HHSEARCH alignment of GI: 254780629 and SCOP domain: d1vp2a_

Alignment
>d1vp2a_ c.51.4.1 (A:) Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 {Thermotoga maritima [TaxId: 2336]}
Probab=100.00  E-value=0  Score=410.01  Aligned_cols=188  Identities=32%  Similarity=0.492  Sum_probs=160.3

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHCCCEEEEHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECHHHHHHHHHCC
Q ss_conf             77799984992279999997300791997244478856666765545677876533113456307852012434342014
Q gi|254780629|r    6 ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGK   85 (224)
Q Consensus         6 ~~kii~aT~N~~K~~E~~~iL~~~~i~~~~~~~~~~~~peE~g~tf~eNA~~KA~~~~~~~~~pvlaDDSGL~vdaL~G~   85 (224)
                      +++|+|||+|+||++|++.+|.. .+.++...  +..+|+|++.||+|||++||++++++++.|||||||||||+||||+
T Consensus         1 km~I~~aT~N~~K~~E~~~il~~-~~~i~~~~--~~~e~~E~~~t~~enA~~KA~~~~~~~~~pvlaDDSGL~v~aL~g~   77 (189)
T d1vp2a_           1 KLTVYLATTNPHKVEEIKMIAPE-WMEILPSP--EKIEVVEDGETFLENSVKKAVVYGKKLKHPVMADDSGLVIYSLGGF   77 (189)
T ss_dssp             CEEEEESCCCHHHHHHHHTTCCT-TEEEEECS--SCCCCCCCCSSHHHHHHHHHHHHHHHHCSCEEEEEEEEEEGGGTTE
T ss_pred             CCEEEEECCCHHHHHHHHHHHHC-CCEEECCC--CCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCEEEEEHHHHH
T ss_conf             95999986987899999998216-98882255--4477666783589888876654303344238861537885212444


Q ss_pred             CCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEECCC-CCCCEEEEEEEEEEEEEECCCCCCCCC
Q ss_conf             4514344304578868889999998877752135677765068998620132-342104564333249982641178857
Q gi|254780629|r   86 PGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAW-PDGHVENFSGKVSGIIVWPPRGQLGFG  164 (224)
Q Consensus        86 PGvySaR~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~R~A~f~~~~~~~~-~~~~~~~f~G~~~G~I~~~prG~~GFG  164 (224)
                      ||||||||++....+..+    ..++..+..      .+|+|+|.|++++++ +++.+.+|+|.|+|+|+.+|||++|||
T Consensus        78 PGvysar~~~~~~~~~~~----~~~~~~~~~------~~~~a~~~~~~~~~~~~~~~~~~f~G~~~G~I~~~~rG~~GFG  147 (189)
T d1vp2a_          78 PGVMSARFMEEHSYKEKM----RTILKMLEG------KDRRAAFVCSATFFDPVENTLISVEDRVEGRIANEIRGTGGFG  147 (189)
T ss_dssp             EGGGTTTTTTTSCHHHHH----HHHHHHTTT------SCCEEEEEEEEEEEETTTTEEEEEEEEEEEEECSSCCCSCSST
T ss_pred             HHHHHHHHHHCCCCCHHH----HHHHHHCCC------CCCCCCEEEEEEEEECCCCCCEEEEEEEEEEEEECCCCCCCCC
T ss_conf             567889997515420567----899874236------5555221457876520354313785689964796466788989


Q ss_pred             CCEEEEECCCCCCHHHCCHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             2313665699847776898785012123222332334352589999999999998764
Q gi|254780629|r  165 YDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID  222 (224)
Q Consensus       165 yDpIF~p~g~~kT~aEm~~~eKn~~~~~~~~~~~~~~~~iSHR~~Al~kl~~~l~~~~  222 (224)
                      |||||+|+|+++|||||+ +|||+               ||||++|+++|+++|.++.
T Consensus       148 yDpiF~p~g~~kT~aEm~-~eKn~---------------iSHR~~A~~kl~~~L~~il  189 (189)
T d1vp2a_         148 YDPFFIPDGYDKTFGEIP-HLKEK---------------ISHRSKAFRKLFSVLEKIL  189 (189)
T ss_dssp             TGGGEEETTCSSCTTTCG-GGHHH---------------HSHHHHHHHHHHHHHHHHC
T ss_pred             CCEEEEECCCCCCHHHCH-HHHHH---------------CCHHHHHHHHHHHHHHHHC
T ss_conf             872898789996366497-66876---------------5989999999999999769


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Anticodon-binding domain-like
superfamily: ITPase-like
family: ITPase (Ham1)
domain: Putative inosine/xanthosine triphosphate pyrophosphatase TM0159
species: Thermotoga maritima [TaxId: 2336]