HHsearch results for GI: 254780629 and protein with PDBid: 1b78_A

>1b78_A Pyrophosphatase; structural genomics, hyperthermal protein; 2.20A {Methanocaldococcus jannaschii} SCOP: c.51.4.1 PDB: 2mjp_A*
Probab=100.00  E-value=0  Score=396.94  Aligned_cols=188  Identities=32%  Similarity=0.440  Sum_probs=158.2

Q ss_pred             CCCCC--CCEEEEECCCCCHHHHHHHHHHHCCCEEEEHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECHHHH
Q ss_conf             96656--7779998499227999999730079199724447885666676554567787653311345630785201243
Q gi|254780629|r    1 MRKLI--ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLV   78 (224)
Q Consensus         1 m~~~~--~~kii~aT~N~~K~~E~~~iL~~~~i~~~~~~~~~~~~peE~g~tf~eNA~~KA~~~~~~~~~pvlaDDSGL~   78 (224)
                      |++.+  |++|+|||+|+||++|++.+|.++++..+  ..++++.| |++.||+|||++||++++++++.||||||||||
T Consensus         1 ~~~~~~~mMkI~~aT~N~~K~~E~~~lL~~l~~~~~--~~~~~~~~-E~~~t~~enA~~Ka~~~~~~~~~pvlaDDSGL~   77 (193)
T 1b78_A            1 MQRTLGEIMKIYFATGNPNKIKEANIILKDLKDVEI--EQIKISYP-EIQGTLEEVAEFGAKWVYNILKKPVIVEDSGFF   77 (193)
T ss_dssp             ---------CEEEECSCHHHHHHHHHHTTTCTTCCE--EEECCCCC-CBSSCHHHHHHHHHHHHHHHHCSCEEEEEEEEE
T ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHHCCCCCE--ECCCCCCC-CCCCCHHHHHHHHHHHHHHCCCCCEEEECCEEE
T ss_conf             975426842899988987899999998866788520--00467888-668888999999898755304785788536798


Q ss_pred             HHHHHCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCEEEEEEEEEEEEEECCC
Q ss_conf             43420144514344304578868889999998877752135677765068998620132342104564333249982641
Q gi|254780629|r   79 IDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPR  158 (224)
Q Consensus        79 vdaL~G~PGvySaR~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~R~A~f~~~~~~~~~~~~~~~f~G~~~G~I~~~pr  158 (224)
                      |+||||+|||||+||+... +   .    +.+...+.     ...+|+|+|+|+++++++++ +.+|+|.|+|.|+.+|+
T Consensus        78 v~aL~g~PGiys~~~~~~~-~---~----~~~~~~l~-----~~~~r~a~f~~~~~~~~~~~-~~~f~G~~~G~I~~~~~  143 (193)
T 1b78_A           78 VEALNGFPGTYSKFVQETI-G---N----EGILKLLE-----GKDNRNAYFKTVIGYCDENG-VRLFKGIVKGRVSEEIR  143 (193)
T ss_dssp             EGGGTTCEETTHHHHHHHT-H---H----HHHHHHHT-----TCSCCEEEEEEEEEEEETTE-EEEEEEEEEEEECSSCC
T ss_pred             EHHHCCCCCCEEHHHHHHC-C---C----HHHHHHHH-----CCCHHHHHHHHHHHHHCCCE-EEEEEEEEEEEEEEEEC
T ss_conf             7542299850227756647-8---6----99998740-----65236788988765411331-79852689999987336


Q ss_pred             CCC-CCCCCEEEEECCCCCCHHHCCHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             178-85723136656998477768987850121232223323343525899999999999987
Q gi|254780629|r  159 GQL-GFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR  220 (224)
Q Consensus       159 G~~-GFGyDpIF~p~g~~kT~aEm~~~eKn~~~~~~~~~~~~~~~~iSHR~~Al~kl~~~l~~  220 (224)
                      |.+ ||||||||+|+|+++|||||+.+|||+               ||||++|+++|+++|++
T Consensus       144 g~~~GfGyDpIFip~~~~kT~aEm~~~eKn~---------------iSHR~~Al~~l~~~L~e  191 (193)
T 1b78_A          144 SKGYGFAYDSIFIPEEEERTFAEMTTEEKSQ---------------ISHRKKAFEEFKKFLLD  191 (193)
T ss_dssp             CSSCCSGGGGSEEETTCSSCGGGSCHHHHTT---------------TSHHHHHHHHHHHHHHT
T ss_pred             CCCCCCCCCCEEEECCCCCEEECCCHHHHHH---------------CCHHHHHHHHHHHHHHH
T ss_conf             5899989895698799994512299899767---------------49799999999999885