HHsearch alignment of GI: 254780629 and MMDB domain: 2car_A_

>2car_A (A:) Inosine triphosphate pyrophosphatase; hydrolase, inosine triphosphate pyrophosphohydrolase, inosine triphosphatase deficiency, ITP, IMP; 1.09A {Homo sapiens}
Probab=100.00  E-value=0  Score=407.37  Aligned_cols=189  Identities=29%  Similarity=0.411  Sum_probs=169.3

Q ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECHHHHHHH
Q ss_conf             66567779998499227999999730079199724447885666676554567787653311345630785201243434
Q gi|254780629|r    2 RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDV   81 (224)
Q Consensus         2 ~~~~~~kii~aT~N~~K~~E~~~iL~~~~i~~~~~~~~~~~~peE~g~tf~eNA~~KA~~~~~~~~~pvlaDDSGL~vda   81 (224)
                      |+|||++|+|||+|+||++|++.+|.++++.++.+.+++   ++|++.||+|||++||+++++.++.|||||||||||+|
T Consensus         5 ~~~~~~~i~~aT~N~~K~~E~~~il~~~~~~~i~~~~~d---~~E~~~t~~enA~~KA~~~~~~~~~pviaDDSGL~i~a   81 (196)
T 2car_A            5 ASLVGKKIVFVTGNAKKLEEVVQILGDKFPCTLVAQKID---LPEYQGEPDEISIQKCQEAVRQVQGPVLVEDTCLCFNA   81 (196)
T ss_dssp             HHHTTCEEEEECSCHHHHHHHHHHHCTTCCSEEEEECCC---CCCBCSCHHHHHHHHHHHHHHHHSSCEEEEEEEEEEGG
T ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHHCCCCEEECHHCCC---CCCCCCCHHHHHHHHHHHHHHHHHHHHEECCHHHHHHH
T ss_conf             433499799983998999999998315077010320179---88768861788887667777766555200002546767


Q ss_pred             HHCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEECCCC--CCCEEEEEEEEEEEEEECCCC
Q ss_conf             201445143443045788688899999988777521356777650689986201323--421045643332499826411
Q gi|254780629|r   82 LDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRG  159 (224)
Q Consensus        82 L~G~PGvySaR~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~R~A~f~~~~~~~~~--~~~~~~f~G~~~G~I~~~prG  159 (224)
                      |||+|||||+||++..        ..+++++.+..     ..+|+|+|+|+++++++  ++.+.+|+|.|+|.|+ +|||
T Consensus        82 L~g~PGvys~r~~~~~--------~~~~ll~~l~~-----~~~r~a~~~~~~~~~~~~~~~~~~~f~G~~~G~I~-e~rG  147 (196)
T 2car_A           82 LGGLPGPYIKWFLEKL--------KPEGLHQLLAG-----FEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIV-APRG  147 (196)
T ss_dssp             GTTCEETTHHHHHHHH--------HHHHHHHTTTT-----CSCCEEEEEEEEEEECSCSSCCCEEEEEEEEEEEC-SCCS
T ss_pred             HHHHHHHHHHHHHHHH--------HHHHHHHHHHC-----CCCCCCEEEEEEEEEECCCCCCCEEEEEEECCCCC-CCCC
T ss_conf             7655678869999851--------03667777405-----65454226899998604568873389987424112-2424


Q ss_pred             CCCCCCCEEEEECCCCCCHHHCCHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             788572313665699847776898785012123222332334352589999999999998764
Q gi|254780629|r  160 QLGFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID  222 (224)
Q Consensus       160 ~~GFGyDpIF~p~g~~kT~aEm~~~eKn~~~~~~~~~~~~~~~~iSHR~~Al~kl~~~l~~~~  222 (224)
                      ++||||||||+|+|+++|||||+.+|||+               +|||++|+++|+++|.++.
T Consensus       148 ~~gfGyDpiF~p~g~~kT~aEl~~~eK~~---------------iSHR~~A~~~l~~~L~ei~  195 (196)
T 2car_A          148 CQDFGWDPCFQPDGYEQTYAEMPKAEKNA---------------VSHRFRALLELQEYFGSLA  195 (196)
T ss_dssp             CTTSTTGGGEEETTCSSCTTTSCHHHHHH---------------HCHHHHHHHHHHHHHCSSC
T ss_pred             CCCCCCCCEEECCCCCCCHHHCCHHHHHH---------------CCHHHHHHHHHHHHHHHHC
T ss_conf             68899870676089995453099999754---------------3999999999999999701