HHsearch results for GI: 254780629 and protein with PDBid: 1v7r_A

>1v7r_A Hypothetical protein PH1917; ntpase, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; HET: CIT; 1.40A {Pyrococcus horikoshii OT3} SCOP: c.51.4.1 PDB: 2dvn_A* 2dvo_A* 2dvp_A 2ehk_A 2zti_A 2e5x_A*
Probab=100.00  E-value=0  Score=395.59  Aligned_cols=185  Identities=33%  Similarity=0.456  Sum_probs=164.6

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCEEEEHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECHHHHHHHHHCCC
Q ss_conf             77999849922799999973007919972444788566667655456778765331134563078520124343420144
Q gi|254780629|r    7 NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKP   86 (224)
Q Consensus         7 ~kii~aT~N~~K~~E~~~iL~~~~i~~~~~~~~~~~~peE~g~tf~eNA~~KA~~~~~~~~~pvlaDDSGL~vdaL~G~P   86 (224)
                      +||+|||+|+||++|++.+|.+++++++++   +.+.|++++.++++||..||++++++++.|+||||||||||||||+|
T Consensus         1 Mki~~aT~N~~K~~E~~~lL~~~~i~~~~~---~~~~~e~~~~~~~~~a~~ka~~~~~~~~~p~iaDDSGL~vdaL~g~P   77 (186)
T 1v7r_A            1 MKIFFITSNPGKVREVANFLGTFGIEIVQL---KHEYPEIQAEKLEDVVDFGISWLKGKVPEPFMIEDSGLFIESLKGFP   77 (186)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHTTTCEEEEE---CCCCCCCCCSSHHHHHHHHHHHHTTTSCSSEEEEEEEEEEGGGTTTB
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEC---CCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCEEEEHHHCCCC
T ss_conf             979998799899999999750649879866---87887778732899999999998886359678714568865318998


Q ss_pred             CHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCEEEEEEEEEEEEEECCCCCCCCCCC
Q ss_conf             51434430457886888999999887775213567776506899862013234210456433324998264117885723
Q gi|254780629|r   87 GIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYD  166 (224)
Q Consensus        87 GvySaR~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~R~A~f~~~~~~~~~~~~~~~f~G~~~G~I~~~prG~~GFGyD  166 (224)
                      |||||||+...    +    .+.+...+.     ...+|+|+|+|+++++. ++.+++|+|+|+|+|+.+|||++|||||
T Consensus        78 Gv~sar~~~~~----~----~~~l~~~l~-----~~~~r~a~~~~~~~~~~-~~~~~~~~G~~~G~I~~~~rG~~GFGyD  143 (186)
T 1v7r_A           78 GVYSSYVYRTI----G----LEGILKLME-----GAEDRRAYFKSVIGFYI-DGKAYKFSGVTWGRISNEKRGTHGFGYD  143 (186)
T ss_dssp             GGGHHHHHHHT----H----HHHHHHHTT-----TCSCCEEEEEEEEEEEE-TTEEEEEEEEEEEEECSSCCCSSSCTTG
T ss_pred             CCCCHHHHHHH----H----HHHHHHHHC-----CCCHHHHEEEEEEEECC-CCCEEEEEEEEEEEEEECCCCCCCCCCC
T ss_conf             54129988764----0----878999831-----74032220057898518-9845899989976897547789988858


Q ss_pred             EEEEECCCCCCHHHCCHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             136656998477768987850121232223323343525899999999999987644
Q gi|254780629|r  167 PIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE  223 (224)
Q Consensus       167 pIF~p~g~~kT~aEm~~~eKn~~~~~~~~~~~~~~~~iSHR~~Al~kl~~~l~~~~e  223 (224)
                      |||+|+|+++|||||+.+|||+               ||||++|+++|+++|.+..+
T Consensus       144 piF~p~g~~kT~aEm~~~eKn~---------------iSHR~~A~~kl~~~L~~~l~  185 (186)
T 1v7r_A          144 PIFIPEGSEKTFAEMTIEEKNA---------------LSHRGKALKAFFEWLKVNLK  185 (186)
T ss_dssp             GGEEETTCSSCGGGSCHHHHHT---------------TSHHHHHHHHHHHHHHHHHC
T ss_pred             CEEEECCCCCEEEECCHHHHHH---------------CCHHHHHHHHHHHHHHHHHC
T ss_conf             3699899997716599999755---------------49999999999999999737