HHsearch alignment for GI: 254780629 and conserved domain: PRK01946

>PRK01946 consensus.
Probab=94.64  E-value=0.27  Score=28.10  Aligned_cols=113  Identities=17%  Similarity=0.164  Sum_probs=60.2

Q ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHCCCE--EEEHHHCCCCCC-CCCC-CCHHHHHHHHHHHHCC--CCCCEEEEECH
Q ss_conf             6656777999849922799999973007919--972444788566-6676-5545677876533113--45630785201
Q gi|254780629|r    2 RKLIENNIVIASHNVDKIHEMDSLIMPLGIM--TTSALELNLIIP-EETG-NSFEENAMIKSLTAAK--NAGMPALSDDS   75 (224)
Q Consensus         2 ~~~~~~kii~aT~N~~K~~E~~~iL~~~~i~--~~~~~~~~~~~p-eE~g-~tf~eNA~~KA~~~~~--~~~~pvlaDDS   75 (224)
T Consensus         4 ~~l~~~~iILAS~Sp~R~~----lL~~~gi~f~v~~~~~~dE~~~~~~~~~~~~~~lA~~KA~~v~~~~~~~~lVI~aDt   79 (195)
T PRK01946          4 ENLKKYKIILASGSPRRKE----LLSGLGIDFEVRTLPDVDESYPDTLQREEIPLYLARLKAEAYRSMMKPNELLITADT   79 (195)
T ss_pred             HHHCCCEEEEECCCHHHHH----HHHHCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECE
T ss_conf             7620897999789999999----999779997894389988888888898899999999999999972489988998473


Q ss_pred             HHHHHHHHCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCC
Q ss_conf             24343420144514344304578868889999998877752135677765068998620132342
Q gi|254780629|r   76 GLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDG  140 (224)
Q Consensus        76 GL~vdaL~G~PGvySaR~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~R~A~f~~~~~~~~~~~  140 (224)
T Consensus        80 vv~---~~g~-------i~~KP~~~---~eA~~~L-~~ls--------Gk~h~v~T~v~v~~~~~  122 (195)
T PRK01946         80 IVW---LDGK-------ALGKPKDR---EEAVEML-RSLS--------GKTHQVITGVCFTTKEK  122 (195)
T ss_pred             EEE---ECCE-------EECCCCCH---HHHHHHH-HHHC--------CCCEEEEEEEEEEECCE
T ss_conf             998---8999-------97698999---9999999-9978--------99769999999998992