BLAST/PSIBLAST alignment of GI: 254780629 and GI: 209547616 at iteration 1
>gi|209547616|ref|YP_002279533.1| deoxyribonucleotide triphosphate pyrophosphatase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 214
>gi|209533372|gb|ACI53307.1| Ham1 family protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 214
 Score =  275 bits (703), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 131/219 (59%), Positives = 156/219 (71%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI PLG    SA ELN + P+ETG SFEENA IK++
Sbjct: 1   MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPDETGTSFEENATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  AGMPALSDDSGLV+D LDG PG+++A WAE++ G RDFDMAM K+E AL+   A 
Sbjct: 61  ASANAAGMPALSDDSGLVVDALDGDPGVYTANWAETSNGTRDFDMAMAKVEKALQDAGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGH E F G+V G +VWPPRG  GFGYDP+FQP GY  TFGE
Sbjct: 121 TPEQRTARFVSVLCLAWPDGHTELFRGEVEGSVVWPPRGGQGFGYDPVFQPEGYGVTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+G       +S+     LSHRARAFK FV+ CL
Sbjct: 181 MSGEEKHG-------WSVGKPQALSHRARAFKLFVETCL 212