HHsearch alignment for GI: 254780629 and conserved domain: PRK00120

>PRK00120 putative deoxyribonucleotide triphosphate pyrophosphatase; Reviewed.
Probab=100.00  E-value=0  Score=468.84  Aligned_cols=197  Identities=49%  Similarity=0.806  Sum_probs=182.7

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCEEEEHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECHHHHHHHHHC
Q ss_conf             67779998499227999999730079199724447885666676554567787653311345630785201243434201
Q gi|254780629|r    5 IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDG   84 (224)
Q Consensus         5 ~~~kii~aT~N~~K~~E~~~iL~~~~i~~~~~~~~~~~~peE~g~tf~eNA~~KA~~~~~~~~~pvlaDDSGL~vdaL~G   84 (224)
T Consensus         1 Mm~ki~~aT~N~~K~~E~~~il~~~~~~i~~~~d~~~~e~~E~g~t~~eNA~~KA~~~~~~~~~pvlaDDSGL~i~aL~g   80 (197)
T PRK00120          1 MMKKLVLASHNAGKLRELAALLAPFGLEVVSQGELGLPEPEETGLTFVENALIKARHAAKATGLPALADDSGLAVDALGG   80 (197)
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHHCCCEEEEHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCEEEEHHHCC
T ss_conf             98639999298679999999887659889757886999988889779999999999999874897797146799833149


Q ss_pred             CCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCEEEEEEEEEEEEEECCCCCCCCC
Q ss_conf             44514344304578868889999998877752135677765068998620132342104564333249982641178857
Q gi|254780629|r   85 KPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFG  164 (224)
Q Consensus        85 ~PGvySaR~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~R~A~f~~~~~~~~~~~~~~~f~G~~~G~I~~~prG~~GFG  164 (224)
T Consensus        81 ~PGvySar~ag~~~~d~~~---~~~ll~~l~~~---~~~~r~A~f~~~i~~~~~~~~~~~f~G~~~G~I~~~~rG~~GFG  154 (197)
T PRK00120         81 APGVYSARYAGEHGNDAAN---NEKLLEELRDV---PDEDRSARFVCVLVLAWPDGHPLVAEGEWEGTIVWEPRGEGGFG  154 (197)
T ss_pred             CCCCCEEEHHHHCCCHHHH---HHHHHHHHHCC---CCCCCEEEEEEEEEEEECCCEEEEEEEEEEEEEEECCCCCCCCC
T ss_conf             9983111044427889999---99999997568---85554499999999995798189997178899976661799989


Q ss_pred             CCEEEEECCCCCCHHHCCHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             2313665699847776898785012123222332334352589999999999998764
Q gi|254780629|r  165 YDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID  222 (224)
Q Consensus       165 yDpIF~p~g~~kT~aEm~~~eKn~~~~~~~~~~~~~~~~iSHR~~Al~kl~~~l~~~~  222 (224)
T Consensus       155 yDpIF~p~g~~kTfaEm~~~eKn~---------------iSHR~~A~~kl~~~L~~l~  197 (197)
T PRK00120        155 YDPLFFPPGYGKTFAELTPEEKNA---------------ISHRARALKKLLEALLNLA  197 (197)
T ss_pred             CCCEEEECCCCCCHHCCCHHHHHH---------------HCHHHHHHHHHHHHHHHHC
T ss_conf             883188899997452399899766---------------4989999999999998329