RPSBLAST alignment for GI: 254780627 and conserved domain: COG0593

>gnl|CDD|30938 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]. Length = 408
 Score =  378 bits (972), Expect = e-105
 Identities = 187/459 (40%), Positives = 268/459 (58%), Gaps = 56/459 (12%)

Query: 42  VSSRLKNQVGPDVYASWFQRLKFHSVLHNIVHLSVPTNFLKAWIKNRYLETITKLFQEEH 101
           V +RLK ++G   + SW + LK      +++ L  P  F++ W+ ++ L+ I +L QE  
Sbjct: 4   VLARLKKELGETEFESWIRPLKVEE---SVLVLYAPNEFVRNWLNSK-LDLIKELLQELD 59

Query: 102 SRIQGVEILVRSVALPSVEKTASSPSITKLSPINTNISKSPIILGKQTISPVFGSPLDSR 161
             I+             V  +A +                              S L+ +
Sbjct: 60  GIIK-----------VEVRASAPAQLP-------------------------LPSGLNPK 83

Query: 162 FVFSTFIEGSSNRVALTAAQSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQAIANASI 221
           + F  F+ G SNR+A  AA+++AE     Y     NPLFI+  VGLGKTHLLQAI N ++
Sbjct: 84  YTFDNFVVGPSNRLAYAAAKAVAENPGGAY-----NPLFIYGGVGLGKTHLLQAIGNEAL 138

Query: 222 KRQPNLRVVYLTAEYFMWRFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGK-LIQHEF 280
              PN RVVYLT+E F   F  A+RDN     K+   ++DLLLIDD+QFL GK   Q EF
Sbjct: 139 ANGPNARVVYLTSEDFTNDFVKALRDNEMEKFKEKY-SLDLLLIDDIQFLAGKERTQEEF 197

Query: 281 CHLLNSLLDSAKQVVAAADRPPSELESLDPRIRSRLQGGVSVPLGLHDYEMRFSILKNRL 340
            H  N+LL++ KQ+V  +DRPP EL  L+ R+RSRL+ G+ V +   D E R +IL+ + 
Sbjct: 198 FHTFNALLENGKQIVLTSDRPPKELNGLEDRLRSRLEWGLVVEIEPPDDETRLAILRKK- 256

Query: 341 AISQKEDPKLNINEEVLMHVARTVTTSGRELDGAFNQLVFRHSFAPI-LTAEIADELLSH 399
                ED  + I +EVL  +A+ +  + REL+GA N+L     F    +T ++  E+L  
Sbjct: 257 ----AEDRGIEIPDEVLEFLAKRLDRNVRELEGALNRLDAFALFTKRAITIDLVKEILKD 312

Query: 400 LVNTGETKKMRIEDIQRMVAKHYNISRNDLLSNRRVRTVVRPRQVAMYLSKIMTPRSFPE 459
           L+  GE  K+ IEDIQ++VA++YN+  +DLLS  R R +VRPRQ+AMYL++ +T  S PE
Sbjct: 313 LLRAGE--KITIEDIQKIVAEYYNVKVSDLLSKSRTRNIVRPRQIAMYLARELTNLSLPE 370

Query: 460 IGRRFGDRDHTTVLHAVRKVEKMLETDITLKKEVELLKR 498
           IG+ FG RDHTTVLHAVRK+E+++E D +LK+E+ELLKR
Sbjct: 371 IGKAFG-RDHTTVLHAVRKIEQLIEEDDSLKEEIELLKR 408