BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780629|ref|YP_003065042.1| putative deoxyribonucleotide
triphosphate pyrophosphatase [Candidatus Liberibacter asiaticus str.
psy62]
         (224 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780629|ref|YP_003065042.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040306|gb|ACT57102.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 224

 Score =  463 bits (1191), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/224 (100%), Positives = 224/224 (100%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL
Sbjct: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH
Sbjct: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE
Sbjct: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK
Sbjct: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224


>gi|315121830|ref|YP_004062319.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495232|gb|ADR51831.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 223

 Score =  343 bits (881), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 161/224 (71%), Positives = 192/224 (85%), Gaps = 1/224 (0%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL+E +IVIASHN DKIHE+ +L+ PLGI+T SALEL+L++PEETG++FEENA+IK+L
Sbjct: 1   MRKLVEKSIVIASHNYDKIHEIRNLVAPLGIVTKSALELDLVVPEETGDTFEENAIIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           +AA+ AG+PAL+DDSGLV+D LDGKPGI+SARWAE++TGERDF MAMQKIE  L S+ A+
Sbjct: 61  SAAQCAGIPALADDSGLVVDALDGKPGIYSARWAETSTGERDFYMAMQKIEEHLISQGAN 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P+ R AHFIS L LAWPDGHVE F G+V GIIVWPPRGQLGFGYDPIFQPNGYDRTFGE
Sbjct: 121 APSLRFAHFISALCLAWPDGHVEKFCGRVDGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           MTE+EKNG I +  + S    DL+SHRARAFKC  D+CL +DEK
Sbjct: 181 MTEKEKNGEI-TREILSRSRDDLVSHRARAFKCLFDSCLCVDEK 223


>gi|209547616|ref|YP_002279533.1| deoxyribonucleotide triphosphate pyrophosphatase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209533372|gb|ACI53307.1| Ham1 family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 214

 Score =  275 bits (703), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 131/219 (59%), Positives = 156/219 (71%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI PLG    SA ELN + P+ETG SFEENA IK++
Sbjct: 1   MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPDETGTSFEENATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  AGMPALSDDSGLV+D LDG PG+++A WAE++ G RDFDMAM K+E AL+   A 
Sbjct: 61  ASANAAGMPALSDDSGLVVDALDGDPGVYTANWAETSNGTRDFDMAMAKVEKALQDAGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGH E F G+V G +VWPPRG  GFGYDP+FQP GY  TFGE
Sbjct: 121 TPEQRTARFVSVLCLAWPDGHTELFRGEVEGSVVWPPRGGQGFGYDPVFQPEGYGVTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+G       +S+     LSHRARAFK FV+ CL
Sbjct: 181 MSGEEKHG-------WSVGKPQALSHRARAFKLFVETCL 212


>gi|15964127|ref|NP_384480.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sinorhizobium meliloti 1021]
 gi|307301272|ref|ZP_07581034.1| Ham1 family protein [Sinorhizobium meliloti BL225C]
 gi|307317943|ref|ZP_07597380.1| Ham1 family protein [Sinorhizobium meliloti AK83]
 gi|22653764|sp|Q92SK4|NTPA_RHIME RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|15073303|emb|CAC41811.1| HAM1 NTPase family protein [Sinorhizobium meliloti 1021]
 gi|306896345|gb|EFN27094.1| Ham1 family protein [Sinorhizobium meliloti AK83]
 gi|306903728|gb|EFN34315.1| Ham1 family protein [Sinorhizobium meliloti BL225C]
          Length = 214

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 127/219 (57%), Positives = 158/219 (72%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+LI+  +V+ASHN  KI E+  LI PLG    SA +LN + P+ETG +FEENA IK+L
Sbjct: 1   MRRLIDKTLVVASHNAGKIREIRDLIGPLGFEAKSAADLNFVEPDETGTTFEENATIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +AK +G+PALSDDSGL +D L G PG+++A WAE   G RDF MAM+K+E ALR+K A 
Sbjct: 61  ASAKASGLPALSDDSGLAVDALGGAPGVYTANWAEREDGSRDFQMAMEKVEEALRAKGAV 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGHVE F G+V G +VWPPRG  GFGYDP+FQP GYD TFGE
Sbjct: 121 KPESRTARFVSVLCLAWPDGHVELFRGEVEGYVVWPPRGTSGFGYDPVFQPKGYDTTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+G       +    ++ LSHRARAFK F + CL
Sbjct: 181 MSAEEKHG-------WKPGDSEALSHRARAFKLFAETCL 212


>gi|116250147|ref|YP_765985.1| deoxyribonucleotide triphosphate pyrophosphatase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|241202759|ref|YP_002973855.1| deoxyribonucleotide triphosphate pyrophosphatase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|115254795|emb|CAK05869.1| putative HAM1 family protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|240856649|gb|ACS54316.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 214

 Score =  271 bits (692), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 154/219 (70%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI PLG    SA ELN + P+ETG SFEENA IK++
Sbjct: 1   MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPDETGTSFEENATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  +GMPALSDDSGLV+D L G PG+++A WAE   G RDFDMAM K+E AL+   A 
Sbjct: 61  ASANASGMPALSDDSGLVVDALGGDPGVYTANWAEKADGTRDFDMAMAKVEKALQDAGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A FISVL LAWPDGH E F G+V G +VWPPRG  GFGYDP+FQP GYD TFGE
Sbjct: 121 KPEQRTARFISVLCLAWPDGHTELFRGEVEGSVVWPPRGTQGFGYDPVFQPEGYDITFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+G       +++     LSHRARAFK FV+ CL
Sbjct: 181 MSGEEKHG-------WNVGKPQALSHRARAFKLFVETCL 212


>gi|218661635|ref|ZP_03517565.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhizobium etli IE4771]
          Length = 214

 Score =  270 bits (689), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 153/219 (69%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI PLG    SA ELN + P+ETG SFEENA IK++
Sbjct: 1   MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVAPDETGTSFEENATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  AGMPALSDDSGLV+D L G PG+++A WAE   G RDFDMAM K+E AL+   A 
Sbjct: 61  ASAHAAGMPALSDDSGLVVDALGGDPGVYTANWAERADGTRDFDMAMAKVEKALQDAGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGH E F G+V G +VWPPRG  GFGYDP+FQP GY  TFGE
Sbjct: 121 TPEQRTARFVSVLCLAWPDGHTELFRGEVEGNVVWPPRGTQGFGYDPVFQPEGYGVTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+G       ++I     LSHRARAFK FV+ CL
Sbjct: 181 MSGEEKHG-------WNIGKPQALSHRARAFKLFVETCL 212


>gi|159184260|ref|NP_353358.2| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Agrobacterium tumefaciens str. C58]
 gi|22653753|sp|Q8UIG9|NTPA_AGRT5 RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|159139587|gb|AAK86143.2| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Agrobacterium tumefaciens str. C58]
          Length = 214

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 131/219 (59%), Positives = 155/219 (70%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI P G    SA ELN   PEETG +FEENA IK+L
Sbjct: 1   MRKLDTRTIVVASHNKGKIAEIADLIGPFGFSAKSAAELNFSEPEETGTTFEENAAIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +AK +G+PALSDDSGLVID LDG PG+++A WAE+  G RDF MAMQK+E+AL  + A 
Sbjct: 61  ASAKASGLPALSDDSGLVIDALDGAPGVYTANWAETADGTRDFAMAMQKVEDALAERGAS 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGHVE F G+V G +VWPPRG  GFGYDPIF+P+GYD TFGE
Sbjct: 121 KPEDRTARFVSVLCLAWPDGHVEYFRGEVEGTVVWPPRGTSGFGYDPIFKPDGYDTTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ +EK+G               LSHRARAFK FV+ CL
Sbjct: 181 MSADEKHGWKHGDAF-------ALSHRARAFKKFVETCL 212


>gi|190890030|ref|YP_001976572.1| nucleoside-triphosphatase, HAM1-like protein [Rhizobium etli CIAT
           652]
 gi|218516542|ref|ZP_03513382.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhizobium etli 8C-3]
 gi|190695309|gb|ACE89394.1| probable nucleoside-triphosphatase protein, HAM1-like protein
           [Rhizobium etli CIAT 652]
          Length = 214

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 153/219 (69%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI PLG    SA ELN + P+ETG SFEENA IK++
Sbjct: 1   MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPDETGTSFEENATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  AGMPALSDDSGLV+D L G PG+++A WAE   G RDFDMAM K+E AL+   A 
Sbjct: 61  ASAHAAGMPALSDDSGLVVDALGGDPGVYTANWAEKADGTRDFDMAMAKVEKALQDAGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGH E F G+V G +VWPPRG  GFGYDP+FQP GY  TFGE
Sbjct: 121 APEQRTARFVSVLCLAWPDGHTELFRGEVEGNVVWPPRGTQGFGYDPVFQPEGYGVTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+G       ++I     LSHRARAFK FV+ CL
Sbjct: 181 MSGEEKHG-------WNIGKPQALSHRARAFKLFVETCL 212


>gi|86356018|ref|YP_467910.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhizobium etli CFN 42]
 gi|86280120|gb|ABC89183.1| probable nucleoside-triphosphatase HAM1-like protein [Rhizobium
           etli CFN 42]
          Length = 214

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 129/219 (58%), Positives = 152/219 (69%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI PLG    SA ELN + P+ETG SFEENA IK++
Sbjct: 1   MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPDETGTSFEENATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  AGMPALSDDSGLV+D L G PG+++A WAE   G RDFDMAM K+E AL+   A 
Sbjct: 61  ASANAAGMPALSDDSGLVVDALGGDPGVYTANWAEKADGTRDFDMAMAKVEKALQEAGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F+SVL LAWPDGH E F G+V G +VWPPRG  GFGYDP+FQP GY  TFGE
Sbjct: 121 TPEQRGARFVSVLCLAWPDGHTELFRGEVEGHVVWPPRGTQGFGYDPVFQPEGYAVTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+G       +++     LSHRARAFK FV+ CL
Sbjct: 181 MSGEEKHG-------WNVGKPQALSHRARAFKLFVETCL 212


>gi|218459792|ref|ZP_03499883.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhizobium etli Kim 5]
          Length = 214

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 153/219 (69%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI PLG    SA ELN + P+ETG SFEENA IK++
Sbjct: 1   MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPDETGTSFEENATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  AGMPALSDDSGLV+D L G PG+++A WAE   G RDFDMAM K+E AL+   A 
Sbjct: 61  ASAHAAGMPALSDDSGLVVDALGGDPGVYTANWAERADGTRDFDMAMAKVEKALQDAGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGH E F G+V G +VWPPRG  GFGYDP+FQP GY  TFGE
Sbjct: 121 TPEQRTARFVSVLCLAWPDGHTELFRGEVEGNVVWPPRGTQGFGYDPVFQPEGYGVTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+G       ++I     LSHRARAFK FV+ CL
Sbjct: 181 MSGEEKHG-------WNIGKPQALSHRARAFKLFVETCL 212


>gi|150395236|ref|YP_001325703.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sinorhizobium medicae WSM419]
 gi|150026751|gb|ABR58868.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sinorhizobium medicae WSM419]
          Length = 214

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 129/219 (58%), Positives = 155/219 (70%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+L +  +V+ASHN  KI E+  LI PLG    SA +LN I PEETG +FEENA IK+L
Sbjct: 1   MRRLSDKTLVVASHNAGKIREIRDLIGPLGFEAKSAADLNFIEPEETGTTFEENAAIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +AK +G+PALSDDSGLVID L G PG+++A WAE   G RDF MAM+K+E ALR K A 
Sbjct: 61  ASAKASGLPALSDDSGLVIDALGGAPGVYTANWAEREDGSRDFQMAMEKVEEALRDKGAV 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGHVE F G+V G +VWPPRG  GFGYDP+FQP GY+ TFGE
Sbjct: 121 MPESRTARFVSVLCLAWPDGHVELFRGEVEGTVVWPPRGTSGFGYDPVFQPKGYNTTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M  EEK+G       +     + LSHRARAFK F + CL
Sbjct: 181 MRAEEKHG-------WKPGDPEALSHRARAFKLFAETCL 212


>gi|325291760|ref|YP_004277624.1| deoxyribonucleotide triphosphate pyrophosphatase [Agrobacterium sp.
           H13-3]
 gi|325059613|gb|ADY63304.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Agrobacterium sp. H13-3]
          Length = 214

 Score =  267 bits (682), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 129/219 (58%), Positives = 153/219 (69%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI P G    SA ELN + P+ETG +FEENA IK+L
Sbjct: 1   MRKLDTRTIVVASHNKGKIAEIADLIGPFGFSAKSAAELNFVEPDETGTTFEENAAIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +AK +G+PALSDDSGLVID LDG PG+++A WAE+  G RDF MAMQK+E+AL  + A 
Sbjct: 61  ASAKASGLPALSDDSGLVIDALDGAPGVYTANWAETADGTRDFAMAMQKVEDALAERGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+  F+SVL LAWPDGHVE F G+V G + WPPRG  GFGYDPIF+P GYD TFGE
Sbjct: 121 KPEDRTGRFVSVLCLAWPDGHVEYFRGEVEGTVAWPPRGTSGFGYDPIFKPEGYDTTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT +EK+G               LSHRARAFK FV+ CL
Sbjct: 181 MTADEKHGWKHGDAF-------ALSHRARAFKKFVETCL 212


>gi|227820595|ref|YP_002824565.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sinorhizobium fredii NGR234]
 gi|227339594|gb|ACP23812.1| Ham1-like protein [Sinorhizobium fredii NGR234]
          Length = 214

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 157/219 (71%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL++  +V+ASHN  KI E+  LI PLG    SA +LN + P+ETG +FEENA IK+L
Sbjct: 1   MRKLVDKTLVVASHNAGKIREIRDLIGPLGFEAKSAADLNFVEPDETGTTFEENATIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A+ +G+PALSDDSGL ID L G PG+++A WAE + G RDF MAM+K+E  L  K A 
Sbjct: 61  ASARASGLPALSDDSGLAIDALGGAPGVYTANWAERDDGSRDFAMAMEKVERELSEKGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGHVE F G+V G +VWPPRG  GFGYDP+FQP GYD TFGE
Sbjct: 121 KPEERTARFVSVLCLAWPDGHVELFRGEVEGHVVWPPRGTSGFGYDPVFQPTGYDTTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+G       +   +++ LSHRARAFK F + CL
Sbjct: 181 MSAEEKHG-------WKPGNSEALSHRARAFKLFAETCL 212


>gi|222084655|ref|YP_002543184.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Agrobacterium radiobacter K84]
 gi|221722103|gb|ACM25259.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Agrobacterium radiobacter K84]
          Length = 214

 Score =  265 bits (677), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 127/219 (57%), Positives = 151/219 (68%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E++ LI P G    SA +LN I P+ETG +FEENA IK+L
Sbjct: 1   MRKLETKTIVVASHNAGKIREIEDLIGPFGFTAKSAADLNFIEPDETGTTFEENATIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  +G+PALSDDSGLVID L G PG+++A WAE+  G RDF MAMQK+E AL    A 
Sbjct: 61  ASANASGLPALSDDSGLVIDALGGDPGVYTANWAETADGTRDFAMAMQKVETALEKVGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGH E F G+V G + WPPRG  GFGYDPIFQP GY+ TFGE
Sbjct: 121 TPESRTARFVSVLCLAWPDGHTELFRGEVEGTVAWPPRGTQGFGYDPIFQPKGYETTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+G       +       LSHRARAFK FV+ CL
Sbjct: 181 MSAEEKHG-------WKPGDAQALSHRARAFKLFVETCL 212


>gi|222147320|ref|YP_002548277.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Agrobacterium vitis S4]
 gi|221734310|gb|ACM35273.1| non-canonical purine NTP pyrophosphatase rdgB/HAM1 family
           [Agrobacterium vitis S4]
          Length = 214

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 126/219 (57%), Positives = 152/219 (69%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI P G    SA EL  I P+ETG +FEENA IK+L
Sbjct: 1   MRKLETRTIVVASHNAGKIAEIADLIGPFGFTAKSAKELGFIEPDETGTTFEENAAIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +AK +G+PALSDDSGLV+D LDG PG+++A WAE   G RDF MAM+K+E+AL+ K A 
Sbjct: 61  ASAKASGLPALSDDSGLVVDALDGAPGVYTANWAEREDGSRDFAMAMEKVEHALQEKGAV 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R+A F+SVL L WPDGH E F G+V G++ WPPRG  GFGYDPIFQP G+  TFGE
Sbjct: 121 TQESRTARFVSVLCLGWPDGHTEFFRGEVEGVVAWPPRGTSGFGYDPIFQPEGFSTTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT EEK+G       +   +   LSHRARAFK FV+ CL
Sbjct: 181 MTSEEKHG-------WKPGNAQALSHRARAFKLFVETCL 212


>gi|23501086|ref|NP_697213.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           suis 1330]
 gi|62289150|ref|YP_220943.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82699089|ref|YP_413663.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           melitensis biovar Abortus 2308]
 gi|148560455|ref|YP_001258207.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           ovis ATCC 25840]
 gi|161618163|ref|YP_001592050.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           canis ATCC 23365]
 gi|163842444|ref|YP_001626848.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           suis ATCC 23445]
 gi|189023426|ref|YP_001934194.1| deoxyribonucleotide triphosphate pyrophosphatase [Brucella abortus
           S19]
 gi|225851707|ref|YP_002731940.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           melitensis ATCC 23457]
 gi|254690477|ref|ZP_05153731.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           abortus bv. 6 str. 870]
 gi|254694966|ref|ZP_05156794.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           abortus bv. 3 str. Tulya]
 gi|254696597|ref|ZP_05158425.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|254700980|ref|ZP_05162808.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           suis bv. 5 str. 513]
 gi|254705351|ref|ZP_05167179.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           suis bv. 3 str. 686]
 gi|254707136|ref|ZP_05168964.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           pinnipedialis M163/99/10]
 gi|254709321|ref|ZP_05171132.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           pinnipedialis B2/94]
 gi|254713258|ref|ZP_05175069.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           ceti M644/93/1]
 gi|254716389|ref|ZP_05178200.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           ceti M13/05/1]
 gi|254731510|ref|ZP_05190088.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           abortus bv. 4 str. 292]
 gi|256030844|ref|ZP_05444458.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           pinnipedialis M292/94/1]
 gi|256045965|ref|ZP_05448837.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256060314|ref|ZP_05450487.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           neotomae 5K33]
 gi|256158873|ref|ZP_05456727.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           ceti M490/95/1]
 gi|256254250|ref|ZP_05459786.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           ceti B1/94]
 gi|256258733|ref|ZP_05464269.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           abortus bv. 9 str. C68]
 gi|256264781|ref|ZP_05467313.1| nucleoside-triphosphatase [Brucella melitensis bv. 2 str. 63/9]
 gi|256368639|ref|YP_003106145.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           microti CCM 4915]
 gi|260169748|ref|ZP_05756559.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           sp. F5/99]
 gi|260885051|ref|ZP_05896665.1| nucleoside-triphosphatase [Brucella abortus bv. 9 str. C68]
 gi|261221401|ref|ZP_05935682.1| nucleoside-triphosphatase [Brucella ceti B1/94]
 gi|261324289|ref|ZP_05963486.1| nucleoside-triphosphatase [Brucella neotomae 5K33]
 gi|265987902|ref|ZP_06100459.1| nucleoside-triphosphatase [Brucella pinnipedialis M292/94/1]
 gi|265992377|ref|ZP_06104934.1| nucleoside-triphosphatase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265997363|ref|ZP_06109920.1| nucleoside-triphosphatase [Brucella ceti M490/95/1]
 gi|306844442|ref|ZP_07477032.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella sp. BO1]
 gi|54037240|sp|P64306|NTPA_BRUSU RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|54041338|sp|P64305|NTPA_BRUME RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|23346955|gb|AAN29128.1| ham1 protein [Brucella suis 1330]
 gi|62195282|gb|AAX73582.1| ham1 protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615190|emb|CAJ10131.1| Ham1-like protein [Brucella melitensis biovar Abortus 2308]
 gi|148371712|gb|ABQ61691.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Brucella ovis ATCC 25840]
 gi|161334974|gb|ABX61279.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella canis ATCC 23365]
 gi|163673167|gb|ABY37278.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella suis ATCC 23445]
 gi|189018998|gb|ACD71720.1| Ham1-like protein [Brucella abortus S19]
 gi|225640072|gb|ACN99985.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Brucella melitensis ATCC 23457]
 gi|255998797|gb|ACU47196.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           microti CCM 4915]
 gi|260874579|gb|EEX81648.1| nucleoside-triphosphatase [Brucella abortus bv. 9 str. C68]
 gi|260919985|gb|EEX86638.1| nucleoside-triphosphatase [Brucella ceti B1/94]
 gi|261300269|gb|EEY03766.1| nucleoside-triphosphatase [Brucella neotomae 5K33]
 gi|262551831|gb|EEZ07821.1| nucleoside-triphosphatase [Brucella ceti M490/95/1]
 gi|263003443|gb|EEZ15736.1| nucleoside-triphosphatase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263095190|gb|EEZ18859.1| nucleoside-triphosphatase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660099|gb|EEZ30360.1| nucleoside-triphosphatase [Brucella pinnipedialis M292/94/1]
 gi|306275255|gb|EFM57005.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella sp. BO1]
 gi|326537913|gb|ADZ86128.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Brucella melitensis M5-90]
          Length = 220

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 121/221 (54%), Positives = 152/221 (68%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR L +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L
Sbjct: 1   MRMLEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G PALSDDSGL++D LDG+PG+++A WAE+  G+RDFDMAMQK+EN L+ K A 
Sbjct: 61  AAAKATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFDMAMQKVENLLQEKGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F+SV+ LAWPDG  E F G+V G +VWPPRG +GFGYDP+F P+GY +TFGE
Sbjct: 121 TPDKRKARFVSVICLAWPDGEAEYFRGEVEGTLVWPPRGNIGFGYDPVFLPDGYGKTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           MT EEK+G       +       LSHRARAFK F +  L +
Sbjct: 181 MTAEEKHG-------WKPGDASALSHRARAFKLFAEKALNV 214


>gi|239831021|ref|ZP_04679350.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ochrobactrum intermedium LMG 3301]
 gi|239823288|gb|EEQ94856.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ochrobactrum intermedium LMG 3301]
          Length = 224

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 154/222 (69%), Gaps = 7/222 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L
Sbjct: 5   MRKLEQGKLIVASHNAGKLKEFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKAL 64

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+++D LDG PG+++A WAE+  G RDFDMAMQK+EN L+ K A 
Sbjct: 65  AAAEATGLPALSDDSGMMVDALDGDPGVYTANWAETEDGTRDFDMAMQKVENLLQEKGAL 124

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P  R A F+SV+ LAWPDG  E F G+V G IVWPPRG  GFG+DPIF P+GY++TFGE
Sbjct: 125 EPQQRKARFVSVICLAWPDGEAEYFRGEVEGTIVWPPRGNTGFGFDPIFLPDGYEKTFGE 184

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           MT +EK+G       +       LSHRARAFK F +  L ++
Sbjct: 185 MTADEKHG-------WKPGDASALSHRARAFKLFAEKALNVE 219


>gi|17988055|ref|NP_540689.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           melitensis bv. 1 str. 16M]
 gi|225626713|ref|ZP_03784752.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Brucella ceti str. Cudo]
 gi|237814643|ref|ZP_04593641.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella abortus str. 2308 A]
 gi|297247566|ref|ZP_06931284.1| Ham1 family protein [Brucella abortus bv. 5 str. B3196]
 gi|17983803|gb|AAL52953.1| nucleoside-triphosphatase [Brucella melitensis bv. 1 str. 16M]
 gi|225618370|gb|EEH15413.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Brucella ceti str. Cudo]
 gi|237789480|gb|EEP63690.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella abortus str. 2308 A]
 gi|297174735|gb|EFH34082.1| Ham1 family protein [Brucella abortus bv. 5 str. B3196]
          Length = 224

 Score =  258 bits (658), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 121/221 (54%), Positives = 152/221 (68%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR L +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L
Sbjct: 5   MRMLEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKAL 64

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G PALSDDSGL++D LDG+PG+++A WAE+  G+RDFDMAMQK+EN L+ K A 
Sbjct: 65  AAAKATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFDMAMQKVENLLQEKGAT 124

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F+SV+ LAWPDG  E F G+V G +VWPPRG +GFGYDP+F P+GY +TFGE
Sbjct: 125 TPDKRKARFVSVICLAWPDGEAEYFRGEVEGTLVWPPRGNIGFGYDPVFLPDGYGKTFGE 184

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           MT EEK+G       +       LSHRARAFK F +  L +
Sbjct: 185 MTAEEKHG-------WKPGDASALSHRARAFKLFAEKALNV 218


>gi|153007529|ref|YP_001368744.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Ochrobactrum anthropi ATCC 49188]
 gi|151559417|gb|ABS12915.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ochrobactrum anthropi ATCC 49188]
          Length = 220

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 153/222 (68%), Gaps = 7/222 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L
Sbjct: 1   MRKLEQGKLIVASHNAGKLKEFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+++D LDG PG+++A WAE+  G RDFDMAMQK+EN L+ K A 
Sbjct: 61  AAAEATGLPALSDDSGMMVDALDGDPGVYTANWAETEDGTRDFDMAMQKVENLLQEKAAV 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F+SV+ LAWPDG  E F G+V G IVWPPRG  GFG+DPIF P+GY++TFGE
Sbjct: 121 APQQRKARFVSVICLAWPDGEAEYFRGEVEGAIVWPPRGTTGFGFDPIFLPDGYEKTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           MT +EK+G       +       LSHRARAFK F +  L ++
Sbjct: 181 MTADEKHG-------WKPGDASALSHRARAFKLFAEKALNVE 215


>gi|256112678|ref|ZP_05453599.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           melitensis bv. 3 str. Ether]
 gi|265994120|ref|ZP_06106677.1| nucleoside-triphosphatase [Brucella melitensis bv. 3 str. Ether]
 gi|262765101|gb|EEZ11022.1| nucleoside-triphosphatase [Brucella melitensis bv. 3 str. Ether]
          Length = 220

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 152/221 (68%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR L +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L
Sbjct: 1   MRMLEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G PALSDDSGL++D LDG+PG+++A WAE+  G+RDFDMAMQK+EN L+ K A 
Sbjct: 61  AAAKATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFDMAMQKVENLLQEKGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F+SV+ LAWPDG  E F G++ G +VWPPRG +GFGYDP+F P+GY +TFGE
Sbjct: 121 TPDKRKARFVSVICLAWPDGEAEYFRGEMEGTLVWPPRGNIGFGYDPVFLPDGYGKTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           MT EEK+G       +       LSHRARAFK F +  L +
Sbjct: 181 MTAEEKHG-------WKPGDASALSHRARAFKLFAEKALNV 214


>gi|254718389|ref|ZP_05180200.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           sp. 83/13]
 gi|306839622|ref|ZP_07472426.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella sp. NF 2653]
 gi|306405320|gb|EFM61595.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella sp. NF 2653]
          Length = 220

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 121/221 (54%), Positives = 152/221 (68%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR L +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L
Sbjct: 1   MRMLEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G PALSDDSGL++D LDG+PG+++A WAE+  G+RDFDMAMQK+EN L+ K A 
Sbjct: 61  AAAKATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFDMAMQKVENLLQEKGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F+SV+ LAWPDG  E F G+V G +VWPPRG +GFGYDP+F P+GY +TFGE
Sbjct: 121 TPDKRKACFVSVICLAWPDGEAEYFRGEVEGALVWPPRGNIGFGYDPVFLPDGYGKTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           MT EEK+G       +       LSHRARAFK F +  L +
Sbjct: 181 MTAEEKHG-------WKPGDASALSHRARAFKLFAEKALNV 214


>gi|260546449|ref|ZP_05822189.1| nucleoside-triphosphatase [Brucella abortus NCTC 8038]
 gi|260563248|ref|ZP_05833734.1| nucleoside-triphosphatase [Brucella melitensis bv. 1 str. 16M]
 gi|260567188|ref|ZP_05837658.1| nucleoside-triphosphatase [Brucella suis bv. 4 str. 40]
 gi|260756031|ref|ZP_05868379.1| nucleoside-triphosphatase [Brucella abortus bv. 6 str. 870]
 gi|260759255|ref|ZP_05871603.1| nucleoside-triphosphatase [Brucella abortus bv. 4 str. 292]
 gi|260760978|ref|ZP_05873321.1| nucleoside-triphosphatase [Brucella abortus bv. 2 str. 86/8/59]
 gi|261215308|ref|ZP_05929589.1| nucleoside-triphosphatase [Brucella abortus bv. 3 str. Tulya]
 gi|261218175|ref|ZP_05932456.1| nucleoside-triphosphatase [Brucella ceti M13/05/1]
 gi|261314612|ref|ZP_05953809.1| nucleoside-triphosphatase [Brucella pinnipedialis M163/99/10]
 gi|261316832|ref|ZP_05956029.1| nucleoside-triphosphatase [Brucella pinnipedialis B2/94]
 gi|261320977|ref|ZP_05960174.1| nucleoside-triphosphatase [Brucella ceti M644/93/1]
 gi|261751501|ref|ZP_05995210.1| nucleoside-triphosphatase [Brucella suis bv. 5 str. 513]
 gi|261756065|ref|ZP_05999774.1| nucleoside-triphosphatase [Brucella suis bv. 3 str. 686]
 gi|261759289|ref|ZP_06002998.1| nucleoside-triphosphatase [Brucella sp. F5/99]
 gi|294851574|ref|ZP_06792247.1| Ham1 family protein [Brucella sp. NVSL 07-0026]
 gi|306842541|ref|ZP_07475192.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella sp. BO2]
 gi|260096556|gb|EEW80432.1| nucleoside-triphosphatase [Brucella abortus NCTC 8038]
 gi|260153264|gb|EEW88356.1| nucleoside-triphosphatase [Brucella melitensis bv. 1 str. 16M]
 gi|260156706|gb|EEW91786.1| nucleoside-triphosphatase [Brucella suis bv. 4 str. 40]
 gi|260669573|gb|EEX56513.1| nucleoside-triphosphatase [Brucella abortus bv. 4 str. 292]
 gi|260671410|gb|EEX58231.1| nucleoside-triphosphatase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676139|gb|EEX62960.1| nucleoside-triphosphatase [Brucella abortus bv. 6 str. 870]
 gi|260916915|gb|EEX83776.1| nucleoside-triphosphatase [Brucella abortus bv. 3 str. Tulya]
 gi|260923264|gb|EEX89832.1| nucleoside-triphosphatase [Brucella ceti M13/05/1]
 gi|261293667|gb|EEX97163.1| nucleoside-triphosphatase [Brucella ceti M644/93/1]
 gi|261296055|gb|EEX99551.1| nucleoside-triphosphatase [Brucella pinnipedialis B2/94]
 gi|261303638|gb|EEY07135.1| nucleoside-triphosphatase [Brucella pinnipedialis M163/99/10]
 gi|261739273|gb|EEY27269.1| nucleoside-triphosphatase [Brucella sp. F5/99]
 gi|261741254|gb|EEY29180.1| nucleoside-triphosphatase [Brucella suis bv. 5 str. 513]
 gi|261745818|gb|EEY33744.1| nucleoside-triphosphatase [Brucella suis bv. 3 str. 686]
 gi|294820163|gb|EFG37162.1| Ham1 family protein [Brucella sp. NVSL 07-0026]
 gi|306287397|gb|EFM58877.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella sp. BO2]
 gi|326408198|gb|ADZ65263.1| Ham1-like protein [Brucella melitensis M28]
          Length = 218

 Score =  254 bits (648), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 119/218 (54%), Positives = 150/218 (68%), Gaps = 7/218 (3%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           L +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L AA
Sbjct: 2   LEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKALAAA 61

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G PALSDDSGL++D LDG+PG+++A WAE+  G+RDFDMAMQK+EN L+ K A  P 
Sbjct: 62  KATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFDMAMQKVENLLQEKGATTPD 121

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+SV+ LAWPDG  E F G+V G +VWPPRG +GFGYDP+F P+GY +TFGEMT 
Sbjct: 122 KRKARFVSVICLAWPDGEAEYFRGEVEGTLVWPPRGNIGFGYDPVFLPDGYGKTFGEMTA 181

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EEK+G       +       LSHRARAFK F +  L +
Sbjct: 182 EEKHG-------WKPGDASALSHRARAFKLFAEKALNV 212


>gi|265983353|ref|ZP_06096088.1| nucleoside-triphosphatase [Brucella sp. 83/13]
 gi|264661945|gb|EEZ32206.1| nucleoside-triphosphatase [Brucella sp. 83/13]
          Length = 218

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/218 (54%), Positives = 150/218 (68%), Gaps = 7/218 (3%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           L +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L AA
Sbjct: 2   LEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKALAAA 61

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G PALSDDSGL++D LDG+PG+++A WAE+  G+RDFDMAMQK+EN L+ K A  P 
Sbjct: 62  KATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFDMAMQKVENLLQEKGATTPD 121

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+SV+ LAWPDG  E F G+V G +VWPPRG +GFGYDP+F P+GY +TFGEMT 
Sbjct: 122 KRKACFVSVICLAWPDGEAEYFRGEVEGALVWPPRGNIGFGYDPVFLPDGYGKTFGEMTA 181

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EEK+G       +       LSHRARAFK F +  L +
Sbjct: 182 EEKHG-------WKPGDASALSHRARAFKLFAEKALNV 212


>gi|49473732|ref|YP_031774.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bartonella quintana str. Toulouse]
 gi|62900216|sp|Q6G1E6|NTPA_BARQU RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|49239235|emb|CAF25555.1| hypothetical protein BQ00480 [Bartonella quintana str. Toulouse]
          Length = 215

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 148/221 (66%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +    +VIA+HN  K+HE+ +L+ P G+   SA EL+L  P+ETG +FEENA IK+ 
Sbjct: 1   MRSIASKKLVIATHNTGKLHEITTLVAPFGLEIQSAKELDLPEPKETGVTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAKN G+PALSDDSGL +D L G PG+++A WA  + G R+F  AMQKIE+ L+   AH
Sbjct: 61  AAAKNTGLPALSDDSGLEVDALGGAPGVYTADWALQSDGTRNFSKAMQKIEDELQKIGAH 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           + + R A FISV+ +AW D + + F G V G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 EKSQRKARFISVICIAWSDAYADYFRGSVEGTFIWPPRGDKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           M+ E+K+G       + +     LSHRARAFK   +N L +
Sbjct: 181 MSTEQKHG-------WKLNDKTPLSHRARAFKLLAENLLTL 214


>gi|319407923|emb|CBI81577.1| HAM1-like protein [Bartonella schoenbuchensis R1]
          Length = 214

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 147/219 (67%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M+++    +VIA+HN  K+HE+ +LI P G+ T SA EL L  P+ETG +FE+NA IK+ 
Sbjct: 1   MKRITNEKLVIATHNAGKLHEITALIAPFGLTTLSAKELGLPEPKETGTTFEKNAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK   +PALSDDSGL ID L G PG+++A WA    G R+F  AMQKIE+ L+   A 
Sbjct: 61  AAAKTTQLPALSDDSGLEIDALGGAPGVYTADWAIQPDGTRNFSKAMQKIEDELQKIGAL 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +   R   FISV+ +AWPDG+ + F G + G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 EKGQRKCRFISVICVAWPDGYADYFRGSIEGTFIWPPRGDKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ E+K+G       +++     LSHR+RAFK FV+N L
Sbjct: 181 MSTEQKHG-------WTLNDKTPLSHRSRAFKLFVENFL 212


>gi|163867356|ref|YP_001608550.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bartonella tribocorum CIP 105476]
 gi|161016997|emb|CAK00555.1| HAM1-like protein [Bartonella tribocorum CIP 105476]
          Length = 215

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 111/219 (50%), Positives = 145/219 (66%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR + +  +VIA+HN  K+HE+ +L+ P G++  SA EL L  P+ETG +FEENA IK+ 
Sbjct: 1   MRSIADKKLVIATHNTGKLHEITTLVAPFGLIIQSAKELGLPEPKETGTTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSGL +D L G PG+++A WA    G R+F  AMQKIE+ L+   A 
Sbjct: 61  AAAKKTGLPALSDDSGLEVDALGGAPGVYTADWAIQADGTRNFPKAMQKIEDELQKIEAR 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           + + R   FISV+ +AWPD H + F G V G  VWPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 EKSQRKCRFISVICIAWPDNHADYFRGCVEGTFVWPPRGDKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ E+K+G   +  L        LSHRARAFK   +N L
Sbjct: 181 MSTEQKHGWQHNDIL-------PLSHRARAFKLLAENLL 212


>gi|49474878|ref|YP_032919.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bartonella henselae str. Houston-1]
 gi|62900217|sp|Q6G565|NTPA_BARHE RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|49237683|emb|CAF26870.1| hypothetical protein BH00540 [Bartonella henselae str. Houston-1]
          Length = 215

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 145/221 (65%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +    +VIA+HN+ K+ E+ +L+ P G+   SA EL L  P+ETG +FEENA IK+ 
Sbjct: 1   MRSIANKKLVIATHNIGKLQEITTLVAPFGLTIQSAKELGLPEPKETGTTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAKN G+PALSDDSGL +D L+G PG+++A  A  + G RDF  AMQKIE  L+   AH
Sbjct: 61  AAAKNTGLPALSDDSGLEVDALNGAPGVYTADLALQSDGTRDFLKAMQKIEEKLQKIGAH 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             + R   FISV+ +AWPD H + F G+V G  +WPPRG  GFG+DP+F P+GY  TFGE
Sbjct: 121 KKSQRKCRFISVICIAWPDAHADYFHGRVEGSFIWPPRGDKGFGFDPVFLPDGYKNTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           MT E+K+G       + +     LSHRA AFK   +N L++
Sbjct: 181 MTTEQKHG-------WKLNDQTPLSHRACAFKLLAENLLKL 214


>gi|307943384|ref|ZP_07658728.1| Ham1 family protein [Roseibium sp. TrichSKD4]
 gi|307773014|gb|EFO32231.1| Ham1 family protein [Roseibium sp. TrichSKD4]
          Length = 212

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 146/218 (66%), Gaps = 11/218 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +V+ASHN  KI E++ L+ P G    SA +L+L  PEETG +FE NA +K+  
Sbjct: 4   RKLEPGRLVVASHNKGKIREINELLAPFGFDVVSAGDLDLPEPEETGTTFEANAELKARA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+ A +PAL+DDSG  +  LDG PGI+SARWA  +   +DF MAM+ +E  L+ K A  
Sbjct: 64  AAEVANLPALADDSGFCVAALDGAPGIYSARWAGPD---KDFSMAMRNVEEKLQEKGATS 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R + F++VL+L WPDGH+E F G+V G IVWPPRG  GFGYDP+F+P+G++RTFGEM
Sbjct: 121 PEQRRSSFVAVLALVWPDGHMEQFRGEVEGEIVWPPRGDKGFGYDPVFRPDGHERTFGEM 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           T EEK+G           +   LSHRARAF+ F   CL
Sbjct: 181 TSEEKHG--------WSRTEPALSHRARAFQMFAKACL 210


>gi|240849729|ref|YP_002971117.1| HAM1 protein [Bartonella grahamii as4aup]
 gi|240266852|gb|ACS50440.1| HAM1 protein [Bartonella grahamii as4aup]
          Length = 215

 Score =  228 bits (581), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 145/219 (66%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR + +  +VIA+HN  K+HE+ +LI P G++  SA EL L  P+ETG +FEENA IK+ 
Sbjct: 1   MRSIADKKLVIATHNTGKLHEITTLITPFGLIIQSAKELGLPEPKETGKTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           +AAK  G+PALSDDSGL +D L+G PG+++A WA    G R+F  AM+KIEN L+   A 
Sbjct: 61  SAAKKTGLPALSDDSGLEVDALEGAPGVYTADWAIQADGTRNFPKAMKKIENELQKVGAR 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           + + R   FIS++ +AWPD H + F G V G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 EKSQRKCRFISIICIAWPDAHADYFRGCVEGTFIWPPRGDKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ E+K+        +       LSHRARAFK   +N L
Sbjct: 181 MSTEQKHN-------WKCNDIPPLSHRARAFKLLAENLL 212


>gi|13473882|ref|NP_105450.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Mesorhizobium loti MAFF303099]
 gi|22653768|sp|Q98DN4|NTPA_RHILO RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|14024633|dbj|BAB51236.1| mlr4626 [Mesorhizobium loti MAFF303099]
          Length = 220

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 142/221 (64%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M  L    IV+ASHN  K+ E   L+ P G    SA +  L  P+ETG +FEENA IK+L
Sbjct: 1   MHTLDGKKIVVASHNAGKLREFADLMGPFGFEAKSAKDYGLPEPDETGTTFEENAYIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSGL +D LDG PG+++A WAE+  G RDF MAMQ+ E AL+   A 
Sbjct: 61  AAAKATGLPALSDDSGLCVDALDGAPGVYTANWAETPDGSRDFAMAMQRTEVALQEVGAA 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R   F++V+ LA+PDG  E + G+  G +VWPPRG+LGFGYDP+F PNG+D+TFGE
Sbjct: 121 SAEQRKGRFVAVICLAFPDGAAEYYRGEAEGTLVWPPRGELGFGYDPVFLPNGFDKTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           M+ EEK+G       +       LSHRARAF+ F    L +
Sbjct: 181 MSAEEKHG-------WKPGQAAALSHRARAFQKFAQARLDL 214


>gi|319780509|ref|YP_004139985.1| Ham1 family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166397|gb|ADV09935.1| Ham1 family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 215

 Score =  228 bits (580), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 111/219 (50%), Positives = 142/219 (64%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M  L    IV+ASHN  K+ E   L+ P G    SA E  L  P+ETG +FEENA IK+L
Sbjct: 1   MHSLDGKKIVVASHNEGKLREFADLMGPFGFEAKSAREYGLPEPDETGTTFEENAYIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSGL +D LDG PG+++A WAE+  G RDF MAMQ+ E AL+   A 
Sbjct: 61  AAAKATGLPALSDDSGLCVDALDGAPGVYTANWAETPDGSRDFGMAMQRTEVALQEVGAA 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R   F++V+ LA+PDG  E + G+  G +VWPPRG+LGFGYDP+F P+G+++TFGE
Sbjct: 121 LPEQRKGRFVAVICLAFPDGEAEYYRGEAEGTLVWPPRGELGFGYDPVFLPDGFEKTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+G       +       LSHRARAF+ F    L
Sbjct: 181 MSAEEKHG-------WKPGQPTALSHRARAFQKFAKARL 212


>gi|121602526|ref|YP_989583.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bartonella bacilliformis KC583]
 gi|120614703|gb|ABM45304.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bartonella bacilliformis KC583]
          Length = 215

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 108/221 (48%), Positives = 145/221 (65%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +I   +VIA+HN  K++E+ +L+ P  +   SA ELNL  P+ETG +FEENA IK+ 
Sbjct: 1   MRSIIGKKLVIATHNTGKLYEITTLVAPFDLTIQSAAELNLPEPKETGTTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSG+ ID L   PG+++A WA    G RDF  AMQK+EN L+   A 
Sbjct: 61  AAAKATGLPALSDDSGMEIDALGNAPGVYTANWAMQPDGTRDFSKAMQKVENELQKIGAV 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +   R   F+SV+ +AWPDG+ + F G + G  +WPPRG  GFG+DPIF P+GYD +FGE
Sbjct: 121 EKNQRKGRFVSVICVAWPDGYADYFRGSIDGTFIWPPRGNKGFGFDPIFLPDGYDNSFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           M+ E+K+G       + +     LSHRARAFK F ++ L I
Sbjct: 181 MSTEQKHG-------WQLNDEIPLSHRARAFKLFAESLLVI 214


>gi|260463466|ref|ZP_05811666.1| Ham1 family protein [Mesorhizobium opportunistum WSM2075]
 gi|259030791|gb|EEW32067.1| Ham1 family protein [Mesorhizobium opportunistum WSM2075]
          Length = 225

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 140/215 (65%), Gaps = 7/215 (3%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+ASHN  K+ E   L+ P G    SA +  L  P+ETG +FEENA IK+L AAK  
Sbjct: 12  KKIVVASHNAGKLREFADLMRPFGFEAKSAKDYGLPEPDETGTTFEENAYIKALAAAKAT 71

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PALSDDSGL +D LDG PG+++A WAE+  G RDF MAMQ+ E AL+   A  P  R 
Sbjct: 72  GLPALSDDSGLCVDALDGAPGVYTANWAETPDGGRDFAMAMQRTEVALQEVGAALPEQRK 131

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
             F++V+ LA+PDG  E + G+  G +VWPPRG+LGFGYDP+F P+G+D+TFGEM+  EK
Sbjct: 132 GRFVAVICLAFPDGEAEYYRGEAEGTLVWPPRGELGFGYDPVFLPDGFDKTFGEMSAAEK 191

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           +G       +       LSHRARAF+ F    L +
Sbjct: 192 HG-------WKPGQATALSHRARAFQKFAQARLDL 219


>gi|319403536|emb|CBI77117.1| HAM1-like protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 215

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 140/219 (63%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +    ++IA+HN  K+HE+ +LI P GI T S  EL L  P+ETG +FEENA IK+ 
Sbjct: 1   MRNITIKKLIIATHNTGKLHEITTLIAPFGITTQSVKELGLPEPKETGTTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK    PALSDDSG+ ID L+G PG+++A WA    G RDF  AMQK+EN L+     
Sbjct: 61  AAAKATNFPALSDDSGMEIDALNGAPGVYTADWALQPDGTRDFVKAMQKVENELQKVDPL 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R   FISV+ LA+PDGH + F G V G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 KKNQRKGRFISVICLAYPDGHADYFRGSVEGTFIWPPRGNKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ E+K+        + +     LSHRARAFK F +N L
Sbjct: 181 MSTEQKHS-------WKLHGQTPLSHRARAFKLFAENLL 212


>gi|328541648|ref|YP_004301757.1| Nucleoside-triphosphatase [polymorphum gilvum SL003B-26A1]
 gi|326411400|gb|ADZ68463.1| Nucleoside-triphosphatase [Polymorphum gilvum SL003B-26A1]
          Length = 213

 Score =  224 bits (572), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 142/218 (65%), Gaps = 11/218 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +V+ASHN  KI E+  L+ P G    SA EL+L  PEETG +FE NA +K+L 
Sbjct: 4   RKLEPGRLVVASHNPGKIREIRELLSPYGFDVVSAGELDLPEPEETGTTFEANAELKALA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+ +G+P+L+DDSG  +  LDG PG++SARWA  +   +DF MAM+ IE  L+      
Sbjct: 64  AARGSGLPSLADDSGFCVAALDGAPGVYSARWAGPD---KDFAMAMRAIEEKLQQAGGTT 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R   F++VL LAWPDGH E F G+V G +VWPPRG+ GFGYDP+FQP+G+ RTFGEM
Sbjct: 121 PDRRRGSFVAVLCLAWPDGHREFFRGEVEGQVVWPPRGEQGFGYDPMFQPDGHARTFGEM 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           +  EK+G           +T  LSHRARAF  F   CL
Sbjct: 181 SSTEKHG--------WSRTTPALSHRARAFVAFSKACL 210


>gi|319406450|emb|CBI80090.1| HAM1-like protein [Bartonella sp. 1-1C]
          Length = 215

 Score =  224 bits (572), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 141/219 (64%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M+ +    ++IA+HN  K+HE+ +LI P GI T S  EL L  P+ETG +FEENA IK+ 
Sbjct: 1   MKSITIKKLIIATHNTGKLHEITTLIAPFGITTQSVKELGLPEPKETGTTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK   +PALSDDSG+ ID L+G PGI++A WA    G RDF  AMQK+EN L+     
Sbjct: 61  AAAKATNLPALSDDSGMEIDALNGAPGIYTADWALQPDGTRDFLKAMQKVENELQKVGPL 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R   FISV+ LA+PDGH + F G V G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 KKNQRKGRFISVICLAYPDGHADYFRGSVEGTFIWPPRGNKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ E+K+        + +     LSHRARAFK F +N L
Sbjct: 181 MSTEQKHS-------WKLHGPTPLSHRARAFKLFAENLL 212


>gi|110636338|ref|YP_676546.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Mesorhizobium sp. BNC1]
 gi|110287322|gb|ABG65381.1| Ham1-like protein [Chelativorans sp. BNC1]
          Length = 215

 Score =  224 bits (571), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 139/221 (62%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +     V+ASHN  K+ E   L+ P G    SA EL L  PEETG  FE+NA IK+ 
Sbjct: 1   MRPIDNKKFVLASHNKGKLDEFAGLLAPFGYEIRSAAELGLPEPEETGTEFEQNAYIKAS 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSG+ +D L G PG+++A WA    G RDF +AM+K+E  LR K A 
Sbjct: 61  AAAKATGLPALSDDSGMCVDALGGAPGVYTADWATLPDGRRDFGIAMEKVEKLLREKGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F++VL L +PDG  E + G+V G +VWPPRG LGFGYDP+FQP+G+ RTFGE
Sbjct: 121 SPEQRRARFVAVLCLCFPDGEAEFYRGEVEGHLVWPPRGGLGFGYDPVFQPDGHQRTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           MT  EK+G       +       LSHRARAF+ F    L +
Sbjct: 181 MTAAEKHG-------WKPGDAQALSHRARAFQKFARARLGV 214


>gi|298293789|ref|YP_003695728.1| Ham1 family protein [Starkeya novella DSM 506]
 gi|296930300|gb|ADH91109.1| Ham1 family protein [Starkeya novella DSM 506]
          Length = 218

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 141/217 (64%), Gaps = 11/217 (5%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           + +E  IVIA+HN  K+ EM  L+ P G+   SA EL L  PEETG +F ENA IK+++A
Sbjct: 8   RRLEGRIVIATHNPGKLEEMRGLLAPYGVDAVSAGELGLPEPEETGLTFAENARIKAVSA 67

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           AK +G+PA +DDSGL ++ L G PG+ +ARWA     E+DF  AM ++E  LR+  A  P
Sbjct: 68  AKASGLPAFADDSGLCVEALGGAPGLLTARWAGP---EKDFMAAMTRVETELRAAGAELP 124

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A+FIS L LAWPDGH E+F G V G +VWPPRG  GFGYDP+FQP+GY+RTFGEMT
Sbjct: 125 DLRRAYFISALCLAWPDGHAEDFEGVVEGTLVWPPRGPAGFGYDPMFQPDGYERTFGEMT 184

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             EK+G          L    LSHRARAF       L
Sbjct: 185 GAEKHG-------LPPLGRG-LSHRARAFIALATASL 213


>gi|319898243|ref|YP_004158336.1| HAM1-like protein [Bartonella clarridgeiae 73]
 gi|319402207|emb|CBI75738.1| HAM1-like protein [Bartonella clarridgeiae 73]
          Length = 215

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 108/221 (48%), Positives = 143/221 (64%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +    +VIA+HN  K+HE+  LI P G+ T S  EL L  P+ETG +FEENA IK+ 
Sbjct: 1   MRSIAIKKLVIATHNTGKLHEITRLIAPFGVTTQSVKELGLPEPKETGTTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK   +PALSDDSG+ ID L+G PG+++A WA  + G RDF  AMQK+EN L+   + 
Sbjct: 61  AAAKATNLPALSDDSGIEIDALNGAPGVYTADWALQSDGTRDFLKAMQKVENELQKVASL 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R + FISV+ +A+PDG+ + F G V G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 KKNQRKSRFISVICIAYPDGYADYFRGSVEGTCIWPPRGNKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           M+ E+K+        +       LSHRARAFK F +N L +
Sbjct: 181 MSTEQKHS-------WKFNGQTPLSHRARAFKLFAENLLAL 214


>gi|254504255|ref|ZP_05116406.1| Ham1 family [Labrenzia alexandrii DFL-11]
 gi|222440326|gb|EEE47005.1| Ham1 family [Labrenzia alexandrii DFL-11]
          Length = 212

 Score =  221 bits (564), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 112/220 (50%), Positives = 145/220 (65%), Gaps = 13/220 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +V+ASHN  K+ E++ L+   G    SA +L L  PEETG +FE NA IK++ 
Sbjct: 4   RKLEPGKLVVASHNKGKLREINELLQSYGFEVVSAGDLGLPEPEETGTTFEANAEIKAVA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           +A  A +PAL+DDSG  +  L+G PGI+SARWA  +   +DF MAM+ +E  L+S  A  
Sbjct: 64  SATAANLPALADDSGFCVAELNGDPGIYSARWAGPD---KDFAMAMRTVEEKLQSAGAMT 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R   F++VL LAWPDGH E F G+V G IVWPPRG  GFGYDP+FQP+G++RTFGEM
Sbjct: 121 PERRRGSFVAVLCLAWPDGHKEFFRGEVDGQIVWPPRGTQGFGYDPVFQPDGHERTFGEM 180

Query: 182 TEEEKNG-GIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           T +EK+G G D         T  LSHR+RAF+ F   CL+
Sbjct: 181 TSDEKHGWGPD---------TPALSHRSRAFELFAKACLK 211


>gi|92115782|ref|YP_575511.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Nitrobacter hamburgensis X14]
 gi|91798676|gb|ABE61051.1| Ham1-like protein [Nitrobacter hamburgensis X14]
          Length = 211

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 139/220 (63%), Gaps = 13/220 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  PEETG+ F  NA IK++
Sbjct: 1   MHRRIAGKLVIATHNPGKLAEMRELLAPYGIEAVSAGELGLGEPEETGDDFRANATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA++A +PA +DDSGLV+D LDG PGI+SARWA      +DF  AM +IE  L+ + A 
Sbjct: 61  AAARSAKLPAFADDSGLVVDALDGAPGIYSARWAGET---KDFSAAMTRIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R AHF+S L +AWPDGH+E    +V G +VWPPRG  GFGYDP FQP+G+ RTFGE
Sbjct: 118 TAEKRKAHFVSALCVAWPDGHLEEVEARVHGTLVWPPRGTAGFGYDPAFQPDGHTRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDL-LSHRARAFKCFVDNCL 219
           MT  EK+G         +    L LSHRARAF    +  L
Sbjct: 178 MTSIEKHG---------LPPRGLGLSHRARAFVKLAEMSL 208


>gi|209883566|ref|YP_002287423.1| non-canonical purine NTP pyrophosphatase [Oligotropha
           carboxidovorans OM5]
 gi|209871762|gb|ACI91558.1| non-canonical purine NTP pyrophosphatase [Oligotropha
           carboxidovorans OM5]
          Length = 212

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 140/221 (63%), Gaps = 19/221 (8%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           + I   +VIA+HN  K+ EM  L+ P GI   SA ELNL  PEETG +F  NA IK+  A
Sbjct: 5   RHITGRLVIATHNPGKLAEMRELLAPYGIEAVSAAELNLDEPEETGTTFAANARIKATAA 64

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A   G+PA +DDSGL +D L+G+PGI+SARWA  +   +DF  AM +IE  L+ + A +P
Sbjct: 65  ANATGLPAFADDSGLCVDALEGQPGIYSARWAGPS---KDFMAAMTQIERLLQERDATEP 121

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           A R AHF+S L +AWPDGHVE    +V G +VWPPRG  GFGYDP F P+G+ RTFGEMT
Sbjct: 122 AQRKAHFVSALCVAWPDGHVEEVEERVDGQMVWPPRGTAGFGYDPAFLPDGHGRTFGEMT 181

Query: 183 EEEKNG----GIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             EK+G    G+             LSHRA+AF    + CL
Sbjct: 182 SIEKHGLPPHGMG------------LSHRAKAFVKLAEICL 210


>gi|319404962|emb|CBI78564.1| HAM1-like protein [Bartonella sp. AR 15-3]
          Length = 215

 Score =  214 bits (545), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 138/219 (63%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +    ++IA+HN  K++E+ +LI P  I T S  EL L  P+E G +FEENA IK+ 
Sbjct: 1   MRSIAIKKLIIATHNAGKLNEITTLIAPFDITTQSVKELGLPEPKEIGRTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK    PALSDDSG+ ID L+G PG+++A WA    G RDF  AMQ +EN L+   + 
Sbjct: 61  AAAKATSFPALSDDSGIEIDALNGAPGVYTADWALQPDGTRDFLKAMQTVENELQKVGSL 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R   FISV+ LA+PDGH + F G V G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 KKNQRKGRFISVICLAYPDGHADYFCGSVEGTFIWPPRGNKGFGFDPIFVPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ E+K+        + +     LSHRARAFK F +N L
Sbjct: 181 MSTEQKHN-------WKLNGQTPLSHRARAFKLFAENFL 212


>gi|158425914|ref|YP_001527206.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Azorhizobium caulinodans ORS 571]
 gi|158332803|dbj|BAF90288.1| HAM1 protein [Azorhizobium caulinodans ORS 571]
          Length = 210

 Score =  214 bits (545), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 142/220 (64%), Gaps = 13/220 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + +   IVIA+HN  K+ EM  L+ P GI   SA ELNL  P+ETG +F  NA IK+ 
Sbjct: 1   MSRKLTGRIVIATHNPGKLKEMQELLAPYGIEAVSAGELNLPEPDETGTTFRANARIKAE 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK AG+PA +DDSG+ +D LDG PGI+SARW      ++DF MAM K+   + ++ A 
Sbjct: 61  AAAKAAGLPAFADDSGIAVDALDGAPGIYSARWGGP---QKDFRMAMGKVHEEMLARGAA 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +PA R+A F+S L +AWPDGH+E F G V G +VWPPRG  GFGYDP F P G+ RTFGE
Sbjct: 118 EPAQRTARFVSALCIAWPDGHLEEFEGIVEGEVVWPPRGNSGFGYDPFFLPEGHTRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDL-LSHRARAFKCFVDNCL 219
           MT EEK+         S+    L LSHRARAF+     CL
Sbjct: 178 MTSEEKH---------SMPPLGLGLSHRARAFRQLALACL 208


>gi|299133260|ref|ZP_07026455.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Afipia
           sp. 1NLS2]
 gi|298593397|gb|EFI53597.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Afipia
           sp. 1NLS2]
          Length = 212

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 137/215 (63%), Gaps = 11/215 (5%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           I   +VIA+HN  K+ EM  L+ P GI   SA ELNL  PEETG +F  NA IK+  AA 
Sbjct: 7   ITGRLVIATHNSGKLAEMRELLAPYGIEAVSAGELNLPEPEETGTTFAANARIKAEAAAN 66

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PA +DDSGL +D LD +PGI+SARWA  +   +DF  AM +IE  L+ + A  PA 
Sbjct: 67  ATGLPAFADDSGLCVDALDSQPGIYSARWAGPS---KDFMAAMAQIERLLQERGATAPAQ 123

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R AHF+S L +AWPDGH+E    +V+G +VWPPRG  GFGYDP F P+G+ RTFGEMT  
Sbjct: 124 RKAHFVSALCVAWPDGHLEEVEERVNGAMVWPPRGDAGFGYDPAFLPDGHGRTFGEMTSI 183

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EK+G          L    LSHRA+AF    + CL
Sbjct: 184 EKHG-------LPPLGLG-LSHRAKAFVKLAEICL 210


>gi|163757815|ref|ZP_02164904.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Hoeflea
           phototrophica DFL-43]
 gi|162285317|gb|EDQ35599.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Hoeflea
           phototrophica DFL-43]
          Length = 217

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 148/218 (67%), Gaps = 13/218 (5%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             I++ASHN  KI E+  L  PLG+  TSA ELNL  PEETG++FE NA  K+L AA  +
Sbjct: 7   TEILVASHNAGKIAEIRDLFGPLGVAVTSAAELNLPEPEETGDTFEANAATKALAAATAS 66

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G  ALSDDSGL++D LDG PG+++A WA    G RDF +AMQK+E+AL+++ A   A R+
Sbjct: 67  GKIALSDDSGLIVDALDGAPGVYTADWATLPDGSRDFAVAMQKVEDALQARGALTEAKRT 126

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
             F+S+L LA PDG V  + G+  G++VWPPRG  GFGYDP+F+P+G+ RTFGEMT EEK
Sbjct: 127 GRFVSMLCLATPDGDVSFYRGEADGVMVWPPRGTSGFGYDPVFRPDGHTRTFGEMTAEEK 186

Query: 187 NG---GIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           +G   G  +AT          SHRARAFK F +  L +
Sbjct: 187 HGWKPGQATAT----------SHRARAFKLFAEQRLGV 214


>gi|118593718|ref|ZP_01551093.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Stappia
           aggregata IAM 12614]
 gi|118433728|gb|EAV40390.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Stappia
           aggregata IAM 12614]
          Length = 212

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 115/218 (52%), Positives = 144/218 (66%), Gaps = 11/218 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +V+ASHN  KI E++ L+ P G    SA EL+L  P+ETG +FEENA IK+  
Sbjct: 4   RKLEPGKLVVASHNKGKIREINELLQPYGFEVISAGELDLPEPDETGVTFEENAAIKAHA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK +G+PAL+DDSG  +  L+G PGI+SARWA  +   +DF MAM+ +E  L+S  A  
Sbjct: 64  AAKASGLPALADDSGFCVAALNGDPGIYSARWAGPD---KDFAMAMRTVEEKLQSLGATT 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R   F++VL LAWPDG  E F G+V G IVWPPRG  GFGYDPIFQP+G++RTFGEM
Sbjct: 121 DDQRRGSFVAVLCLAWPDGSEEYFRGEVDGQIVWPPRGTQGFGYDPIFQPDGHERTFGEM 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           T EEK+G     +         LSHRARAF+ F   CL
Sbjct: 181 TSEEKHGWSKDGS--------ALSHRARAFQLFSAGCL 210


>gi|85714062|ref|ZP_01045051.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Nitrobacter sp. Nb-311A]
 gi|85699188|gb|EAQ37056.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Nitrobacter sp. Nb-311A]
          Length = 211

 Score =  212 bits (539), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 137/220 (62%), Gaps = 13/220 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P G+   SA EL L  PEETG  F  NA IK+ 
Sbjct: 1   MNRRIAGKLVIATHNPGKLVEMRELLAPYGVEAISAGELGLSEPEETGEDFRANARIKAT 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           +AA++A +PA +DDSGLV+D LDG PGIHSARWA       DF  AM +IE  L+ + A 
Sbjct: 61  SAARSAKLPAFADDSGLVVDALDGAPGIHSARWAGKPA---DFSAAMTRIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R AHF+S L +AWPDGH++   G+V G +VWPPRG  GFGYDP+F P+G+ RTFGE
Sbjct: 118 GADKRKAHFVSALCVAWPDGHLQEVEGRVDGTLVWPPRGTAGFGYDPVFLPDGHRRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDL-LSHRARAFKCFVDNCL 219
           M   EK+G         +    L LSHRARAF    +  L
Sbjct: 178 MAGIEKHG---------LPPRGLGLSHRARAFVKLAEIAL 208


>gi|91974876|ref|YP_567535.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodopseudomonas palustris BisB5]
 gi|91681332|gb|ABE37634.1| Ham1-like protein [Rhodopseudomonas palustris BisB5]
          Length = 210

 Score =  212 bits (539), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 139/219 (63%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG+SF  NA IK+ 
Sbjct: 1   MHRRISGKLVIATHNPGKLAEMRELLAPYGIEAVSAGELGLGEPDETGDSFRANARIKAE 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+ A +PA +DDSGL +D LDG PGI SARWA      +DF+ AM +IE  LR + A 
Sbjct: 61  AAAQAAKLPAFADDSGLSVDALDGAPGIFSARWAGEG---KDFNAAMAQIERLLRERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            PA R AHF+S L +AWPDGH+E    +  G +VWPPRG  GFGYDP+F P+G+DRTFGE
Sbjct: 118 APAQRGAHFVSALCVAWPDGHIEEVEARADGTLVWPPRGDAGFGYDPMFLPDGHDRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+  EK+G          L    LSHRARAF    + CL
Sbjct: 178 MSSIEKHG-------LPPLGLG-LSHRARAFVKLAEICL 208


>gi|316931692|ref|YP_004106674.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rhodopseudomonas palustris DX-1]
 gi|315599406|gb|ADU41941.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rhodopseudomonas palustris DX-1]
          Length = 210

 Score =  210 bits (535), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 113/219 (51%), Positives = 140/219 (63%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG+SF+ NA IK+ 
Sbjct: 1   MHRRITGKLVIATHNPGKLAEMRELLAPYGIEAISAGELGLAEPDETGDSFQANARIKAE 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK A +PA +DDSGL +D LDG PGI+SARWA  +   +DF  AM +IE  L+ + A 
Sbjct: 61  AAAKAAQLPAFADDSGLAVDALDGAPGIYSARWAGDS---KDFGGAMARIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+AHF+S L +AWPDGHVE       G +VWPPRG  GFGYDPIF P+G+DRTFGE
Sbjct: 118 APERRTAHFVSALCVAWPDGHVEEVEAHAGGTLVWPPRGTAGFGYDPIFLPDGHDRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+G          L    LSHRA+AF    + CL
Sbjct: 178 MTSVEKHG-------LPPLGLG-LSHRAKAFVKLAEICL 208


>gi|75674391|ref|YP_316812.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Nitrobacter winogradskyi Nb-255]
 gi|74419261|gb|ABA03460.1| Ham1-like protein [Nitrobacter winogradskyi Nb-255]
          Length = 211

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 136/220 (61%), Gaps = 13/220 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ E+  L+ P G+   SA EL L  PEETG  F  NA IK+ 
Sbjct: 1   MHRRIAGKLVIATHNPGKLAEIRELLAPYGVEAVSAGELGLDEPEETGEDFRANARIKAT 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           +AA +A +PA +DDSGLV+D LDG PGIHSARWA       DF  AM +IE  L+ + A 
Sbjct: 61  SAALSAKLPAFADDSGLVVDALDGAPGIHSARWAGKPA---DFSAAMARIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R AHFIS L +AWPDGH++   G+V G +VWPPRG  GFGYDP+F P+G+ RTFGE
Sbjct: 118 SADQRKAHFISALCVAWPDGHLQEVEGRVDGTLVWPPRGTAGFGYDPVFLPDGHGRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDL-LSHRARAFKCFVDNCL 219
           M   EK+G         +    L LSHRARAF    +  L
Sbjct: 178 MAGIEKHG---------LPPRGLGLSHRARAFVKLAEIAL 208


>gi|148251803|ref|YP_001236388.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bradyrhizobium sp. BTAi1]
 gi|189030894|sp|A5E8I8|NTPA_BRASB RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|146403976|gb|ABQ32482.1| putative HAM1 protein [Bradyrhizobium sp. BTAi1]
          Length = 214

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 140/218 (64%), Gaps = 12/218 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    IVIA+HN  K+ EM  L+ P G+   SA EL+L  P+ETG +F+ NA IK++ 
Sbjct: 6   RKL-SGRIVIATHNPGKLAEMRELLAPYGVEAVSAGELSLGEPDETGETFQANARIKAVA 64

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  A +PA +DDSG+V+  LDG PGI+SARWA  +   +DF  AM +IE  L+ + A  
Sbjct: 65  AADAAQLPAFADDSGIVVHALDGAPGIYSARWAGPD---KDFTAAMTRIERLLQERGATG 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R AHF+S L +AWPDGHVE    +V G +VWPPRG  GFGYDP+F P G+DRTFGEM
Sbjct: 122 PDKRGAHFVSALCVAWPDGHVEEVEARVDGTLVWPPRGSAGFGYDPMFLPEGHDRTFGEM 181

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           T  EK+G          L    LSHRARAF    + CL
Sbjct: 182 TSLEKHG-------LPPLGLG-LSHRARAFVKLAEICL 211


>gi|254486927|ref|ZP_05100132.1| Ham1 family protein [Roseobacter sp. GAI101]
 gi|214043796|gb|EEB84434.1| Ham1 family protein [Roseobacter sp. GAI101]
          Length = 203

 Score =  207 bits (527), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 135/218 (61%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+   + I+IA+HN  K+ EM  L  P G+    A E+NL  PEET ++F  NA IK++ 
Sbjct: 3   RRFTGDQILIATHNAGKLQEMAELFAPFGVRVVGAAEMNLAEPEETEDNFIGNARIKAVA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A K  G+PAL+DDSG+ ++ LDG PG+++A W+E+  G RDF MAM K  N L  K A  
Sbjct: 63  AVKATGLPALADDSGIEVEALDGAPGVYTADWSETPNG-RDFVMAMTKTHNLLEEKNAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F + L LAWPDGH E F G V+G +VWP RG++G GYDPIFQP+GYD+TFGEM
Sbjct: 122 P--RRARFCATLVLAWPDGHEEIFEGTVNGKLVWPMRGEIGHGYDPIFQPDGYDQTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           T +EKN                +SHRA AF      C 
Sbjct: 180 THDEKNK---------------ISHRADAFAKLTSACF 202


>gi|115522382|ref|YP_779293.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodopseudomonas palustris BisA53]
 gi|115516329|gb|ABJ04313.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rhodopseudomonas palustris BisA53]
          Length = 211

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 138/219 (63%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA +L L  P+ETG++F+ NA IK+ 
Sbjct: 1   MHRRITGQLVIATHNPGKLAEMRELLAPYGIEAISAGDLGLQEPDETGDTFQANARIKAQ 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA  A +PA +DDSGLV+D LDG PGI SARWA      +DF  AM +IE  L+ + A 
Sbjct: 61  AAANAAQLPAFADDSGLVVDALDGAPGIFSARWAGEG---KDFLAAMTQIERLLQERGAR 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P  R+AHF+S L +AWPDGHVE    +  G +VWPPRG  GFGYDP F P+G+ RTFGE
Sbjct: 118 EPEQRTAHFVSALCVAWPDGHVEEVEARADGTLVWPPRGSAGFGYDPTFLPDGHGRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+G          L    LSHRA+AF    + CL
Sbjct: 178 MTSLEKHG-------LPPLGLG-LSHRAKAFIKLAELCL 208


>gi|192288762|ref|YP_001989367.1| deoxyribonucleotide triphosphate pyrophosphatase [Rhodopseudomonas
           palustris TIE-1]
 gi|192282511|gb|ACE98891.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rhodopseudomonas palustris TIE-1]
          Length = 210

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 137/219 (62%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG SF+ NA IK+ 
Sbjct: 1   MHRRITGKLVIATHNPGKLAEMRELLAPYGIEAISAGELGLAEPDETGGSFQANARIKAE 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK A +PA +DDSGL +D LDG PGI+SARWA      +DF  AM +IE  L+ + A 
Sbjct: 61  AAAKAAQLPAFADDSGLTVDALDGAPGIYSARWAGDA---KDFAGAMARIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+AHF+S L +AWPDGH+E    +  G +VWPPRG  GFGYDP+F P G+ RTFGE
Sbjct: 118 APERRTAHFVSALCVAWPDGHIEEVEARADGTLVWPPRGTAGFGYDPVFLPEGHSRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+G          L    LSHRA+AF    + CL
Sbjct: 178 MTSVEKHG-------LPPLGLG-LSHRAKAFVKLAEICL 208


>gi|39933405|ref|NP_945681.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodopseudomonas palustris CGA009]
 gi|62900229|sp|Q6NCY9|NTPA_RHOPA RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|39647251|emb|CAE25772.1| Ham1-like protein [Rhodopseudomonas palustris CGA009]
          Length = 210

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 138/219 (63%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG+SF+ NA IK+ 
Sbjct: 1   MHRRITGKLVIATHNPGKLAEMRELLAPYGIEAISAGELGLAEPDETGDSFQANARIKAE 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK A +PA +DDSGL +D LDG PGI+SARWA      +DF  AM +IE  L+ + A 
Sbjct: 61  AAAKAAQLPAFADDSGLAVDALDGAPGIYSARWAGDA---KDFAGAMARIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+AHF+S L +AWPDGH+E    +  G +VWPPRG  GFGYDP+F P G+ RTFGE
Sbjct: 118 APERRTAHFVSALCVAWPDGHIEEVEARADGTLVWPPRGTAGFGYDPVFLPEGHSRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+G          L    LSHRA+AF    + CL
Sbjct: 178 MTSIEKHG-------LPPLGLG-LSHRAKAFVKLAEICL 208


>gi|83594969|ref|YP_428721.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodospirillum rubrum ATCC 11170]
 gi|123739387|sp|Q2RN61|NTPA_RHORT RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|83577883|gb|ABC24434.1| Ham1-like protein [Rhodospirillum rubrum ATCC 11170]
          Length = 201

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 134/218 (61%), Gaps = 23/218 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L+E+ +V+ASHN  K+ E+  LI P G+   SA  L+L  PEETG+SF ENA++K+  
Sbjct: 5   RRLVESPLVVASHNAGKVREIAELIAPFGLEARSAASLDLPEPEETGSSFVENALLKAHA 64

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+  G+PAL+DDSGL +  L G PGI+SARWA      +DF +AM  I + L      D
Sbjct: 65  AARATGLPALADDSGLAVSALGGDPGIYSARWAGPT---KDFALAMATINHLL-----GD 116

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              RSAHF+  L+LAWPDGH E F G+V G++VWPPRG  GFGYDP+F   G   TFGEM
Sbjct: 117 NPDRSAHFVCALALAWPDGHAETFEGRVDGVLVWPPRGDQGFGYDPMFLGEGAAETFGEM 176

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
               K+                +SHRARAF   V  CL
Sbjct: 177 DPAAKHA---------------ISHRARAFALLVAACL 199


>gi|86747550|ref|YP_484046.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodopseudomonas palustris HaA2]
 gi|86570578|gb|ABD05135.1| Ham1-like protein [Rhodopseudomonas palustris HaA2]
          Length = 210

 Score =  205 bits (521), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 113/219 (51%), Positives = 137/219 (62%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG+SF  NA IK+ 
Sbjct: 1   MHRRISGQLVIATHNPGKLAEMRELLAPYGIAAVSAGELGLGEPDETGDSFRANARIKAE 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+ A +PA +DDSGL +D LDG PGI SARWA      +DF+ AM +IE  L+ + A 
Sbjct: 61  AAAQAAQLPAFADDSGLAVDALDGAPGILSARWAGEG---KDFNAAMARIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R AHF+S L +AWPDGHVE    +  G +VWPPRG  GFGYDPIF P G+DRTFGE
Sbjct: 118 TPDRRGAHFVSALCVAWPDGHVEEVEARADGTLVWPPRGSAGFGYDPIFLPEGHDRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+G          L    LSHRARAF    + CL
Sbjct: 178 MTSLEKHG-------LPPLGLG-LSHRARAFVELAEICL 208


>gi|304392747|ref|ZP_07374687.1| Ham1 family protein [Ahrensia sp. R2A130]
 gi|303295377|gb|EFL89737.1| Ham1 family protein [Ahrensia sp. R2A130]
          Length = 218

 Score =  204 bits (520), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 132/214 (61%), Gaps = 11/214 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR L   NI++A+HNV K+ E   L+ P G+  TSA + +L  P E G +FEENA IK+ 
Sbjct: 1   MRALDTANIILATHNVGKLDEFRELVQPYGLTITSAADHDLPEPVEDGTTFEENAYIKAW 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALR--SK 117
            AA   G  ALSDDSGL +  LDG PGI++A WAE   G  RDF  AM+K+E AL     
Sbjct: 61  AAASATGKVALSDDSGLCVAALDGDPGIYTADWAEKPDGSGRDFQYAMEKVEKALNDVGL 120

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
            + D A R  +F +VL L WPDGH E F G+  G +VWPPRG  GFGYDP+F+P G+ RT
Sbjct: 121 KSEDEASREGYFCAVLCLCWPDGHAEYFRGEAHGHLVWPPRGDSGFGYDPVFRPQGHTRT 180

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
           FGEMT  EK+              + LSHRARAF
Sbjct: 181 FGEMTATEKHSWKP--------GEEGLSHRARAF 206


>gi|217978305|ref|YP_002362452.1| Ham1 family protein [Methylocella silvestris BL2]
 gi|217503681|gb|ACK51090.1| Ham1 family protein [Methylocella silvestris BL2]
          Length = 209

 Score =  204 bits (519), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 106/221 (47%), Positives = 138/221 (62%), Gaps = 12/221 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + IE  +V+A+HN  K+ EM  L+   G+   SA EL L  PEETG++F EN+ +K+L
Sbjct: 1   MVRAIEGRLVVATHNAGKLAEMRELLDHYGVKAVSAGELGLPEPEETGSTFLENSRLKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+ +  PAL+DDSGL +D L G+PGI+SARWA  +   RDF +    +E ALR   A 
Sbjct: 61  AAAEGSASPALADDSGLCVDALGGEPGIYSARWAGPD---RDFAIGRAAVEEALRVAGAQ 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P   +AHFI VL+LA+PDG   +F G+V G +V+PPRG L FGYDPIF P G  +TFGE
Sbjct: 118 AP--FAAHFICVLTLAFPDGETSSFEGRVDGELVFPPRGSLVFGYDPIFLPEGLSKTFGE 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           MT EEK              +  LSHRARAF+ F   C  +
Sbjct: 176 MTLEEKQA-------IPPDGSPALSHRARAFQAFAKACFGV 209


>gi|296447434|ref|ZP_06889359.1| Ham1 family protein [Methylosinus trichosporium OB3b]
 gi|296255054|gb|EFH02156.1| Ham1 family protein [Methylosinus trichosporium OB3b]
          Length = 209

 Score =  204 bits (519), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 101/217 (46%), Positives = 135/217 (62%), Gaps = 12/217 (5%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           + IE  +VIA+HN  K+ E+  L+ P G+   SA EL +  PEET  SF  NA++K+  +
Sbjct: 4   RKIEGRLVIATHNPGKLWELRQLLEPHGVDAVSAGELGVTEPEETETSFAGNALLKARAS 63

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
               G+PA +DDSGL +D LDG PG++SARW   N   RDF  A++++E  L  + A  P
Sbjct: 64  CAATGLPAFADDSGLCVDALDGAPGVYSARWGGDN---RDFAAAIRRVERELAERGATAP 120

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
               AHF+  L++AWPDGHVE F G+V G++V+PPRG+ GFGYDPIF P+G  RTFGEM 
Sbjct: 121 F--PAHFVCALAVAWPDGHVEEFEGRVDGVLVFPPRGEQGFGYDPIFLPDGLSRTFGEMM 178

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             EK+             +  LSHRARAF+     CL
Sbjct: 179 SAEKHA-------LPGDGSRALSHRARAFQALARACL 208


>gi|294011051|ref|YP_003544511.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sphingobium japonicum UT26S]
 gi|292674381|dbj|BAI95899.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sphingobium japonicum UT26S]
          Length = 209

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 139/215 (64%), Gaps = 20/215 (9%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           +RKL    +VIASHN  K+ E+  L+ P GI T SA  L+L  PEETG +F  NA +K++
Sbjct: 11  IRKLGPGRLVIASHNPGKVREIGELLAPYGIETVSAAALDLPEPEETGTTFIANAELKAM 70

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA  +G+PAL+DDSGL ++ L+G PGI SARWA      +DF +AM+ + + +++K   
Sbjct: 71  QAADLSGLPALADDSGLCVEALNGDPGIFSARWAGPT---KDFGIAMRLVWDNIQAKGPE 127

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             A   AHFI  L+LAWPDGHVE F G+V G I+WPPRG  GFGYDPIFQP+G+D +FGE
Sbjct: 128 --AGHGAHFICALALAWPDGHVEAFEGRVDGTIIWPPRGDRGFGYDPIFQPHGHDISFGE 185

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           M  E+K+G               +SHRA AF   V
Sbjct: 186 MDPEKKHG---------------MSHRADAFAQLV 205


>gi|27375784|ref|NP_767313.1| deoxyribonucleotide triphosphate pyrophosphatase [Bradyrhizobium
           japonicum USDA 110]
 gi|62900283|sp|Q89WK5|NTPA_BRAJA RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|27348922|dbj|BAC45938.1| bll0673 [Bradyrhizobium japonicum USDA 110]
          Length = 211

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 139/219 (63%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETGN F  NA IK++
Sbjct: 1   MHRRITGKLVIATHNPGKLAEMKELLAPYGIEAVSAGELGLSEPDETGNDFRSNAAIKAI 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA  + +P+ +DDSG+V+D LDG PGI+SARWA      +DF  AM +IE  L+ + A 
Sbjct: 61  AAAHASKLPSFADDSGIVVDALDGAPGIYSARWAGPT---KDFTAAMTRIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R AHF+S L +AWPD H+E    +V G +VWPPRG  GFGYDP+F+P+G+ RTFGE
Sbjct: 118 APDKRKAHFVSALCVAWPDDHLEEVEARVDGTLVWPPRGTAGFGYDPMFRPDGHTRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+ G+    L        LSHRARAF    + CL
Sbjct: 178 MTSIEKH-GLPPLGL-------ALSHRARAFVKLAEICL 208


>gi|148553492|ref|YP_001261074.1| Ham1 family protein [Sphingomonas wittichii RW1]
 gi|148498682|gb|ABQ66936.1| Ham1 family protein [Sphingomonas wittichii RW1]
          Length = 209

 Score =  201 bits (511), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 131/214 (61%), Gaps = 17/214 (7%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +VIASHN  K+ E+  L+ P GI T SA  L +  PEETG SF  NA +K+  
Sbjct: 9   RKLAPGKLVIASHNKGKLREIAELLAPHGIETVSAGALGVPEPEETGTSFVANAELKARF 68

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           +A   G+PAL+DDSGL ++ L G+PGI SARWAE + G RDF   M+++    R   A D
Sbjct: 69  SADLTGLPALADDSGLCVEALGGEPGIFSARWAELDDGSRDFAEGMRRVHA--RMVEAGD 126

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            A   AHFI  LS+AWPDGHVE F G+V G+I WPPRG  GFGYDPIFQP G+  +FGEM
Sbjct: 127 EAGHDAHFICALSIAWPDGHVETFEGRVDGLITWPPRGDKGFGYDPIFQPLGHAASFGEM 186

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
             E K+                +SHRA AF   V
Sbjct: 187 DPEAKHA---------------MSHRADAFAKLV 205


>gi|146337342|ref|YP_001202390.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bradyrhizobium sp. ORS278]
 gi|146190148|emb|CAL74140.1| putative HAM1 protein [Bradyrhizobium sp. ORS278]
          Length = 202

 Score =  201 bits (511), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 137/210 (65%), Gaps = 11/210 (5%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMP 69
           +IA+HN  K+ EM  L+ P G+   SA EL L  PEETG++F+ NA IK++ AA+ A +P
Sbjct: 1   MIATHNAGKLVEMRELLAPHGVEAVSAGELGLGEPEETGDTFQANARIKAVAAAEAAQLP 60

Query: 70  ALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHF 129
           A +DDSG+V+  LDG PGI+SARWA      +DF  AM +IE  L+ + A     R+AHF
Sbjct: 61  AFADDSGIVVHALDGAPGIYSARWAGPG---KDFGAAMAQIERLLQERGAVTADKRTAHF 117

Query: 130 ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGG 189
           +S L +AWPDGH+E    +V G +VWPPRG  GFGYDP+F P+G+DRTFGEMT  EK+G 
Sbjct: 118 VSALCVAWPDGHIEEVEARVDGTLVWPPRGTAGFGYDPMFLPDGHDRTFGEMTSIEKHG- 176

Query: 190 IDSATLFSILSTDLLSHRARAFKCFVDNCL 219
                    L    LSHRARAF    + CL
Sbjct: 177 ------LPPLGLG-LSHRARAFVKLAEICL 199


>gi|254510867|ref|ZP_05122934.1| Ham1 family protein [Rhodobacteraceae bacterium KLH11]
 gi|221534578|gb|EEE37566.1| Ham1 family protein [Rhodobacteraceae bacterium KLH11]
          Length = 204

 Score =  200 bits (509), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 106/218 (48%), Positives = 133/218 (61%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ EM  L+ P G+    A E+NL  P+ET ++F  NA IK+  
Sbjct: 3   RKFDSDRLLVATHNQGKLEEMTHLLEPFGVTIVGAGEMNLPEPDETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  NAL +K    
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETGNG-RDFLMAMTRAYNALEAKNVPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R+A F S L LAWPDGH E F G   G +VWP RGQ GFGYDP+F P+GYD TF EM
Sbjct: 122 P--RTAQFRSTLVLAWPDGHDEVFEGIAPGHLVWPIRGQGGFGYDPMFVPDGYDITFAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHR RA + FV  C 
Sbjct: 180 DRWEKN---------------KISHRGRAVEMFVKGCF 202


>gi|94496906|ref|ZP_01303480.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sphingomonas sp. SKA58]
 gi|94423582|gb|EAT08609.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sphingomonas sp. SKA58]
          Length = 209

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 103/215 (47%), Positives = 138/215 (64%), Gaps = 20/215 (9%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           +RKL    +VIASHN  K+ E+ +L+ P GI   SA  L+L  PEETG +F  NA +K++
Sbjct: 11  IRKLQAGKLVIASHNAGKVREIAALLGPYGIEPISAGALDLPEPEETGTTFIANAELKAM 70

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA  +G+PAL+DDSGL ++ L G PG+ SARWA  +   +DF++AMQK+ + + +K   
Sbjct: 71  QAADLSGLPALADDSGLCVEALGGDPGLFSARWAGPD---KDFNLAMQKVWDGIAAKGPD 127

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             A   AHF+  L+LAWPDGHVE F G+V G IVWPPRG  GFGYDP+FQP+G+D +FGE
Sbjct: 128 --AGHDAHFVCALALAWPDGHVEAFEGRVDGTIVWPPRGDKGFGYDPMFQPHGHDISFGE 185

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           M  + K+                +SHRA AF   V
Sbjct: 186 MDPDAKHA---------------MSHRAHAFAQLV 205


>gi|90420651|ref|ZP_01228557.1| conserved hypothetical protein, Ham1 family [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334942|gb|EAS48703.1| conserved hypothetical protein, Ham1 family [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 214

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 136/214 (63%), Gaps = 10/214 (4%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +++ASHN+ KI E+  L+ P G   TSA +  L  PEETG +FE NA +K+L A +  G+
Sbjct: 11  LLVASHNIGKIWEIRELMEPFGFEVTSAKDKGLEDPEETGTTFEANAELKALAAMRATGL 70

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
            +LSDDSG+ ID L+G PGI+SARW   +   RDF MAM+ +E  L++  A  P  R A 
Sbjct: 71  VSLSDDSGIAIDALNGDPGIYSARWGGPD---RDFAMAMRNVEEKLQAAGATTPEQRRAK 127

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F++VL LA P G    F G+V G IVWPPRG+LGFGYDPIF P+G DRTFGEM   EK+ 
Sbjct: 128 FVAVLCLADPAGGTHLFRGEVEGTIVWPPRGELGFGYDPIFLPDGSDRTFGEMMSAEKHA 187

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
                  +       +SHRARAF+ F  + L ++
Sbjct: 188 -------WKPGQPTAMSHRARAFQKFARDALGVE 214


>gi|220924629|ref|YP_002499931.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Methylobacterium nodulans ORS 2060]
 gi|219949236|gb|ACL59628.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylobacterium nodulans ORS 2060]
          Length = 210

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 141/220 (64%), Gaps = 13/220 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M +L+   +VIA+HN  K+ EM  L+ P G+   SA EL+L  P ETG  F ENA IK+ 
Sbjct: 1   MARLLSGRVVIATHNSGKLKEMRELLAPFGVEAVSAGELDLPEPVETGTMFAENAAIKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           +AA   G+PA +DDSG+ ++ LDG PG+ SARWA    G +DF  AM +IE  L  + A 
Sbjct: 61  SAAAATGLPAFADDSGICVEALDGAPGLFSARWA---GGSKDFSAAMARIERELAQRGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +   R AHF+S L +AWPDGH E F G+V G +VWPPRG LGFGYDP+F+P+    TFGE
Sbjct: 118 N---RRAHFVSALVVAWPDGHEELFEGRVFGELVWPPRGTLGFGYDPMFKPDESPLTFGE 174

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           ++ EEK+ GID        +   LSHRARAF     +CLR
Sbjct: 175 LSSEEKH-GIDWE------NGRALSHRARAFLSLAASCLR 207


>gi|260431971|ref|ZP_05785942.1| Ham1 family protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415799|gb|EEX09058.1| Ham1 family protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 204

 Score =  199 bits (505), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 104/218 (47%), Positives = 133/218 (61%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+   + +++A+HN  K+ EM  L+ P G+    A E+NL  PEET ++F  NA IK+  
Sbjct: 3   RRFEGDRLLVATHNKGKLEEMSHLLEPFGVTVVGAAEMNLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  N L +  A  
Sbjct: 63  AAQATGLPALSDDSGITIDALDGAPGVYTADWAETGNG-RDFLMAMTRAHNELEALNAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R+A F   L LAWPDGH E F G V G +VWP RG+ GFGYDP+F P GYD+TF EM
Sbjct: 122 P--RTAQFRCTLVLAWPDGHDEVFEGVVPGHLVWPIRGKDGFGYDPMFVPEGYDQTFAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRARA + FV  C 
Sbjct: 180 DRWEKNK---------------ISHRARAVELFVKGCF 202


>gi|114705079|ref|ZP_01437987.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Fulvimarina pelagi HTCC2506]
 gi|114539864|gb|EAU42984.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Fulvimarina pelagi HTCC2506]
          Length = 216

 Score =  199 bits (505), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 106/214 (49%), Positives = 132/214 (61%), Gaps = 10/214 (4%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +++ASHN  KI E+  L+ P G   TSA E NL  PEETG ++E NA IK+L +    G+
Sbjct: 13  LLVASHNRGKIWEIRELMEPFGFEVTSAKEKNLEDPEETGTTYEANAEIKALASHNATGL 72

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
             LSDDSGL I+ L G PGI+SARWA  +   RDF MAM+ +E  L++  A  P  R A 
Sbjct: 73  ACLSDDSGLSIEALSGDPGIYSARWAGPD---RDFSMAMRNVEEKLQAVGATTPEKRRAT 129

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F++VL LA P G    + G+V G +VWPPRG LGFGYDPIF P+G DRTFGEM   EK+ 
Sbjct: 130 FVAVLCLAMPSGETHLYRGEVHGQVVWPPRGDLGFGYDPIFLPDGLDRTFGEMMSLEKHA 189

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
                  +     D LSHRARAF+ F    L  D
Sbjct: 190 -------WKPGQPDALSHRARAFQKFAREALGTD 216


>gi|307294010|ref|ZP_07573854.1| Ham1 family protein [Sphingobium chlorophenolicum L-1]
 gi|306880161|gb|EFN11378.1| Ham1 family protein [Sphingobium chlorophenolicum L-1]
          Length = 209

 Score =  198 bits (503), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 139/216 (64%), Gaps = 22/216 (10%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           +RKL    +VIASHN  K+ E+ +L+ P GI T SA  L+L  P+ETG +F  NA +K++
Sbjct: 11  IRKLGPGKLVIASHNPGKVREIGALLAPYGIETVSAGALDLPEPDETGTTFIANAELKAM 70

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFA 119
            AA  +G+PAL+DDSGL ++ L+G PGI SARWA    GE +DF +AMQ + + +++K  
Sbjct: 71  QAADLSGLPALADDSGLCVEALNGDPGIFSARWA----GEAKDFGLAMQLVWDNIQAKGP 126

Query: 120 HDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
              A   AHFI  L+LAWPDGHVE F G+V G I WPPRG  GFGYDPIFQP+G+  +FG
Sbjct: 127 E--AGHGAHFICALALAWPDGHVEAFEGRVDGTITWPPRGDQGFGYDPIFQPHGHAISFG 184

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           EM  E+K+                +SHRA AF   V
Sbjct: 185 EMEPEKKHA---------------MSHRADAFAQLV 205


>gi|163745105|ref|ZP_02152465.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanibulbus indolifex HEL-45]
 gi|161381923|gb|EDQ06332.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanibulbus indolifex HEL-45]
          Length = 203

 Score =  198 bits (503), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 104/218 (47%), Positives = 131/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK  E+ I+IA+HN  K+ EM  L  P G+    A E+NL  PEET  +F  NA IK+  
Sbjct: 3   RKFTESRILIATHNAGKLAEMSQLFAPHGVSVFGAAEMNLPEPEETETTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  GMPAL+DDSG+ ++ LD  PG+++A WAE+  G RDF MAM K  + L  K A  
Sbjct: 63  AAKATGMPALADDSGIEVEALDNAPGVYTADWAETENG-RDFVMAMTKTRDLLEEKNAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F + L LAWPDGH E F GKV+G +VWP RG+ G GYDP+FQP+G+D TF EM
Sbjct: 122 P--RRARFCATLVLAWPDGHDEVFVGKVNGTLVWPMRGEQGHGYDPMFQPDGHDVTFAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              +KN                +SHRA AF   +  C 
Sbjct: 180 DAAQKNS---------------ISHRADAFAKLIAGCF 202


>gi|218528483|ref|YP_002419299.1| deoxyribonucleotide triphosphate pyrophosphatase [Methylobacterium
           chloromethanicum CM4]
 gi|218520786|gb|ACK81371.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylobacterium chloromethanicum CM4]
          Length = 211

 Score =  197 bits (502), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 139/218 (63%), Gaps = 14/218 (6%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           +++   +VIA+HN  K+ EM  L+ P G+   SA EL L  P+ETG  F ENA IK+  A
Sbjct: 5   RILSGKVVIATHNAGKLVEMRELLAPFGVKAVSAGELGLPEPDETGTMFSENAAIKAHAA 64

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           AK +G+PA +DDSGL +D LDG PG+ SARWA  +   +DF  AM +I   L ++ A D 
Sbjct: 65  AKASGLPAFADDSGLCVDALDGAPGLFSARWAGPD---KDFSGAMARIAAELDTRGATD- 120

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R AHF+S L LAWPDGH E F G+V G +V  PRG LGFGYDP+F+P G DRTFGE++
Sbjct: 121 --RRAHFVSALVLAWPDGHTELFEGRVFGDLV-QPRGNLGFGYDPMFRPEGIDRTFGEIS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            EEK+G           S + LSHRARAF      CLR
Sbjct: 178 SEEKHG-------VDWQSGNALSHRARAFVLLAQACLR 208


>gi|240137078|ref|YP_002961547.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Methylobacterium extorquens AM1]
 gi|240007044|gb|ACS38270.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Methylobacterium extorquens AM1]
          Length = 211

 Score =  197 bits (502), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 139/218 (63%), Gaps = 14/218 (6%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           +++   +VIA+HN  K+ EM  L+ P G+   SA EL L  P+ETG  F ENA IK+  A
Sbjct: 5   RILSGKVVIATHNAGKLVEMRELLAPFGVEAVSAGELGLPEPDETGTMFSENAAIKAHAA 64

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           AK +G+PA +DDSGL +D LDG PG+ SARWA  +   +DF  AM +I   L ++ A D 
Sbjct: 65  AKASGLPAFADDSGLCVDALDGAPGLFSARWAGPD---KDFSGAMARIAAELDTRGATD- 120

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R AHF+S L LAWPDGH E F G+V G +V  PRG LGFGYDP+F+P G DRTFGE++
Sbjct: 121 --RRAHFVSALVLAWPDGHTELFEGRVFGDLV-APRGSLGFGYDPMFRPEGMDRTFGEIS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            EEK+G           S + LSHRARAF      CLR
Sbjct: 178 SEEKHG-------VDWQSGNALSHRARAFVQLAQACLR 208


>gi|254559086|ref|YP_003066181.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Methylobacterium extorquens DM4]
 gi|254266364|emb|CAX22128.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Methylobacterium extorquens DM4]
          Length = 211

 Score =  197 bits (501), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 138/218 (63%), Gaps = 14/218 (6%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           +++   +VIA+HN  K+ EM  L+ P G+   SA EL L  P+ETG  F ENA IK+  A
Sbjct: 5   RILSGKVVIATHNAGKLVEMRELLAPFGVEAVSAGELGLPEPDETGTMFAENAAIKAHAA 64

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           AK +G+PA +DDSGL +D LDG PG+ SARWA  +   +DF  AM +I   L  + A D 
Sbjct: 65  AKASGLPAFADDSGLCVDALDGAPGLFSARWAGPD---KDFSGAMARIAAELDKRGATD- 120

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R AHF+S L LAWPDGH E F G+V G +V  PRG LGFGYDP+F+P G DRTFGE++
Sbjct: 121 --RRAHFVSALVLAWPDGHTELFEGRVFGDLV-APRGSLGFGYDPMFRPEGMDRTFGEIS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            EEK+G           S + LSHRARAF      CLR
Sbjct: 178 SEEKHG-------VDWQSGNALSHRARAFVLLAQACLR 208


>gi|126738498|ref|ZP_01754203.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter sp. SK209-2-6]
 gi|126720297|gb|EBA17003.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter sp. SK209-2-6]
          Length = 204

 Score =  197 bits (501), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 132/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + I++A+HN  K+ E+  ++ P G+    A  ++L  PEET ++F  NA IK+  
Sbjct: 3   RKFEGDQILVATHNKGKLQEITEILAPYGVKVIGAAAMDLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  + + +K A  
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETGNG-RDFMMAMTRANDEITAKGADA 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  RSA F   L LAWPDGH E F G + G +VWP RG+ GFGYDP+F P+GYD T  EM
Sbjct: 122 P--RSAQFRCTLVLAWPDGHDEVFEGVMPGTLVWPIRGEGGFGYDPMFMPDGYDVTCAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            +EEKN                +SHR RA   FV  C 
Sbjct: 180 PKEEKN---------------QISHRGRAVSAFVQGCF 202


>gi|56694935|ref|YP_165280.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Ruegeria
           pomeroyi DSS-3]
 gi|62900156|sp|Q5LWF7|NTPA_SILPO RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|56676672|gb|AAV93338.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ruegeria pomeroyi DSS-3]
          Length = 204

 Score =  197 bits (501), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 130/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R    + ++IA+HN  K+ EM  L+ P G+    A E+NL  PEET ++F  NA IK+  
Sbjct: 3   RAFDGDTLLIATHNKGKLEEMAHLLQPFGVKVVGAAEMNLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  +AL +K A  
Sbjct: 63  AARATGLPALSDDSGITIDALDGAPGVYTADWAETGNG-RDFLMAMTRAHDALEAKSAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G   G +VWP RG  GFGYDP+F P GYD TF EM
Sbjct: 122 P--RLAQFRCTLVLAWPDGHDEVFEGVAPGHLVWPIRGAAGFGYDPMFVPEGYDVTFAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRARA + FV  C 
Sbjct: 180 DRWEKN---------------KISHRARAVEKFVKGCF 202


>gi|84684653|ref|ZP_01012554.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84667632|gb|EAQ14101.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacterales bacterium HTCC2654]
          Length = 204

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 137/218 (62%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R    + +VIASHN  K+ E+ +L+ P G+  +SA E  L  P+ET ++F  NA IK+  
Sbjct: 3   RAFTGDRLVIASHNKGKLREIAALVEPFGVTCSSASEFGLEEPDETEDTFAGNARIKAHF 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+++D LDG PG+++A WAE+  G RDF MAM+K  + L  + A +
Sbjct: 63  AAKATGLPALSDDSGIMVDALDGAPGVYTADWAETPDG-RDFPMAMRKTWDLLDERGAAE 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R+A F   L LAWPDGH E F G+VSG + WP RG  GFGYDPIF P+G+D TFGEM
Sbjct: 122 P--RTASFNCTLCLAWPDGHDEIFEGRVSGRLTWPMRGDQGFGYDPIFIPDGFDITFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             ++K+                +SHRA AF   V+ C 
Sbjct: 180 DPKQKH---------------EMSHRAVAFAKLVEGCF 202


>gi|188579738|ref|YP_001923183.1| deoxyribonucleotide triphosphate pyrophosphatase [Methylobacterium
           populi BJ001]
 gi|179343236|gb|ACB78648.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylobacterium populi BJ001]
          Length = 211

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 139/218 (63%), Gaps = 14/218 (6%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           +++   +VIA+HN  K+ EM  L+ P G+   SA EL L  P+ETG  F ENA IK+  A
Sbjct: 5   RILSGKVVIATHNAGKLVEMRELLAPFGVEAVSAGELGLPEPDETGTMFSENAAIKAHAA 64

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           AK +G+PA +DDSGL +D LDG PG+ SARWA      +DF  AM +I + L  + A + 
Sbjct: 65  AKASGLPAFADDSGLCVDALDGAPGLFSARWAGP---AKDFSGAMARIADELDRRGATN- 120

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R AHF+S L LAWPDGH E F G+V G +V  PRGQLGFGYDP+F+P G DRTFGE++
Sbjct: 121 --RRAHFVSALVLAWPDGHTELFEGRVFGDLV-APRGQLGFGYDPMFRPEGMDRTFGEIS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            EEK+G           S + LSHRARAF      CLR
Sbjct: 178 SEEKHG-------VDWQSGNALSHRARAFVELARACLR 208


>gi|149912895|ref|ZP_01901429.1| Ham1-like protein [Roseobacter sp. AzwK-3b]
 gi|149813301|gb|EDM73127.1| Ham1-like protein [Roseobacter sp. AzwK-3b]
          Length = 202

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 128/219 (58%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRK   + +++A+HN  K+ E+ SL+ P G+    A E  L  PEET  SF  NA IK+ 
Sbjct: 1   MRKFTGDTLLVATHNSGKLEEIASLLEPFGVKVVGAAEKGLAEPEETETSFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSG+ +D LDG PG+ +A WAE+ TG RDF MAM K  + L    A 
Sbjct: 61  AAAKATGLPALSDDSGIEVDALDGAPGVFTANWAETETG-RDFIMAMGKTHDRLVESGAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P   +A F   L LAWPDGH E F G V G IVWP RG  G GYDPIFQP+GY++TFGE
Sbjct: 120 QP--WTARFCCTLVLAWPDGHDEVFPGTVEGRIVWPMRGHEGHGYDPIFQPDGYEQTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M    KN                +SHRA AF   V  C 
Sbjct: 178 MDRWGKN---------------RISHRADAFAKLVKGCF 201


>gi|126730098|ref|ZP_01745910.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sagittula stellata E-37]
 gi|126709478|gb|EBA08532.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sagittula stellata E-37]
          Length = 203

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 129/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK     +++A+HN  K+ E+  L+ P G+    A  + L  P E G +F ENA IK+  
Sbjct: 3   RKFEGEKLLVATHNQGKLEEIADLLKPFGVEVVGAAGMGLPEPVEDGTTFIENARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LD  PG+++A WAE+ TG RDF MAM K  + L    A +
Sbjct: 63  AAKATGLPALSDDSGIEIDALDKAPGVYTADWAETETG-RDFVMAMTKSHDLLVKSGAPE 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P    A F   L LAWPDGH E F GK+ G +VWP RG+ G GYDPIFQP GYD TFGEM
Sbjct: 122 PWI--ARFCCTLVLAWPDGHDEVFPGKMEGRVVWPMRGEQGHGYDPIFQPEGYDVTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRA AF+ FVD C 
Sbjct: 180 DRWEKN---------------KISHRADAFRKFVDGCF 202


>gi|114762202|ref|ZP_01441670.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Pelagibaca bermudensis HTCC2601]
 gi|114545226|gb|EAU48229.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius sp. HTCC2601]
          Length = 203

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 130/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK     +++A+HN  K+ E+  L+ P G+    A E++L  PEETG +F ENA IK+  
Sbjct: 3   RKFEGKKLLVATHNRGKLEEIADLLKPYGVEVVGAAEMDLPEPEETGTTFVENARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  + L +    +
Sbjct: 63  AAQATGLPALSDDSGIAIDALDGAPGVYTADWAETGNG-RDFVMAMTRAHDELTASGKPE 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P   +A F   L LAWPDGH E F G + G +VWP RG  G GYDP+F+P GYD TFGEM
Sbjct: 122 P--WTARFCCTLVLAWPDGHDEVFPGVMEGRVVWPMRGDQGHGYDPVFEPQGYDITFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRA AF  FV  C 
Sbjct: 180 DRWEKN---------------KISHRADAFAKFVTGCF 202


>gi|85706899|ref|ZP_01037989.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius sp. 217]
 gi|85668510|gb|EAQ23381.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius sp. 217]
          Length = 202

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 100/219 (45%), Positives = 131/219 (59%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRK  ++ +++A+HN  K+ E+ +L+ P G+    A  L L  P+ET  +F  NA IK+ 
Sbjct: 1   MRKFTDDRLLVATHNAGKLGEITALLAPYGVEVVGAAALGLAEPDETETTFLGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+VID LDG PG+++A WAE+ TG RDF MAM +  +AL +  + 
Sbjct: 61  AAARATGLPALSDDSGIVIDALDGAPGVYTADWAETETG-RDFGMAMHRAHDALVA--SK 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P   +A F   L LAWPDGH E F G   G +VWP RG  G GYDP+FQP G+D TF E
Sbjct: 118 QPQPWTARFCCTLVLAWPDGHDEVFEGTAEGWVVWPMRGAQGHGYDPMFQPLGHDVTFAE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                +SHRA AF+  V  C 
Sbjct: 178 MVPTEKN---------------RISHRADAFRKLVAGCF 201


>gi|332188369|ref|ZP_08390094.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sphingomonas sp. S17]
 gi|332011598|gb|EGI53678.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sphingomonas sp. S17]
          Length = 208

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 105/216 (48%), Positives = 133/216 (61%), Gaps = 23/216 (10%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           +RKL    +V+ASHN  KI E   L+ P G+   +A +L+L  PEETG +F  NA +K+L
Sbjct: 11  IRKLEPGKLVLASHNKGKIVEFRELLAPYGVEVIAAGDLDLPEPEETGTTFVANAELKAL 70

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA  +G+PALSDDSGL ++ L G PG+ SARWA     E+DF MAM+ +E+ L      
Sbjct: 71  AAADLSGLPALSDDSGLCVEALGGDPGLFSARWAGP---EKDFAMAMRAVEDRLN----E 123

Query: 121 DPAF-RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
           +P   R+AHF+  L++ WPDGHVE F G+V G IVWPPRG  G GYDPIFQP GY  TF 
Sbjct: 124 EPDMSRAAHFVCALAVGWPDGHVEWFEGRVDGTIVWPPRGDKGHGYDPIFQPIGYTETFA 183

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           EM + EKN                +SHRA AF   V
Sbjct: 184 EMDQGEKN---------------RISHRADAFGQLV 204


>gi|86136763|ref|ZP_01055341.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter sp. MED193]
 gi|85826087|gb|EAQ46284.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter sp. MED193]
          Length = 204

 Score =  194 bits (494), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 131/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + I++A+HN  K+ E+  ++ P G+    A E++L  PEET ++F  NA IK+  
Sbjct: 3   RKFEGDQILVATHNAGKLQEITEILAPFGVKVVGAAEMDLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  + + +K    
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETGNG-RDFMMAMTRANDEISAKGPDA 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  RSA F   L LAWPDGH E F G ++G +VWP RG+ GFGYDP+F P GYD T  +M
Sbjct: 122 P--RSAQFRCTLVLAWPDGHDEVFEGVMAGDLVWPIRGEGGFGYDPMFMPEGYDVTCAQM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            + EKN                +SHR RA   FV  C 
Sbjct: 180 DKAEKN---------------RISHRGRAVSAFVKGCF 202


>gi|170742382|ref|YP_001771037.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Methylobacterium sp. 4-46]
 gi|168196656|gb|ACA18603.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylobacterium sp. 4-46]
          Length = 210

 Score =  194 bits (494), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 139/219 (63%), Gaps = 13/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + +   +VIA+HN  K+ EM  L+ P G+   SA EL L  PEETG  F ENA IK+ 
Sbjct: 1   MGRRLTGRVVIATHNGGKLREMRELLAPFGVEAVSAGELGLAEPEETGVMFAENAAIKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA  AG+PA +DDSGL +D LDG PG+ SARWA  +   +DF  AM+++E  L  + A 
Sbjct: 61  AAASAAGLPAFADDSGLCVDALDGAPGLFSARWAGPS---KDFGQAMERVERELALRGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +   R AHF+S L LAWPDGH E F G+V G +VWPPRG  GFGYDP+F+P+    +FGE
Sbjct: 118 N---RRAHFVSALVLAWPDGHEELFEGRVFGELVWPPRGSRGFGYDPMFKPDESPLSFGE 174

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           +  EEK+ GID A      +   LSHRARAF     +CL
Sbjct: 175 LGAEEKH-GIDWA------NGRALSHRARAFLSLAASCL 206


>gi|163849852|ref|YP_001637895.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Methylobacterium extorquens PA1]
 gi|163661457|gb|ABY28824.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylobacterium extorquens PA1]
          Length = 211

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 137/218 (62%), Gaps = 14/218 (6%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           +++   +VIA+HN  K+ EM  L+ P G+   SA EL L  P+ETG  F ENA IK+  A
Sbjct: 5   RILSGKVVIATHNAGKLVEMRELLAPFGVEAVSAGELGLPEPDETGTMFSENAAIKAHAA 64

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           AK +G+PA +DDSGL +D LDG PG+ SARWA  +   +DF  AM +I   L  + A D 
Sbjct: 65  AKASGLPAFADDSGLCVDALDGAPGLFSARWAGPD---KDFSGAMARIAAELDKRGATD- 120

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R AHF+S L LAWPDGH E F G+V G +V  P G LGFGYDP+F+P G DRTFGE++
Sbjct: 121 --RRAHFVSALVLAWPDGHTELFEGRVFGDLV-APLGSLGFGYDPMFRPEGMDRTFGEIS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            EEK+G           S + LSHRARAF      CLR
Sbjct: 178 SEEKHG-------VDWQSGNALSHRARAFVLLAQACLR 208


>gi|260429183|ref|ZP_05783160.1| Ham1 family protein [Citreicella sp. SE45]
 gi|260419806|gb|EEX13059.1| Ham1 family protein [Citreicella sp. SE45]
          Length = 203

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 102/218 (46%), Positives = 128/218 (58%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  L+ P G+      EL L  PEETG +F ENA IK+  
Sbjct: 3   RKFEGDRLLVATHNQGKLDEITDLLKPFGVSVVGNAELGLPEPEETGTTFVENARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+  G+PALSDDSG+ ID L G PG+++A WAE+  G RDF MAM +  + L +  A  
Sbjct: 63  AAQATGLPALSDDSGIAIDALGGAPGVYTADWAETGNG-RDFVMAMTRAHDELLASGAAQ 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P   +A F   L LAWPDGH E F G + G +VWP RG  G GYDP+FQP GYD TFGEM
Sbjct: 122 P--WTARFCCTLVLAWPDGHDEVFPGVMEGQVVWPMRGDQGHGYDPVFQPQGYDITFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRA AF  FV  C 
Sbjct: 180 DRWEKN---------------RISHRADAFAKFVKGCF 202


>gi|90421848|ref|YP_530218.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodopseudomonas palustris BisB18]
 gi|90103862|gb|ABD85899.1| Ham1-like protein [Rhodopseudomonas palustris BisB18]
          Length = 211

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 134/219 (61%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG+SF  NA IK++
Sbjct: 1   MHRRITGQLVIATHNPGKLAEMRELLAPYGIAAVSAGELKLAEPDETGDSFRANARIKAI 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA  A +PA +DDSGLV++ LDG PGI SARWA      +DF  AM +IE  L+ + A 
Sbjct: 61  AAANAAQLPAFADDSGLVVEALDGAPGIFSARWAGEG---KDFTSAMTRIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R AHF+S L +AWPDGH+E    +  G +VWPPRG  GFGYDP F P G+ RTFGE
Sbjct: 118 TSDQRKAHFVSALCVAWPDGHLEEVEARADGTLVWPPRGTAGFGYDPAFLPEGHVRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+G          L    LSHRARAF    + CL
Sbjct: 178 MTSVEKHG-------LPPLGLG-LSHRARAFVKLAEICL 208


>gi|254462309|ref|ZP_05075725.1| Ham1 family [Rhodobacterales bacterium HTCC2083]
 gi|206678898|gb|EDZ43385.1| Ham1 family [Rhodobacteraceae bacterium HTCC2083]
          Length = 204

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 133/218 (61%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK  ++ ++IA+HN  K+ EM  L+ P G+    A E NL  PEET ++F  NA IK+  
Sbjct: 3   RKFSDDILLIATHNAGKLEEMRELLAPFGVSVVGATEKNLAEPEETEDNFIGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A K  G+PALSDDSG+ ++ L+ +PG+++A WAE+  G RDF MAM K  + L +  A  
Sbjct: 63  AVKATGLPALSDDSGIEVEALNNEPGVYTADWAETPNG-RDFVMAMTKTNDKLEAVNAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F S L LAWPDGH E F GK +G +VWP RGQ+G GYDP+F P+GYD TFGEM
Sbjct: 122 P--RRARFCSTLVLAWPDGHDEVFEGKANGSLVWPMRGQIGHGYDPMFMPDGYDITFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             E+KN                +SHRA AF   V  C 
Sbjct: 180 AFEKKNE---------------ISHRADAFAKLVKGCF 202


>gi|56550909|ref|YP_161748.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241762327|ref|ZP_04760407.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|62900165|sp|Q5NRL7|NTPA_ZYMMO RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|56542483|gb|AAV88637.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373121|gb|EER62760.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 209

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 133/220 (60%), Gaps = 22/220 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L    +V+ASHN  K+ E+  L+ P G+ T SA EL L  P E GNSF  NA IK+  
Sbjct: 11  RRLEPGRLVLASHNQGKLREIRELLSPFGLETVSAAELGLPEPVEDGNSFIANAEIKARF 70

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFAH 120
            A+  G  AL+DDSGL ++ LD  PGI+SARWA    GE RDFD AM+K+   L +K A 
Sbjct: 71  VAEKTGSVALADDSGLCVEALDEAPGIYSARWA----GEPRDFDKAMEKVHQELTAKGAE 126

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             A + AHF+  LSL WPDGHVENF G V G ++WPPRG  GFGYDP+F  +G+ ++F E
Sbjct: 127 --ASKRAHFVCALSLCWPDGHVENFEGHVWGNLIWPPRGDRGFGYDPMFVADGHQQSFAE 184

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +  E K                 +SHR+ AFK  +  CLR
Sbjct: 185 IGAEAKKA---------------ISHRSEAFKQLLAACLR 209


>gi|83942033|ref|ZP_00954495.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sulfitobacter sp. EE-36]
 gi|83847853|gb|EAP85728.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sulfitobacter sp. EE-36]
          Length = 203

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 129/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + I++A+HN  K+ EM  L  P G+    A E+NL  PEET N+F  NA IK+  
Sbjct: 3   RKFTGDQILVATHNAGKLQEMTELFAPFGVTVKGAAEMNLGEPEETENTFIGNARIKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A    G+PAL+DDSG+ ++ LD  PG+++A W+E+  G RDF MAM K    L    A  
Sbjct: 63  AVAATGLPALADDSGIEVEALDNAPGVYTADWSETPNG-RDFVMAMTKTHRLLEEANAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F + L L WPDGH E F G+V+G +VWP RG +G GYDP+FQP+G+D+TFGEM
Sbjct: 122 P--RRARFCATLVLVWPDGHEEVFEGRVNGTLVWPIRGDIGHGYDPMFQPDGHDQTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           + + KN                +SHRA AF   +  C 
Sbjct: 180 SADAKNA---------------ISHRADAFAKLISACF 202


>gi|254475771|ref|ZP_05089157.1| Ham1 family protein [Ruegeria sp. R11]
 gi|214030014|gb|EEB70849.1| Ham1 family protein [Ruegeria sp. R11]
          Length = 204

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 132/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ EM  L+ P G+    A E+NL  PEET ++F  NA IK+  
Sbjct: 3   RKFEGDRLLVATHNKGKLEEMTHLLQPFGVTVVGAGEMNLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +    L +K A  
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETGNG-RDFMMAMTRAHTELEAKNA-- 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G + G +VWP RG+ GFGYDP+FQP+G+++T  EM
Sbjct: 120 PYPRRAQFRCTLVLAWPDGHDEVFEGVMPGQLVWPIRGKDGFGYDPMFQPDGHEQTCAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHR +A   FV+ C 
Sbjct: 180 DRWEKN---------------KISHRGQAVAKFVEACF 202


>gi|260753399|ref|YP_003226292.1| deoxyribonucleotide triphosphate pyrophosphatase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258552762|gb|ACV75708.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 209

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 103/220 (46%), Positives = 133/220 (60%), Gaps = 22/220 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L    +V+ASHN  K+ E+  L+ P G+ T SA EL L  P E G+SF  NA IK+  
Sbjct: 11  RRLEPGRLVLASHNQGKLREIRELLSPFGLETVSAAELGLPEPVEDGDSFIANAEIKARF 70

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFAH 120
            A+  G  AL+DDSGL ++ LD  PGI+SARWA    GE RDFD AM+K+   L +K A 
Sbjct: 71  VAEKTGSVALADDSGLCVEALDEAPGIYSARWA----GEPRDFDKAMEKVHQELTAKGAE 126

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             A + AHF+  LSL WPDGHVENF G V G ++WPPRG  GFGYDP+F  +G+ ++F E
Sbjct: 127 --ASKRAHFVCALSLCWPDGHVENFEGHVWGNLIWPPRGDRGFGYDPMFVADGHQQSFAE 184

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +  E K                 +SHR+ AFK  +  CLR
Sbjct: 185 IGAEAKKA---------------ISHRSEAFKQLLAACLR 209


>gi|89052696|ref|YP_508147.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Jannaschia sp. CCS1]
 gi|88862245|gb|ABD53122.1| Ham1-like protein [Jannaschia sp. CCS1]
          Length = 203

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 132/216 (61%), Gaps = 18/216 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+   + ++IA+HN  K+ EM  L+ P GI  + A + +L  P+ET  +F  NA IK+ 
Sbjct: 1   MRRFTGDQLLIATHNQGKLDEMRHLLQPFGIRVSGAADHDLPEPDETETTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSG+ ID L G PG+++A WAE+  G RDF MAM++    L +  A 
Sbjct: 61  AAAKATGLPALSDDSGIEIDALGGAPGVYTADWAETPDG-RDFVMAMERAHRELEAVGAS 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F   L LAWPDGH E F G + G +VWP RG+ G GYDP+FQPNGYD TFGE
Sbjct: 120 HP--RTARFCCTLVLAWPDGHDEVFPGVMEGQVVWPMRGEQGHGYDPVFQPNGYDLTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           M   EKN                +SHRARA +  V+
Sbjct: 178 MDRWEKN---------------KISHRARAVEQLVE 198


>gi|114326690|ref|YP_743847.1| xanthosine triphosphate pyrophosphatase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114314864|gb|ABI60924.1| xanthosine triphosphate pyrophosphatase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 205

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 104/223 (46%), Positives = 134/223 (60%), Gaps = 24/223 (10%)

Query: 2   RKLIENN-IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           R+L  N+ +++A+HN  K+ E DSL+ P  I   SA  LNL  PEET + F  NA +K+L
Sbjct: 5   RRLNRNDTLILATHNAGKVREFDSLLKPWSITLVSAASLNLPEPEETASDFVGNARLKAL 64

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+ +G PAL+DDSG  +  L+G PGI SARWA     E+DF  AMQ+I +      A 
Sbjct: 65  AAAQVSGQPALADDSGFCVAALEGDPGIFSARWAGP---EKDFAAAMQRIHD-----LAG 116

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +   R A F+ VLSLAWPDGH ++F G+V G  VWPPRG  GFGYDP+F P G + T+GE
Sbjct: 117 EDEDRRAWFVCVLSLAWPDGHTDSFLGRVDGERVWPPRGTQGFGYDPMFIPRGGNLTYGE 176

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           +   EK               D  SHRARAF+ F   CL + E
Sbjct: 177 IAPAEK---------------DAASHRARAFEQFAAACLPLAE 204


>gi|103485752|ref|YP_615313.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sphingopyxis alaskensis RB2256]
 gi|98975829|gb|ABF51980.1| Ham1-like protein [Sphingopyxis alaskensis RB2256]
          Length = 210

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 132/218 (60%), Gaps = 21/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +VIASHN  K+ E+ +L+ P G+   SA +L L  PEETG SF +NA++K+  
Sbjct: 6   RKLAPGKLVIASHNAGKVREIRALLAPYGVDPVSAADLGLPEPEETGTSFRDNALLKAHA 65

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE----RDFDMAMQKIENALRSK 117
           +A  +G+PAL+DDSGL +D L G+PG+++A WAE    E    RD+ +AM K+E  L  +
Sbjct: 66  SAAASGLPALADDSGLCVDALGGRPGVYTADWAERQWFEGNPGRDWYLAMGKVEGLLAEQ 125

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                  RSA F+  L+LAWPDGH E F G+V G + WPPRG+LGFGYDP+F P G   T
Sbjct: 126 GPD--VDRSARFVCTLALAWPDGHAEVFEGRVEGGLTWPPRGKLGFGYDPVFVPAGKTLT 183

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           F E+   EK+                +SHRA AF   V
Sbjct: 184 FAEIEPAEKHA---------------ISHRADAFAKLV 206


>gi|259417925|ref|ZP_05741844.1| Ham1 family protein [Silicibacter sp. TrichCH4B]
 gi|259346831|gb|EEW58645.1| Ham1 family protein [Silicibacter sp. TrichCH4B]
          Length = 204

 Score =  191 bits (486), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 98/218 (44%), Positives = 130/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  ++ P G+    A E+NL  PEET ++F  NA IK+  
Sbjct: 3   RKFEGDTLLVATHNAGKLGEITEILAPFGVKVVGAGEMNLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  + + +K    
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETGQG-RDFMMAMTRANDEITAKGPDA 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R+A F   L LAWPDGH E F G + G +VWP RG+ GFGYDP+F P GYD T  +M
Sbjct: 122 P--RTAQFRCTLVLAWPDGHDEVFEGVMPGRLVWPIRGEGGFGYDPMFMPEGYDVTCAQM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            + EKN                +SHR RA   FV  C 
Sbjct: 180 DKAEKN---------------RISHRGRALAQFVQGCF 202


>gi|83953082|ref|ZP_00961804.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sulfitobacter sp. NAS-14.1]
 gi|83842050|gb|EAP81218.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sulfitobacter sp. NAS-14.1]
          Length = 203

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 130/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + I++A+HN  K+ EM  L  P G+    A E+NL  PEET N+F  NA IK+  
Sbjct: 3   RKFTGDQILVATHNAGKLQEMTELFAPFGVTVKGAAEMNLGEPEETENTFIGNARIKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A    G+PAL+DDSG+ ++ LD  PG+++A W+E+  G RDF MAM K    L    A+ 
Sbjct: 63  AVAATGLPALADDSGIEVEALDNAPGVYTADWSETPNG-RDFVMAMTKTHRLLEE--ANA 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F + L L WPDGH E F G+V+G +VWP RG +G GYDP+FQP+G+++TFGEM
Sbjct: 120 PHPRRARFCATLVLVWPDGHEEVFEGRVNGTLVWPIRGDIGHGYDPMFQPDGHEQTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           + + KN                +SHRA AF   +  C 
Sbjct: 180 SADAKNA---------------ISHRADAFAKLISACF 202


>gi|182677772|ref|YP_001831918.1| Ham1 family protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633655|gb|ACB94429.1| Ham1 family protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 215

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 136/213 (63%), Gaps = 12/213 (5%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + +VIA+HN  K+ EM  L+ P  I   SA EL L  PEETG +F  NA IK+  AA+ +
Sbjct: 9   DRLVIATHNAGKLREMRELLAPYRITAVSAGELRLPEPEETGATFIANAEIKAKAAAERS 68

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL ++ L G PGI+SARWA      +DF  AM +I  A+  + A  P    
Sbjct: 69  GLPALADDSGLCVEGLGGAPGIYSARWAGEG---KDFAAAMSRI--AMELEKAKVPPPHR 123

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A+F+S L+LA PDG +  F GKV GI+V+PPRG  GFGYDPIF P+GY+RTFGEM  EEK
Sbjct: 124 AYFVSALALALPDGTISTFEGKVFGILVFPPRGTRGFGYDPIFLPDGYERTFGEMEAEEK 183

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           +G            +  LSHRARAF+ F   CL
Sbjct: 184 HG-------LPADGSQALSHRARAFQLFARACL 209


>gi|99082711|ref|YP_614865.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Ruegeria
           sp. TM1040]
 gi|99038991|gb|ABF65603.1| Ham1-like protein [Ruegeria sp. TM1040]
          Length = 204

 Score =  191 bits (484), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 98/218 (44%), Positives = 132/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  ++ P G+    A ELNL  PEET ++F  NA IK+  
Sbjct: 3   RKFNGDTLLVATHNEGKLGEITEILAPFGVKVVGAGELNLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+N G RDF  AM +  + + +K    
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETNNG-RDFMKAMTRANDEITAKGPDA 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R+A F   L LAWPDGH E F G ++G +VWP RG+ GFGYDP+F P GYD T  ++
Sbjct: 122 P--RTAQFRCTLVLAWPDGHDEVFEGVMAGSLVWPIRGEGGFGYDPMFMPEGYDVTCAQL 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            ++EKN                +SHR RA   FV  C 
Sbjct: 180 DKDEKN---------------RISHRGRALAKFVQGCF 202


>gi|163737987|ref|ZP_02145403.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Phaeobacter gallaeciensis BS107]
 gi|163742617|ref|ZP_02150003.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Phaeobacter gallaeciensis 2.10]
 gi|161384202|gb|EDQ08585.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Phaeobacter gallaeciensis 2.10]
 gi|161388603|gb|EDQ12956.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Phaeobacter gallaeciensis BS107]
          Length = 204

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 131/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK + + +++A+HN  K+ EM  L+ P G+    A E++L  P ET ++F  NA IK+  
Sbjct: 3   RKFVGDRLLVATHNKGKLEEMKHLLQPFGVTVVGAGEMDLPEPAETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  N L +K A  
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETGDG-RDFMMAMTRAHNELEAKGAAH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G + G +VWP RG+ GFGYDP+FQP+G+ +T  EM
Sbjct: 122 P--RLAQFRCTLVLAWPDGHDEVFEGVMPGQLVWPIRGKDGFGYDPMFQPDGHTQTCAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
               KN                +SHR +A   FV+ C 
Sbjct: 180 DRWAKN---------------KISHRGQAVAKFVEACF 202


>gi|126724519|ref|ZP_01740362.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacterales bacterium HTCC2150]
 gi|126705683|gb|EBA04773.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacterales bacterium HTCC2150]
          Length = 203

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/223 (45%), Positives = 135/223 (60%), Gaps = 26/223 (11%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+  E  ++IA+HN  K+ E++ L+ P G+   SA +LNL  P+ET ++F  NA IK+ 
Sbjct: 1   MRQFSEKKLLIATHNQGKLEEIERLLAPFGVAVVSAGQLNLDEPDETEDNFIGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAM----QKIENALRS 116
            A K  G+PAL+DDSG+ ID LDG PG+++A WAE+  G RDF MAM    QK+E+A+  
Sbjct: 61  AAVKATGLPALADDSGIEIDALDGAPGVYTADWAETPNG-RDFVMAMTNTWQKLEDAVA- 118

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
                P  R+A F   L LAWPDGH E F G++ G + WP RG+ G GYDPIF P+GYD 
Sbjct: 119 -----PYPRTARFRCTLVLAWPDGHDEIFEGQIDGAVTWPLRGEQGHGYDPIFMPDGYDI 173

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           T GEM   +KN                +SHRA AF   V+ C 
Sbjct: 174 TLGEMDRWKKN---------------EISHRADAFNKLVNGCF 201


>gi|154246477|ref|YP_001417435.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Xanthobacter autotrophicus Py2]
 gi|154160562|gb|ABS67778.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Xanthobacter autotrophicus Py2]
          Length = 211

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 108/218 (49%), Positives = 136/218 (62%), Gaps = 13/218 (5%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           ++++  +V+A+HN  K+ EM  L+ P G+   SA EL L  PEET  +F  NA +K+  A
Sbjct: 4   RILKGRLVVATHNPGKLIEMRMLLAPHGVEAVSAGELGLTEPEETEETFSGNARLKAQAA 63

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A+ A +PA +DDSGLVID L G PGIH+ARWA  +   RDF+MAM+K+E  L    A  P
Sbjct: 64  AQAANLPAFADDSGLVIDALGGAPGIHTARWAGPD---RDFEMAMEKVEAELEKVGAIAP 120

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F+S L LAWPDGHVE F G V G +VWPPRG  GFGYDP+F P  Y +TF EMT
Sbjct: 121 EQRRARFVSALCLAWPDGHVEEFEGVVEGTLVWPPRGAKGFGYDPMFIPEDYPKTFAEMT 180

Query: 183 EEEKNGGIDSATLFSILSTDL-LSHRARAFKCFVDNCL 219
            +EK+         S+      LSHRARAF      CL
Sbjct: 181 ADEKH---------SMPPKGFGLSHRARAFLKLSQACL 209


>gi|254295452|ref|YP_003061475.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Hirschia baltica ATCC 49814]
 gi|254043983|gb|ACT60778.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Hirschia baltica ATCC 49814]
          Length = 204

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 102/218 (46%), Positives = 131/218 (60%), Gaps = 21/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +V A+HN  K+ E+  L+ PLG    SA EL+L  PEETG +FE NA +K+L 
Sbjct: 8   RKLQPGRLVAATHNQGKVRELKDLLEPLGFEPVSAGELDLPEPEETGLTFEANAELKALA 67

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G PAL+DDSGL +D L+G PGI+SARWA  +   +DF +AM+K+  AL  + A  
Sbjct: 68  AAIASGSPALADDSGLAVDALNGAPGIYSARWAGES---KDFKLAMEKVNQALEDEKA-- 122

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            A RSA F+  L +AWPDG    F G+V G +VWPPRG+ GFGYD +F   G   TFGEM
Sbjct: 123 -AERSARFVCALCVAWPDGETVTFRGEVKGELVWPPRGENGFGYDAMFVAEGETITFGEM 181

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
               K+G               +SHRA AFK   +  L
Sbjct: 182 EPARKHG---------------MSHRANAFKLLTEAML 204


>gi|260576116|ref|ZP_05844109.1| Ham1 family protein [Rhodobacter sp. SW2]
 gi|259021596|gb|EEW24899.1| Ham1 family protein [Rhodobacter sp. SW2]
          Length = 202

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 132/219 (60%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRK   + +++A+HN  K+ E+  L+ P GI  TSA E+ L  P ET ++F  NA IK+ 
Sbjct: 1   MRKFSGDRLLVATHNRGKLEEIAKLLEPFGIDVTSAGEMGLAEPIETESTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A +  G+PAL+DDSG+ ID LDG PG+++A WAE+ TG RDF MAM K  + L +  A 
Sbjct: 61  FATQATGLPALADDSGISIDALDGAPGVYTADWAETPTG-RDFGMAMAKTWDRLEAVNAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F   L LAWPDGH E F G + G +VWP RG  G GYDPIFQP+G+D TFGE
Sbjct: 120 FP--RRAQFRCTLVLAWPDGHDEVFEGVMPGQVVWPMRGDQGHGYDPIFQPDGFDLTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   +KN                +SHRA AF+  V  C 
Sbjct: 178 MDRWQKN---------------QISHRADAFRKLVAGCF 201


>gi|114769781|ref|ZP_01447391.1| putative deoxyribonucleotide triphosphate pyrophosphatase [alpha
           proteobacterium HTCC2255]
 gi|114549486|gb|EAU52368.1| putative deoxyribonucleotide triphosphate pyrophosphatase [alpha
           proteobacterium HTCC2255]
          Length = 201

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 132/215 (61%), Gaps = 20/215 (9%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL E  IV+ASHN  K+ E+  L+ P GI   SA +L L  PEET N++  NA IK+ 
Sbjct: 1   MRKLNEKQIVLASHNKGKLKEIGHLLKPFGISVISASDLGLDEPEETENTYAGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK +G PALSDDSG  +++LDG PG++SA WAE++ G R+F MAM KI + ++   A 
Sbjct: 61  FAAKASGKPALSDDSGFSVEILDGAPGVYSADWAETSNG-RNFSMAMSKIWDKIQH--AE 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P    A F   L LAWPDGH E F G ++G I WPPRG  GFGYDP+F   G  +TFGE
Sbjct: 118 KPC--KAKFCCTLCLAWPDGHDELFEGSINGEIAWPPRGNNGFGYDPMFIAEGMHQTFGE 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           M   +K+               L+SHRA AFK  +
Sbjct: 176 MLPTDKH---------------LISHRADAFKKLI 195


>gi|170749349|ref|YP_001755609.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Methylobacterium radiotolerans JCM 2831]
 gi|170655871|gb|ACB24926.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylobacterium radiotolerans JCM 2831]
          Length = 209

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 133/219 (60%), Gaps = 14/219 (6%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + +   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG  F ENA IK+ 
Sbjct: 1   MSRRLTGKVVIATHNAGKLTEMRELLAPFGIEAVSAGELGLPEPDETGTLFAENAAIKAQ 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PA +DDSGL +D LDG PGI SARWA      +DF  AM +I   L  + A 
Sbjct: 61  AAAEATGLPAFADDSGLCVDALDGAPGIFSARWAGPT---KDFAGAMARIFAELDRRGAA 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           D   R AHF+S L LAWPDGH E F G+V G +V   +G  GFGYDPIF+P+G+DRTFGE
Sbjct: 118 D---RRAHFVSALVLAWPDGHTELFEGRVFGDLV-AAKGSAGFGYDPIFRPDGHDRTFGE 173

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT EEK+G               LSHRARAF      CL
Sbjct: 174 MTAEEKHG-------VDWQKGRGLSHRARAFVELSRACL 205


>gi|300024893|ref|YP_003757504.1| Ham1 family protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526714|gb|ADJ25183.1| Ham1 family protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 296

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 133/215 (61%), Gaps = 19/215 (8%)

Query: 1   MRKLIE-NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKS 59
           MR+L   + +V+ASHN  K+ E++ L+ P G+   SA +LNL  PEET  +F  NA +K+
Sbjct: 1   MRRLTHGSKLVVASHNPGKVWEINQLLAPYGLNAISAGDLNLSEPEETETTFAGNARLKA 60

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
           L AA+ +G+P+L+DDSGL +D LDG PGI+SARWA      +DF +AM+K+ + +  +  
Sbjct: 61  LAAAEGSGLPSLADDSGLEVDCLDGAPGIYSARWAGPG---KDFGIAMKKVADEISVRNG 117

Query: 120 HDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
             P    A+FISVL LAWPDG  + F GKV G +VWP RG  GFGYDP+F  +G  +TFG
Sbjct: 118 WGPPHPKANFISVLCLAWPDGETQIFEGKVFGHLVWPARGGNGFGYDPMFVADGESKTFG 177

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
           EM   EK                 +SHR RAF  F
Sbjct: 178 EMEPAEKYA---------------ISHRTRAFAVF 197


>gi|254472486|ref|ZP_05085886.1| Ham1 family protein [Pseudovibrio sp. JE062]
 gi|211958769|gb|EEA93969.1| Ham1 family protein [Pseudovibrio sp. JE062]
          Length = 213

 Score =  187 bits (476), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 100/218 (45%), Positives = 140/218 (64%), Gaps = 15/218 (6%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L    +V+ASHN  K+ E+  ++ P G    SA +L+L  P E G++FE NA IK+L 
Sbjct: 9   RRLEPGKLVLASHNKGKLREIQDMLAPHGFEVLSAGDLDLPEPVEDGDTFEANAAIKALA 68

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA   G+PAL+DDSG  ++ L+G PGI+SARWA      +DF +AMQ +++ L    A D
Sbjct: 69  AATATGLPALADDSGFCVNGLNGDPGIYSARWAGPG---KDFGVAMQSVQDKLTETGATD 125

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A+F++VL +AWPDGH + + G++ G + WPPRG  GFGYDP+F P G+DRTFGEM
Sbjct: 126 ---RTAYFVAVLCMAWPDGHTQFYRGEIHGELAWPPRGLEGFGYDPMFVPEGFDRTFGEM 182

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            ++EK+         +    + LSHRARAF  F   CL
Sbjct: 183 DKQEKH---------TTKEGEALSHRARAFVKFQKECL 211


>gi|149204371|ref|ZP_01881338.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius sp. TM1035]
 gi|149142256|gb|EDM30303.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius sp. TM1035]
          Length = 202

 Score =  187 bits (475), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 98/219 (44%), Positives = 129/219 (58%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRK  ++ +++A+HN  K+ E+ +L+ P G+    A  + L  P ET  SF  NA IK+ 
Sbjct: 1   MRKFTDDRLLVATHNAGKLDEIRALLAPYGVDVVGAAAMGLQEPAETETSFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+ ID LDG PG+++A WAE+ TG RDF  AM +   AL +  + 
Sbjct: 61  AAAQATGLPALSDDSGIAIDALDGAPGVYTADWAETETG-RDFGKAMSRAHEALLA--SK 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P   +A F   L LAWPDGH E F G V G +VWP RG  G GYDP+FQP G+D TF E
Sbjct: 118 EPQPWTARFCCTLVLAWPDGHDEVFEGTVEGWVVWPIRGAEGHGYDPMFQPLGHDLTFAE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+  +KN                +SHRA AF   V  C 
Sbjct: 178 MSPAKKN---------------RISHRADAFGKLVAGCF 201


>gi|255264234|ref|ZP_05343576.1| Ham1 family protein [Thalassiobium sp. R2A62]
 gi|255106569|gb|EET49243.1| Ham1 family protein [Thalassiobium sp. R2A62]
          Length = 203

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 100/218 (45%), Positives = 131/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK  +  +++ASHN  KI E+ +L+ P G+   S ++ +L  PEET  +F  NA IK+  
Sbjct: 3   RKFGDKTLLVASHNAGKIEEIAALLEPFGVSIKSNIDFDLPEPEETETTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A++  G+PALSDDSG+ +D L G PG+++A WAE+  G RDF MAM +  N L +  A  
Sbjct: 63  ASQATGLPALSDDSGIEVDALGGAPGVYTADWAETENG-RDFPMAMTRTWNELDAINA-- 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P+ R+A F S L LAWPDGH E F GK+ G +VWP RG+ G GYDPIF  +GYD T GEM
Sbjct: 120 PSPRTARFKSTLVLAWPDGHDEVFDGKIEGQVVWPMRGKQGHGYDPIFMADGYDITMGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRA A K  V  C 
Sbjct: 180 DRWEKNK---------------ISHRADALKKLVAACF 202


>gi|254463982|ref|ZP_05077393.1| Ham1 family [Rhodobacterales bacterium Y4I]
 gi|206684890|gb|EDZ45372.1| Ham1 family [Rhodobacterales bacterium Y4I]
          Length = 204

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 98/218 (44%), Positives = 131/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +++A+HN  K+ E+  ++ P G+    A E+NL  PEET ++F  NA IK+  
Sbjct: 3   RKLEGGKLLVATHNKGKLSEIAEILAPYGVTVIGAGEMNLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID L+G PG+++A WAE+  G RDF MAM +  + L +  A  
Sbjct: 63  AAKATGLPALSDDSGITIDALNGAPGVYTADWAETPDG-RDFKMAMTRANDELTAAGAAA 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R+A F   L +AWPDGH E F G ++G +VWP RG  GFGYDP+FQP+GY+ T  EM
Sbjct: 122 P--RTAQFRCTLVVAWPDGHDEVFEGVMAGQLVWPIRGGHGFGYDPMFQPDGYEITCAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHR +A   FV  C 
Sbjct: 180 DPAEKN---------------KISHRGKALAQFVQGCF 202


>gi|294679007|ref|YP_003579622.1| nucleoside-triphosphatase [Rhodobacter capsulatus SB 1003]
 gi|294477827|gb|ADE87215.1| nucleoside-triphosphatase [Rhodobacter capsulatus SB 1003]
          Length = 203

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/215 (46%), Positives = 125/215 (58%), Gaps = 18/215 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR   E  +++A+HN  K+ EM  L+ P G+    A E+NL  P ET  +F  NA IK+ 
Sbjct: 1   MRAFTEKRLLVATHNKGKLAEMRDLLAPYGVEVVGAAEMNLPEPAETETTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSG+ +D LDG PG+++A WAE+  G RDF  AM +      +K A 
Sbjct: 61  AAAKATGLPALSDDSGIEVDALDGAPGVYTADWAETPNG-RDFVQAMTRTWAECEAKNAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F S L LAWPDGH E F G   G +VWP RG  G GYDP+FQP G+D TF E
Sbjct: 120 FP--RRARFRSTLVLAWPDGHDEVFEGSAEGQLVWPMRGAQGHGYDPMFQPEGFDVTFAE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           M   +KN                +SHRA AF+ FV
Sbjct: 178 MDPAQKN---------------EISHRADAFRKFV 197


>gi|84501188|ref|ZP_00999393.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanicola batsensis HTCC2597]
 gi|84390479|gb|EAQ02967.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanicola batsensis HTCC2597]
          Length = 202

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/219 (45%), Positives = 129/219 (58%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+     +VIASHN  K+ E+  L+ P GI  +SA +  L  P ET  +F  NA IK+ 
Sbjct: 1   MRRFDGKELVIASHNKGKLREIAELLTPFGINVSSAADHGLDEPAETEETFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+ +D L G+PG+H+A WAE+  G RDF MAM ++   L  + A 
Sbjct: 61  YAAQATGLPALSDDSGITVDALGGQPGVHTADWAETPDG-RDFPMAMTRVWTLLEERDA- 118

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F + L LAWPDGH E F GKV G +VWP RG+ GFG+DP+F P+G   TFGE
Sbjct: 119 -PLPRTASFNATLVLAWPDGHDEVFEGKVDGQVVWPMRGEEGFGFDPVFLPDGETETFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M    K                 +SHRA AF+  V  C 
Sbjct: 178 MDPARKKD---------------MSHRADAFRKLVKGCF 201


>gi|154254012|ref|YP_001414836.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Parvibaculum lavamentivorans DS-1]
 gi|154157962|gb|ABS65179.1| Ham1 family protein [Parvibaculum lavamentivorans DS-1]
          Length = 201

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 134/219 (61%), Gaps = 21/219 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+     +V+ASHN  K+ E+  L+  L +   SA +L L  P+ETG +F ENA +K+L 
Sbjct: 3   RRFEGGKLVVASHNPGKVREIADLLASLNVEILSAADLGLAEPDETGETFRENAELKALA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK A +PALSDDSGL ++ L G PGI SARWA      +DF  AM+K+    R      
Sbjct: 63  AAKTAQLPALSDDSGLCVEALGGAPGIFSARWAGPT---KDFAFAMEKLR---RGMLETG 116

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P   SA+FI  L+LAWPDGHVE F G+V G +VWPPRG+ GFGYDP+F P+GY+ TFGEM
Sbjct: 117 PVDTSAYFICGLALAWPDGHVEYFEGRVDGDLVWPPRGEKGFGYDPVFVPHGYETTFGEM 176

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             + K+                +SHRA AF+  VD C R
Sbjct: 177 EPQAKHD---------------ISHRAHAFRQLVDACFR 200


>gi|159046002|ref|YP_001534796.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Dinoroseobacter shibae DFL 12]
 gi|157913762|gb|ABV95195.1| nucleoside-triphosphatase [Dinoroseobacter shibae DFL 12]
          Length = 204

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 102/222 (45%), Positives = 130/222 (58%), Gaps = 18/222 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M +  +  +++ASHN  KI E+  L+ P G+  TSA    L  PEET  +F  NA IK+ 
Sbjct: 1   MSRFKDKTLLVASHNKGKIEEIAHLLEPYGVRVTSAAAHGLSEPEETETTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PAL+DDSGL +  LDG PG+++A WAE+ TG RDF+MAM K+ +AL +K A 
Sbjct: 61  YAAKETGLPALADDSGLEVLALDGAPGVYTADWAETPTG-RDFEMAMVKVHDALIAKGAE 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P    A F   L LAWPDG    F G + G +VWP RG  G GYDP+FQP+GY +TFGE
Sbjct: 120 RP--WRARFCCTLVLAWPDGTDMVFPGTMKGQLVWPMRGSQGHGYDPMFQPDGYAQTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           M   EKN                +SHRA AF+     C   D
Sbjct: 178 MDRWEKNK---------------VSHRADAFRKLTVACFSED 204


>gi|149184524|ref|ZP_01862842.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Erythrobacter sp. SD-21]
 gi|148831844|gb|EDL50277.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Erythrobacter sp. SD-21]
          Length = 208

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 132/218 (60%), Gaps = 21/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R++   ++VIA+HN  K+ E+ +L+ P G+   SA  L L  P ETG +F +NA++K+  
Sbjct: 3   RRIGSGSLVIATHNAGKLKEISALLDPYGVKCISAGSLGLPEPPETGTTFVQNALLKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE----RDFDMAMQKIENALRSK 117
           AA+ +G+PAL+DDSGL +D LDG+PG+++A WAE    E    RD+ MAM K+E  L+ K
Sbjct: 63  AAEASGLPALADDSGLSVDALDGRPGVYTADWAERQHFEGDPGRDWYMAMGKVEGMLQQK 122

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
            A     RS  F  VL+LAWPDG    + G   G + WPPRG+ GFGYDP+F P G D+T
Sbjct: 123 GAD--VDRSCAFHCVLALAWPDGEQVVYEGTAPGTLTWPPRGETGFGYDPVFVPKGRDQT 180

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           F E+  EEK+                +SHRA AF   V
Sbjct: 181 FAEIAPEEKHA---------------ISHRADAFAKMV 203


>gi|161170277|gb|ABX59247.1| xanthosine triphosphate pyrophosphatase [uncultured marine
           bacterium EB000_55B11]
 gi|297183805|gb|ADI19928.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 201

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/215 (47%), Positives = 131/215 (60%), Gaps = 20/215 (9%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL E  IV+AS N  K+ E+  L+ P GI   SA +L L  PEET N++  NA IK+ 
Sbjct: 1   MRKLNEKQIVLASXNKGKLKEIGHLLKPFGISVISASDLGLDEPEETENTYAGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK +G PALSDDSG  +++LDG PG++SA WAE++ G R+F MAM KI + ++   A 
Sbjct: 61  FAAKASGKPALSDDSGFSVEILDGAPGVYSADWAETSNG-RNFSMAMSKIWDXIQH--AE 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P    A F   L LAWPDGH E F G ++G I WPPRG  GFGYDP+F   G  +TFGE
Sbjct: 118 KPC--KAKFCCTLCLAWPDGHDELFEGSINGEIAWPPRGNNGFGYDPMFIAEGMHQTFGE 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           M   +K+               L+SHRA AFK  +
Sbjct: 176 MLPTDKH---------------LISHRADAFKKLI 195


>gi|126734414|ref|ZP_01750161.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter sp. CCS2]
 gi|126717280|gb|EBA14144.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter sp. CCS2]
          Length = 202

 Score =  184 bits (468), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 128/219 (58%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+     +VIA+HN  K+ E+  L+ P G+  TS  +  L  PEET  +F  NA IK+ 
Sbjct: 1   MRRFDGKELVIATHNQGKLEEIADLLKPYGVSLTSNADHGLPEPEETETTFVGNAQIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+ ID L G PG+++A WAE+  G RDF MAM++    L +  A 
Sbjct: 61  AAAQAIGLPALSDDSGIEIDGLGGAPGVYTADWAETPNG-RDFKMAMKRSWAELEAVSAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F   L LAWPDGH E F G + G IVWP RG  G GYDPIFQP+GYD TFGE
Sbjct: 120 FP--RTARFCCTLVLAWPDGHDEVFPGVMPGQIVWPMRGDQGHGYDPIFQPDGYDITFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                +SHRA AF   +  C 
Sbjct: 178 MDRWEKN---------------KISHRADAFAKLIAGCF 201


>gi|110677821|ref|YP_680828.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter denitrificans OCh 114]
 gi|109453937|gb|ABG30142.1| Ham1 protein-like protein [Roseobacter denitrificans OCh 114]
          Length = 203

 Score =  184 bits (467), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 127/218 (58%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK     I+IA+HN  K+ EM  L  P G+    A E+ L  PEET ++F  NA IK+  
Sbjct: 3   RKFDGKRILIATHNAGKLEEMQQLFAPYGVDVVGAAEMGLAEPEETESTFIGNARIKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A +  G+PAL+DDSG+ ++ L+  PG+++A WAE+  G RDF MAM K    L    A  
Sbjct: 63  AVEATGLPALADDSGIEVEALNNAPGVYTADWAETPNG-RDFVMAMTKTHTKLEEINAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F + L LAWPDGH E F G+V+G +VWP RG+ G GYDP+FQP+G+D TF EM
Sbjct: 122 P--RRARFRATLVLAWPDGHDEVFDGRVNGTLVWPIRGKTGHGYDPMFQPDGHDMTFAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRA AF+  +  C 
Sbjct: 180 DPAEKN---------------RISHRADAFQKLIAGCF 202


>gi|84514912|ref|ZP_01002275.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Loktanella vestfoldensis SKA53]
 gi|84511071|gb|EAQ07525.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Loktanella vestfoldensis SKA53]
          Length = 202

 Score =  184 bits (467), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 100/219 (45%), Positives = 128/219 (58%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+   + +++A+HN  K+ E+  L+ P G+M +S  +  L  PEET  +F  NA IK+ 
Sbjct: 1   MRRFAGDRLLVATHNQGKLDEIADLLSPFGVMLSSNADHGLPEPEETETTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+ ID L G PG+++A WAE+  G RDF MAM +    L +  A 
Sbjct: 61  AAAQATGLPALSDDSGITIDGLGGAPGVYTADWAETPQG-RDFGMAMNRAWAELEA--AR 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F   L LAWPDGH E F G ++G IVWP RG  G GYDPIFQP GY +TFGE
Sbjct: 118 APFPRLAQFRCTLVLAWPDGHDEVFEGVMAGQIVWPMRGDQGHGYDPIFQPEGYAQTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                +SHRA AF   +  C 
Sbjct: 178 MDRWEKN---------------KISHRADAFAKLIAGCF 201


>gi|119382768|ref|YP_913824.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Paracoccus denitrificans PD1222]
 gi|119372535|gb|ABL68128.1| dITPase [Paracoccus denitrificans PD1222]
          Length = 201

 Score =  184 bits (467), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 130/212 (61%), Gaps = 18/212 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+L E  +++A+HN  K+ E+ +++ P GI  TSA E+ L  P ET +SF  NA IK+ 
Sbjct: 1   MRRLTERKLLVATHNKGKLDEIRAMMAPHGIEVTSAGEMGLPEPAETESSFIGNARIKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A +  G+P L+DDSG+ +D LDG PG+++A WAE+  G RDF  AM +    L  + A 
Sbjct: 61  AAMQATGLPVLADDSGITVDGLDGAPGVYTADWAETPNG-RDFMQAMTRTWTELDERGAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P  R+A F + L L WPDGH E F G   G +VWPPRG  G GYDPIF P+G+D T+ E
Sbjct: 120 EP--RTAQFRATLILLWPDGHEEIFEGVAPGRLVWPPRGAHGHGYDPIFVPDGHDVTYAE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           M  E+KN                +SHRARAF+
Sbjct: 178 MPSEQKNA---------------ISHRARAFR 194


>gi|83313598|ref|YP_423862.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Magnetospirillum magneticum AMB-1]
 gi|82948439|dbj|BAE53303.1| HAM1 protein homolog [Magnetospirillum magneticum AMB-1]
          Length = 201

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 125/218 (57%), Gaps = 23/218 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+     +VIASHN  K+ E+  L+ P G    SA  L L  PEETG++F  NA +K+  
Sbjct: 4   RRFQGGKLVIASHNAGKVREIGELLAPFGTEVVSAGALGLDEPEETGDTFVANAELKARA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G+P+L+DDSGL +D L G PGI+SARWA +    +DF  AM K+  AL  +   D
Sbjct: 64  AALASGLPSLADDSGLAVDALAGAPGIYSARWAGA---AKDFAFAMAKVHTALGEE--KD 118

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F+  L+LAWPDGH E F G V G IVWPP+G+ GFGYDPIF P     TFGEM
Sbjct: 119 ---RTARFVCALALAWPDGHCETFEGVVEGDIVWPPKGENGFGYDPIFLPKDGVLTFGEM 175

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
               K+                +SHRA AF   V  C 
Sbjct: 176 DAAAKHA---------------ISHRADAFAKLVAACF 198


>gi|83950768|ref|ZP_00959501.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius nubinhibens ISM]
 gi|83838667|gb|EAP77963.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius nubinhibens ISM]
          Length = 202

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 98/219 (44%), Positives = 129/219 (58%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRK  ++ +++A+HN  K+ E+  L+ P G+    A E+ L  PEET +SF  NA IK+ 
Sbjct: 1   MRKFSDDRLLVATHNAGKLEEIAHLLEPYGVSVVGAAEMQLGEPEETEDSFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PAL+DDSGL I+ L G PG+++A WAE+  G RDF MAM K+ + L ++  H
Sbjct: 61  AAAKATGLPALADDSGLSIEALGGAPGVYTADWAETPEG-RDFAMAMAKVHDLLENE-QH 118

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
              +R A F   L +AWPDGH E F G   G I+WPPRG  G GYDPIF P G++ +F E
Sbjct: 119 AKPWR-AKFCCTLVIAWPDGHDEVFEGIAPGEIIWPPRGDQGHGYDPIFLPEGHEISFAE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                +SHRA AF   V  C 
Sbjct: 178 MDRWEKN---------------RISHRADAFAKLVQGCF 201


>gi|163732969|ref|ZP_02140413.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter litoralis Och 149]
 gi|161393504|gb|EDQ17829.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter litoralis Och 149]
          Length = 203

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 125/218 (57%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK     I+IA+HN  K+ EM  L  P G+    A E+ L  PEET  +F  NA IK+  
Sbjct: 3   RKFDGTRILIATHNAGKLEEMQQLFAPYGVDVVGAAEMGLAEPEETETTFIGNARIKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A    G+PAL+DDSG+ ++ L+  PG+++A WAE   G RDF MAM K    L    A  
Sbjct: 63  AVAATGLPALADDSGIEVEALNDAPGVYTADWAEIPNG-RDFIMAMTKTHTKLEEINAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F + L LAWPDGH E F G+V+G +VWP RG+ G GYDP+FQP+G+D TF EM
Sbjct: 122 P--RRARFRATLVLAWPDGHDEVFDGRVNGTLVWPMRGKTGHGYDPMFQPDGHDITFAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             E+KN                +SHRA AF+  +  C 
Sbjct: 180 DPEQKN---------------RISHRADAFQKLIAGCF 202


>gi|254440372|ref|ZP_05053866.1| Ham1 family [Octadecabacter antarcticus 307]
 gi|198255818|gb|EDY80132.1| Ham1 family [Octadecabacter antarcticus 307]
          Length = 202

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 131/219 (59%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRK    +++IA+HN  K+ E+ +L+ P G++ +S  +  L  PEET  +F  NA IK+ 
Sbjct: 1   MRKFGGTDLLIATHNHGKLEEIANLLSPYGVVVSSNADHGLPEPEETETTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A K  G+PALSDDSG+ +D LDG PG+++A WAE+  G RDF  AM +  + L ++ A 
Sbjct: 61  AAVKATGLPALSDDSGITVDGLDGAPGVYTADWAETPDG-RDFVKAMTRTWDELDARGAT 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P  R A F   L LAWPDGH E F G + G +VWP RG  G GYDPIFQP+G+  TFGE
Sbjct: 120 EP--RVAQFRCCLVLAWPDGHDEVFEGMIPGRVVWPMRGDQGHGYDPIFQPDGFGVTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                ++HRA AF   ++ C 
Sbjct: 178 MDRFEKN---------------RINHRADAFTKLIEGCF 201


>gi|254453444|ref|ZP_05066881.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Octadecabacter antarcticus 238]
 gi|198267850|gb|EDY92120.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Octadecabacter antarcticus 238]
          Length = 202

 Score =  181 bits (460), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 131/219 (59%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+    +++IA+HN  K+ E+  L+ P G+  +S  +  L  PEET  +F  NA IK+ 
Sbjct: 1   MRRFDGTDLLIATHNHGKLVEIADLLSPYGVAVSSNADHGLPEPEETETTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A K  G+PALSDDSG+ +D LDG PG+++A WAE++ G RDF  AM +  + L S+ A 
Sbjct: 61  AATKATGLPALSDDSGITVDGLDGAPGVYTADWAETSNG-RDFVKAMTRTWDELESRRAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P  R A F   L LAWPDGH E F G + G +VWP RG  G GYDPIFQP+ +++TFGE
Sbjct: 120 EP--RLAQFRCCLVLAWPDGHDEVFEGVMPGRLVWPMRGDQGHGYDPIFQPDSFEQTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                +SHRA AF   ++ C 
Sbjct: 178 MDRFEKN---------------RISHRADAFAKLIEGCF 201


>gi|162147172|ref|YP_001601633.1| deoxyribonucleotide triphosphate pyrophosphatase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209544227|ref|YP_002276456.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785749|emb|CAP55320.1| putative HAM1 protein homolog [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209531904|gb|ACI51841.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 205

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 132/222 (59%), Gaps = 24/222 (10%)

Query: 2   RKLIENN-IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           R+L   + +V+ASHN  K+ E  +L+   GI   SA +L L  PEET  +F  NA +K+ 
Sbjct: 7   RRLARGDRLVLASHNAGKLVEFSALLDGYGITVLSAGQLGLPEPEETAETFVGNAALKAH 66

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+ +G+PAL+DDSGL +  L G PGI+SARWA     E+DF  AM +I   +      
Sbjct: 67  AAAQASGLPALADDSGLCVAALGGAPGIYSARWAGP---EKDFPGAMARIHEGI----GD 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           DP  RSA F+SVL LAWPDG + +F G++ G I WPPRG  G GYDP+F P G DRTF E
Sbjct: 120 DPD-RSAWFVSVLCLAWPDGTIRSFEGRIDGRITWPPRGTHGHGYDPVFTPEGRDRTFAE 178

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           M E EKN                +SHRARAF  F D CL  D
Sbjct: 179 MPEAEKN---------------TISHRARAFALFRDACLPGD 205


>gi|87200078|ref|YP_497335.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87135759|gb|ABD26501.1| Ham1-like protein [Novosphingobium aromaticivorans DSM 12444]
          Length = 209

 Score =  181 bits (458), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 124/207 (59%), Gaps = 6/207 (2%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           +L    +VIA+HN  K+ E+ +L+ P GI   SA  L L  P ETG +F ENA+IK+  A
Sbjct: 5   RLGSGKLVIATHNSGKLKEIQALLAPYGIECLSAGALGLPEPAETGTTFVENALIKARAA 64

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE----RDFDMAMQKIENALRSKF 118
           A+ + +PAL+DDSGL +D L G PG+++A WAE++  E    RD+ MAM K+E  L    
Sbjct: 65  AEASQIPALADDSGLCVDALGGAPGVYTADWAEADVFEGGPRRDWYMAMGKVEGKLAELG 124

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
              P  R  HF  VL++AWPDG    + G+  G + WPPRG +GFGYDP+F P G  RTF
Sbjct: 125 PETP--RDCHFACVLAIAWPDGESVVYEGRAPGTLTWPPRGTMGFGYDPVFVPVGDTRTF 182

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLS 205
            E+   EK+     A  F+ L  D  S
Sbjct: 183 AELAPAEKHAISHRADAFAKLVADQFS 209


>gi|323137090|ref|ZP_08072170.1| Ham1 family protein [Methylocystis sp. ATCC 49242]
 gi|322397851|gb|EFY00373.1| Ham1 family protein [Methylocystis sp. ATCC 49242]
          Length = 209

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/217 (43%), Positives = 133/217 (61%), Gaps = 12/217 (5%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           + I   +V+A+HN  K+ E+  L+ P G+   SA ++ L  PEET  +F  NA +K+  A
Sbjct: 4   RKISGKLVVATHNPGKLWELQQLLAPHGVDAVSAGDMALPEPEETEPTFRGNAALKARAA 63

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A  +G+PA +DDSGL ++ LDG PGI+SARWA  N   RDF  A + +   L  + A  P
Sbjct: 64  AMASGLPAFADDSGLCVEALDGAPGIYSARWAGPN---RDFKAACELVRQELEKRGAK-P 119

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
            +R A+F   L++ WPDGH+E F G+V G++V+PP+G  GFGYDPIF+P+  D+TFGEM 
Sbjct: 120 PYR-ANFTCALAIVWPDGHIEEFEGRVDGVLVFPPKGDKGFGYDPIFKPDELDKTFGEMM 178

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             EK+             +  LSHRARAF+     CL
Sbjct: 179 SAEKHA-------LPGDGSRALSHRARAFQALAKACL 208


>gi|23015828|ref|ZP_00055594.1| COG0127: Xanthosine triphosphate pyrophosphatase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 202

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 127/220 (57%), Gaps = 23/220 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+     +VIASHN  K+ E+  L+ P G    SA  L L  PEETG++F  NA +K+  
Sbjct: 4   RRFQGGRLVIASHNAGKVREIGELLAPFGTEVVSAGALGLPEPEETGDTFVANAELKARA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G+P+L+DDSGL ++ L G PGI+SARWA      +DF  AM K+++AL  +   D
Sbjct: 64  AAAASGLPSLADDSGLAVNALAGAPGIYSARWAGQ---AKDFAFAMAKVQSALGEE--KD 118

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              RSA F+  L+LAWPDGH E F G V G IVWPP+G+ GFGYDPIF P     TFGEM
Sbjct: 119 ---RSARFVCALALAWPDGHCETFEGVVEGDIVWPPKGENGFGYDPIFLPKDGILTFGEM 175

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
               K+                +SHRA AF   V  C  +
Sbjct: 176 DAAAKHA---------------ISHRADAFTKLVAACFGV 200


>gi|114571549|ref|YP_758229.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Maricaulis maris MCS10]
 gi|114342011|gb|ABI67291.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Maricaulis maris MCS10]
          Length = 197

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/213 (44%), Positives = 125/213 (58%), Gaps = 23/213 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           ++    V+ASHN  KI EM+ ++ P G+   SA +L+L  PEET  +F  NA +K+  A 
Sbjct: 1   MVRETWVLASHNAGKIKEMEQILAPFGVTLKSAADLDLPEPEETETTFRGNAALKARAAC 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFAHDP 122
           +  G+P ++DDSGL +D L G PGI+SARWA    GE RDF  AMQ+++  L      D 
Sbjct: 61  EATGLPCVADDSGLAVDALGGDPGIYSARWA----GEPRDFQRAMQRVDTELSRAGVPD- 115

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F+  ++LA P   V  F G+V G IVWPPRG  GFGYDPIFQP G+D TFGEM+
Sbjct: 116 --RTARFVCTIALARPGSEVRFFEGEVVGEIVWPPRGAGGFGYDPIFQPLGHDITFGEMS 173

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            + K                 LSHRARA    +
Sbjct: 174 ADGKR---------------QLSHRARALDAMI 191


>gi|312114383|ref|YP_004011979.1| Ham1 family protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311219512|gb|ADP70880.1| Ham1 family protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 207

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 96/209 (45%), Positives = 124/209 (59%), Gaps = 20/209 (9%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +VIA+HN  K+ E + L  P+G+   S+  L L  PEETG +F ENA +K++  A   G 
Sbjct: 12  LVIATHNKGKVREFEDLCAPMGVSVVSSAVLGLPEPEETGTTFAENARLKAVATAVATGK 71

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFAHDPAFRSA 127
            +L DDSGL +D LDG PGI+SARWA    GE RDF  AM+++E  L ++ A  P  R A
Sbjct: 72  ISLGDDSGLAVDALDGAPGIYSARWA----GEPRDFGAAMRRVEAELVARGATAPDARRA 127

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+ VL LA P G V+ F G V+G +VWPPRG  GFG+DP+F  +G D TFGEM    K+
Sbjct: 128 QFVCVLCLANPAGEVQFFEGTVAGHLVWPPRGTNGFGFDPMFVADGRDITFGEMDPAAKH 187

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVD 216
                           +SHRA AF  F D
Sbjct: 188 A---------------ISHRANAFAAFKD 201


>gi|294085188|ref|YP_003551948.1| HAM1-like protein [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664763|gb|ADE39864.1| HAM1-like protein [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 204

 Score =  177 bits (450), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 95/218 (43%), Positives = 128/218 (58%), Gaps = 21/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+  ++ +VIA+HN  K+ E+ + +    I   SA EL L  P+ET  SF  NA++K+  
Sbjct: 4   RRFTDSKLVIATHNPGKLPEIAAFLDGFDITLVSAGELGLDEPDETETSFTGNAILKARA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G+PAL+DDSGL +  L+G PGI+SARWA     ++DF MAM K+E+AL +    +
Sbjct: 64  AALASGLPALADDSGLAVVALNGDPGIYSARWAGQ---DKDFGMAMHKVEDALTATGTTN 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F+  LS+ WPDGH E   G V G +VWPPRG  GFGYDPIF  +GYD TFGEM
Sbjct: 121 ---RQAAFMCALSIVWPDGHDETVEGTVKGNLVWPPRGANGFGYDPIFVADGYDMTFGEM 177

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             + K+                + HRA AF   +  C 
Sbjct: 178 EPDIKHA---------------IGHRADAFAKLLQRCF 200


>gi|288956859|ref|YP_003447200.1| nucleoside-triphosphatase [Azospirillum sp. B510]
 gi|288909167|dbj|BAI70656.1| nucleoside-triphosphatase [Azospirillum sp. B510]
          Length = 204

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 100/219 (45%), Positives = 131/219 (59%), Gaps = 19/219 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+   + +VIASHN  K+ E+  L+ P     TSA EL L  PEETG+SF  NA +K+  
Sbjct: 5   RRFTGDTLVIASHNQGKVREIAELLGPYVATFTSAGELGLPEPEETGSSFIANAELKARA 64

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA    + AL+DDSGLV+  L+G PGI+SARWA      +DF +AM+K+E+ L  +    
Sbjct: 65  AAAAGHV-ALADDSGLVVPALNGDPGIYSARWAGPT---KDFALAMRKVEDGLAEQVKAG 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A+F+  LSLAWPDGHVE   G+  G +VWPPRG  GFGYDP+F P+G+  TFGEM
Sbjct: 121 RTDRGAYFVCALSLAWPDGHVETVEGRCHGTLVWPPRGPQGFGYDPMFLPDGHGLTFGEM 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
               K+                +SHRA AF+  V+ C R
Sbjct: 181 EPARKH---------------EMSHRADAFRQLVERCFR 204


>gi|77464800|ref|YP_354304.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacter sphaeroides 2.4.1]
 gi|77389218|gb|ABA80403.1| putative Ham1p_like protein, Ham1 family [Rhodobacter sphaeroides
           2.4.1]
          Length = 203

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 129/219 (58%), Gaps = 18/219 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  L  PLGI   SA EL L  PEET  +F  NA IK+  
Sbjct: 3   RKFSGDRLLVATHNKGKLEEIQHLFEPLGIEVVSAGELGLPEPEETETTFAGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK A M AL+DDSG+ ID LDG PG+++A WA + TG RDF  AM   +   R +  + 
Sbjct: 63  AAKAADMVALADDSGITIDALDGAPGVYTADWAMTPTG-RDFVKAM--TDTWARLEAVNA 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G + G +VWP RGQ G GYDPIFQP+G + TFGEM
Sbjct: 120 PFPRRAQFRCTLVLAWPDGHDEVFEGVMPGQVVWPMRGQQGHGYDPIFQPDGSELTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
              EKN                +SHRARAF+  +  C +
Sbjct: 180 DRWEKN---------------EISHRARAFRNLMQGCFK 203


>gi|146278692|ref|YP_001168851.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145556933|gb|ABP71546.1| Ham1 family protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 203

 Score =  175 bits (443), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 127/218 (58%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R    + +++A+HN  K+ E+  L  PLGI   SA +L L  PEET  +F  NA IK+  
Sbjct: 3   RTFSGDRLLVATHNKGKLEEIQHLFEPLGIAVVSAGDLGLPEPEETETTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK AGM AL+DDSG+ ID LDG PG+++A WA + TG RDF  AM      L +  A+ 
Sbjct: 63  AAKAAGMVALADDSGITIDALDGAPGVYTADWAMTPTG-RDFVKAMTDTWAKLET--ANA 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G + G +VWP RG  G GYDPIFQP+G D TFGEM
Sbjct: 120 PFPRKAQFRCTLVLAWPDGHDEVFEGVMPGQVVWPMRGDQGHGYDPIFQPDGSDLTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRARAF+  +  C 
Sbjct: 180 DRWEKN---------------QISHRARAFRSLMAGCF 202


>gi|296284092|ref|ZP_06862090.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Citromicrobium bathyomarinum JL354]
          Length = 208

 Score =  175 bits (443), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 130/218 (59%), Gaps = 21/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R++    +VIA+HN  K+ E+ +L+ P G+   SA  L L  P+ETG +F ENA++K+  
Sbjct: 3   RRIGSGKLVIATHNAGKLKEISALLAPYGVECISAGALGLPEPKETGTTFVENALLKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE----RDFDMAMQKIENALRSK 117
           AA+++G+ +L+DDSGL +  LDG+PG+++A WAE    E    RD+ MAM K+E  L  +
Sbjct: 63  AAESSGIVSLADDSGLSVAALDGRPGVYTADWAERQWFEGEPGRDWYMAMGKVEGLLAQQ 122

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                  RSA F   L+LAWPDG    + G   G + WPPRG+LGFGYDP+F PNG ++T
Sbjct: 123 GPD--VDRSAAFHCTLALAWPDGEYAVYEGIAPGSLTWPPRGKLGFGYDPVFVPNGREQT 180

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           F E+   EK+                +SHRA AF   V
Sbjct: 181 FAEIEPAEKH---------------TISHRADAFAKLV 203


>gi|126463643|ref|YP_001044757.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126105307|gb|ABN77985.1| Ham1 family protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 203

 Score =  174 bits (442), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 129/219 (58%), Gaps = 18/219 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  L  PLGI   SA EL L  PEET  +F  NA IK+  
Sbjct: 3   RKFSGDRLLVATHNKGKLEEIQHLFEPLGIEVVSAGELGLPEPEETETTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK A M AL+DDSG+ ID LDG PG+++A WA + TG RDF  AM   +   R +  + 
Sbjct: 63  AAKAADMVALADDSGITIDALDGAPGVYTADWAMTPTG-RDFVKAM--TDTWARLEAVNA 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G + G +VWP RGQ G GYDPIFQP+G + TFGEM
Sbjct: 120 PFPRRAQFRCTLVLAWPDGHDEVFEGVMPGQVVWPMRGQQGHGYDPIFQPDGSELTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
              EKN                +SHRARAF+  +  C +
Sbjct: 180 DRWEKNE---------------ISHRARAFRNLMQGCFK 203


>gi|332559696|ref|ZP_08414018.1| dITP/XTP pyrophosphatase [Rhodobacter sphaeroides WS8N]
 gi|332277408|gb|EGJ22723.1| dITP/XTP pyrophosphatase [Rhodobacter sphaeroides WS8N]
          Length = 203

 Score =  174 bits (441), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 129/219 (58%), Gaps = 18/219 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  L  PLGI   SA EL L  PEET  +F  NA IK+  
Sbjct: 3   RKFSGDRLLVATHNKGKLEEIQHLFEPLGIEVVSAGELGLPEPEETETTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK A M AL+DDSG+ ID LDG PG+++A WA + TG RDF  AM   +   R +  + 
Sbjct: 63  AAKAADMVALADDSGITIDALDGAPGVYTADWAMTPTG-RDFVKAM--TDTWARLEAVNA 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G + G +VWP RGQ G GYDPIFQP+G + TFGEM
Sbjct: 120 PFPRRAQFRCTLVLAWPDGHDEVFEGVMPGQVVWPMRGQQGHGYDPIFQPDGSELTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
              EKN                +SHRARAF+  +  C +
Sbjct: 180 GRWEKN---------------EISHRARAFRDLMQGCFK 203


>gi|221640719|ref|YP_002526981.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacter sphaeroides KD131]
 gi|221161500|gb|ACM02480.1| Ham1 family protein [Rhodobacter sphaeroides KD131]
          Length = 203

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 128/219 (58%), Gaps = 18/219 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  L  PLGI   SA EL L  PEET  +F  NA IK+  
Sbjct: 3   RKFSGDRLLVATHNKGKLEEIQHLFEPLGIEVVSAGELGLPEPEETETTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK A M AL+DDSG+ ID LDG PG+++A WA + TG RDF  AM   +   R +  + 
Sbjct: 63  AAKAADMVALADDSGITIDALDGAPGVYTADWAMTPTG-RDFVKAM--TDTWARLEAVNA 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G + G +VWP RGQ G GYDPIFQP G + TFGEM
Sbjct: 120 PFPRRAQFRCTLVLAWPDGHDEVFEGVMPGQVVWPMRGQQGHGYDPIFQPAGSELTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
              EKN                +SHRARAF+  +  C +
Sbjct: 180 DRWEKNE---------------ISHRARAFRNLMQGCFK 203


>gi|310817157|ref|YP_003965121.1| Ham1 family protein [Ketogulonicigenium vulgare Y25]
 gi|308755892|gb|ADO43821.1| Ham1 family protein [Ketogulonicigenium vulgare Y25]
          Length = 202

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 127/218 (58%), Gaps = 19/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L    +++A+HN  K+ E+ +L+   G+   S  + NL  P E+G +F ENA IK+  
Sbjct: 3   RRLERAKLLVATHNRGKLDEIRALLDVFGMDIVSNADFNLPEPVESGTTFVENARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            AK  G+P L+DDSGL I+ LDG PG+++A W+E   G RDF MAM ++ + LR+  A  
Sbjct: 63  GAKATGLPTLADDSGLSIEALDGAPGVYTADWSEGPNG-RDFVMAMARVHDELRATGAAT 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P    A F   L LAWPDGH E F G+V G IV  PRG+ G GYDPIF P+G   TFGEM
Sbjct: 122 P--WRAKFCCTLVLAWPDGHDEVFEGEVHGQIV-APRGEHGHGYDPIFLPDGMTETFGEM 178

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            + EKN                +SHRA AF+  V  C 
Sbjct: 179 DQIEKN---------------FISHRANAFEKLVKGCF 201


>gi|89067430|ref|ZP_01154943.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanicola granulosus HTCC2516]
 gi|89046999|gb|EAR53053.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanicola granulosus HTCC2516]
          Length = 202

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 96/219 (43%), Positives = 127/219 (57%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+     +++A+HN  K+ E+  L+ P G+  TS  +  L  PEET  +F  NA IK+ 
Sbjct: 1   MRRFTGTELIVATHNRGKLEEIADLLSPYGVSLTSNADHELPEPEETEETFVGNARIKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A    G+PAL+DDSG+ ++ LDG PG+H+A WAE+  G RDF+MAM ++   L +  A 
Sbjct: 61  AAVAATGLPALADDSGISVEALDGAPGVHTADWAETPDG-RDFEMAMTRVWRELEALDAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P  R A F   L LAWPDGH E F G + G IVWP RG  G G+DPIFQP G+D T GE
Sbjct: 120 EP--RRAAFRCTLVLAWPDGHDEMFEGVLPGRIVWPMRGTQGHGFDPIFQPEGHDVTLGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                +SHR RAF+  +  C 
Sbjct: 178 MDRWEKN---------------RISHRGRAFEQLIAGCF 201


>gi|114800076|ref|YP_761983.1| non-canonical purine NTP pyrophosphatase [Hyphomonas neptunium ATCC
           15444]
 gi|114740250|gb|ABI78375.1| non-canonical purine NTP pyrophosphatase [Hyphomonas neptunium ATCC
           15444]
          Length = 218

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 97/213 (45%), Positives = 127/213 (59%), Gaps = 23/213 (10%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M +L+   +V A+HN  K+ E+  L  P G    SALEL+L  PEET +SF  NA++K+ 
Sbjct: 20  MPRLVPGKLVAATHNRGKVSELKDLFAPHGFEVVSALELDLDEPEETEDSFSGNALLKAR 79

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFA 119
            AA   G+PALSDDSGL +  L G+PGI+SARWA    GE RDF  AM+K+E  L++  +
Sbjct: 80  AAALATGLPALSDDSGLAVTALGGQPGIYSARWA----GEPRDFYKAMEKVEAELKASGS 135

Query: 120 HDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
            D   RSA F+  L++ WPDG    + G+V G +VWPPRG  GFGYDP+F   G   TFG
Sbjct: 136 QD---RSAKFVCALAVVWPDGTQAVYEGEVHGTLVWPPRGDKGFGYDPVFVAEGETMTFG 192

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           EM    K+                +SHRARA +
Sbjct: 193 EMDPARKHA---------------MSHRARAVE 210


>gi|85708631|ref|ZP_01039697.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Erythrobacter sp. NAP1]
 gi|85690165|gb|EAQ30168.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Erythrobacter sp. NAP1]
          Length = 211

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/220 (42%), Positives = 133/220 (60%), Gaps = 23/220 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL   ++VIA+HN  K+ E+ +L+ P G+   SA  L L  P ETG +F +NA+IK+ +
Sbjct: 3   RKLGGGSLVIATHNPGKLKEISALLDPYGMKCISAGSLGLPEPPETGTTFAQNALIKARS 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE----RDFDMAMQKIENALRSK 117
           AA+ +G+ AL+DDSGL +D L G+PG+++A WAE    E    RD+ MAM K+E  L+ +
Sbjct: 63  AAEASGLAALADDSGLSVDALGGRPGVYTADWAERQWFEGDPGRDWYMAMGKVEGMLQ-Q 121

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGY--D 175
              D   R+A F  VL++AWPDG    + GK  G + WPPRG++GFGYDP+F P+    D
Sbjct: 122 LGPD-TDRTAAFHCVLAVAWPDGEHAVYEGKCPGSLTWPPRGEMGFGYDPVFVPSARDGD 180

Query: 176 RTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           +TF E+   EK+                +SHRA AF   V
Sbjct: 181 QTFAEIDPSEKHA---------------ISHRADAFAKLV 205


>gi|85374028|ref|YP_458090.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Erythrobacter litoralis HTCC2594]
 gi|84787111|gb|ABC63293.1| ham1 protein [Erythrobacter litoralis HTCC2594]
          Length = 209

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 98/218 (44%), Positives = 133/218 (61%), Gaps = 21/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L   ++VIA+HN  K+ E+ +L+ P G+   SA  L L  P ETG +F ENA+IK+  
Sbjct: 3   RRLGSGSLVIATHNAGKLKEISALLEPYGVKCISAGSLGLPEPAETGTTFVENALIKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE----RDFDMAMQKIENALRSK 117
           AA+ +GM AL+DDSGL +D L+G+PG+++A WAE    E    RD+ MAM K+E  L+ +
Sbjct: 63  AAEASGMAALADDSGLSVDALEGRPGVYTADWAERQWFEGKPGRDWYMAMGKVEGMLQ-Q 121

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
              D   R+A F  VL+LAWPDG    + GK  G + WPPRG+LGFGYDP+F P G  +T
Sbjct: 122 LGPD-TDRNAAFHCVLALAWPDGEHAIYEGKCPGSLTWPPRGKLGFGYDPVFVPTGRGQT 180

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           F E+  EEK+                +SHRA AF   V
Sbjct: 181 FAEIDPEEKHA---------------ISHRADAFAKLV 203


>gi|163797074|ref|ZP_02191029.1| hypothetical protein BAL199_11211 [alpha proteobacterium BAL199]
 gi|159177590|gb|EDP62143.1| hypothetical protein BAL199_11211 [alpha proteobacterium BAL199]
          Length = 209

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 134/219 (61%), Gaps = 21/219 (9%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           +RK  +  +++ASHN  K+ E+  L+ P G+   SA +L L  P+ETG++F  NA +K+L
Sbjct: 6   VRKFTDKTLIVASHNSGKVREIGELLGPFGLEVVSAGDLGLPEPDETGDTFIANAELKAL 65

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA  AG PAL+DDSG  +  L+G PGI+SARWA  +   +DF +AM K+  A+ +  + 
Sbjct: 66  AAALAAGKPALADDSGFCVSALNGDPGIYSARWAGPS---KDFSVAMGKVWAAVEASGST 122

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           D   R A F   L+LAWPDGHVE   G V G  VWPPRG  GFGYDP+F P G+DRTFGE
Sbjct: 123 D---RRAWFTCALTLAWPDGHVETVEGHVQGTAVWPPRGDHGFGYDPMFVPEGHDRTFGE 179

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
                    +DSA   S+      SHRA AF+  V+ C 
Sbjct: 180 ---------VDSAWKHSV------SHRAEAFRQLVERCF 203


>gi|296533565|ref|ZP_06896134.1| nucleoside-triphosphatase [Roseomonas cervicalis ATCC 49957]
 gi|296266102|gb|EFH12158.1| nucleoside-triphosphatase [Roseomonas cervicalis ATCC 49957]
          Length = 202

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 122/219 (55%), Gaps = 20/219 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L E  IV+ASHN  K+ E  +L+   GI   SA EL L  P ET  +F  NA IK+L 
Sbjct: 3   RRLEERRIVLASHNAGKVRENAALLAEYGIAVVSAKELGLPEPAETETTFLGNATIKALA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+ A M A++DDSG  I  L+G PG+++A WAE   G RD+  AM K E   R      
Sbjct: 63  AARAANMVAMADDSGFSIASLNGDPGVYTADWAEQPGGGRDYAKAMAKAEALARPH---- 118

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F   L LAWPDGH E F GK  G  VWPPRG  GFGYDP+FQP G+  TF EM
Sbjct: 119 -PDRTAWFTCALVLAWPDGHTEGFEGKAMGEWVWPPRGAAGFGYDPMFQPKGHAETFAEM 177

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
               K+                +SHRA AF+   + CL+
Sbjct: 178 DPAVKH---------------RISHRAEAFRLLAEGCLK 201


>gi|296114410|ref|ZP_06833064.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295979171|gb|EFG85895.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 205

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 127/214 (59%), Gaps = 23/214 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + +V+ASHN  K+ E  +L+   GI   SA  LNL  PEET  +F  NA IK+L AA+ A
Sbjct: 13  DTLVLASHNAGKLVEFSALLSGYGIKVISAATLNLPEPEETATTFAGNAEIKALAAAQAA 72

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSG  +  L+G PGI SARWA     ++DF   M++I + +      D   R+
Sbjct: 73  GLPALADDSGFCVSALNGDPGILSARWAGP---DKDFPAVMRRIHDLM-----GDTPDRT 124

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A FISVL LAWPDG    F G++ G +VWPPRG  G GYDPIF P G   TF EMTE +K
Sbjct: 125 AWFISVLCLAWPDGQSTTFEGRIDGQVVWPPRGTHGHGYDPIFAPEGSPLTFAEMTETQK 184

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           N                +SHR RAF+ F + CL+
Sbjct: 185 N---------------TISHRGRAFRLFREGCLQ 203


>gi|258541166|ref|YP_003186599.1| deoxyribonucleotide triphosphate pyrophosphatase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632244|dbj|BAH98219.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-01]
 gi|256635301|dbj|BAI01270.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-03]
 gi|256638356|dbj|BAI04318.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-07]
 gi|256641410|dbj|BAI07365.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-22]
 gi|256644465|dbj|BAI10413.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-26]
 gi|256647520|dbj|BAI13461.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-32]
 gi|256650573|dbj|BAI16507.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256653564|dbj|BAI19491.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-12]
          Length = 199

 Score =  165 bits (417), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 104/213 (48%), Positives = 127/213 (59%), Gaps = 24/213 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + +V+A+HN  K+ E  +L+   GI   SA ELNL  PEET  +F  NA IK+L AAK A
Sbjct: 10  STLVLATHNAGKLAEFATLLADFGIKVVSAGELNLPEPEETATTFAGNAAIKALAAAKAA 69

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +PAL+DDSGL +  LDG PGI+SARWA  N   +DF  AM +IE  +          R+
Sbjct: 70  NLPALADDSGLCVAALDGAPGIYSARWAGPN---KDFAGAMARIEKEIGQ------GERN 120

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A FI VL LA PDG  E+F G++ G IVWPPRG  G GYDPIF P G  RTF EM + EK
Sbjct: 121 AWFICVLCLALPDGRTESFEGRIDGQIVWPPRGTQGHGYDPIFAPEGETRTFAEMADAEK 180

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           N                +SHRARAF  F + CL
Sbjct: 181 NA---------------ISHRARAFDTFKNACL 198


>gi|197106935|ref|YP_002132312.1| xanthosine triphosphate pyrophosphatase [Phenylobacterium zucineum
           HLK1]
 gi|196480355|gb|ACG79883.1| xanthosine triphosphate pyrophosphatase [Phenylobacterium zucineum
           HLK1]
          Length = 199

 Score =  161 bits (407), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 121/205 (59%), Gaps = 22/205 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+HN  K  E+ + I+       SA EL L  P+ET  +F  NA++K+  AA+ +
Sbjct: 9   TRLVVATHNPGKAREL-AEILDGRFELVSAGELGLSEPDETEATFSGNALLKARAAAEAS 67

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+ AL+DDSGL +  LDG PG++SARWA     E+DF  AM+K+E  L    A D    S
Sbjct: 68  GLIALADDSGLSVAALDGAPGVYSARWAGP---EKDFAAAMRKVEERLEEAGAED---VS 121

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F S L++AWP G      G+V G++V+PPRG  GFGYDPIF P G+D+TFGEM    K
Sbjct: 122 AWFTSALAVAWPGGPAVVVEGRVDGMLVFPPRGTRGFGYDPIFVPEGFDQTFGEMEPAAK 181

Query: 187 NGGIDSATLFSILSTDLLSHRARAF 211
                          D +SHRARAF
Sbjct: 182 ---------------DAMSHRARAF 191


>gi|83945045|ref|ZP_00957411.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanicaulis alexandrii HTCC2633]
 gi|83851827|gb|EAP89682.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanicaulis alexandrii HTCC2633]
          Length = 201

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 122/209 (58%), Gaps = 23/209 (11%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMP 69
            IASHN  KI E+  LI P G+    A  L L  PEET  +F  NA++K+   A+  G+ 
Sbjct: 11  AIASHNKGKIKEIAELIAPYGLAAEGAESLGLPEPEETEKTFTGNALLKARAGAEACGLV 70

Query: 70  ALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFAHDPAFRSAH 128
           +L+DDSGL +  LDG PGI+SARWA    GE RDF  AM+K+   L ++ A D    SA 
Sbjct: 71  SLADDSGLEVTALDGAPGIYSARWA----GEPRDFHAAMEKVRRELEARNATD---YSAR 123

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F+  L+LA P+G    + G+V G + +PPRG+ GFGYDPIF P+G++ TF EM    K+ 
Sbjct: 124 FVCALALAHPNGETRVYEGEVRGQLSFPPRGEKGFGYDPIFIPDGHELTFAEMDPAIKHA 183

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFVDN 217
                          +SHRA AF+  V++
Sbjct: 184 ---------------MSHRAHAFRLLVED 197


>gi|329891145|ref|ZP_08269488.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brevundimonas diminuta ATCC 11568]
 gi|328846446|gb|EGF96010.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brevundimonas diminuta ATCC 11568]
          Length = 200

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 126/210 (60%), Gaps = 23/210 (10%)

Query: 3   KLIEN-NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           KLI+   +V A+HN  K  E+++L+     + T+  ELNL  P+ET  +F  NAM+K+  
Sbjct: 4   KLIKGMRLVAATHNPGKAREIEALLDGHYTIVTAG-ELNLPEPDETETTFVGNAMLKARH 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+ +G  AL+DDSGL +  LDG PGI+SARWA      +DF +AM+K+E  L    + D
Sbjct: 63  AAQASGEVALADDSGLSVAALDGAPGIYSARWAGPT---KDFALAMKKVEQRLEEIASTD 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F S L++AWPDG      G++ G +V+PPRG  GFGYDPIF+P G + TFGEM
Sbjct: 120 ---RRAWFTSALAVAWPDGPCVVVEGQIDGELVFPPRGDRGFGYDPIFRPEGSELTFGEM 176

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAF 211
              EK               D LSHRARAF
Sbjct: 177 DPVEK---------------DALSHRARAF 191


>gi|329114776|ref|ZP_08243533.1| Nucleoside-triphosphatase [Acetobacter pomorum DM001]
 gi|326695907|gb|EGE47591.1| Nucleoside-triphosphatase [Acetobacter pomorum DM001]
          Length = 199

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 102/213 (47%), Positives = 124/213 (58%), Gaps = 24/213 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + +V+A+HN  K+ E  +L+   GI   SA  LNL  PEET  +F  NA IK+L AAK A
Sbjct: 10  STLVLATHNAGKLAEFATLLADFGIKVVSAGALNLPEPEETATTFTGNAAIKALAAAKAA 69

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +PAL+DDSGL +  LD  PGI+SARWA  N   +DF  AM +IE  +          R+
Sbjct: 70  NLPALADDSGLCVAALDSAPGIYSARWAGPN---KDFAGAMARIEEGIGQ------GKRN 120

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A FI VL LA PDG  E+F G++ G IVWPPRG  G GYDPIF P G  RTF EM + EK
Sbjct: 121 AWFICVLCLALPDGRTESFEGRIDGQIVWPPRGTHGHGYDPIFAPEGETRTFAEMADTEK 180

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           N                +SHRARAF  F   CL
Sbjct: 181 NA---------------ISHRARAFDAFKKACL 198


>gi|58039734|ref|YP_191698.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Gluconobacter oxydans 621H]
 gi|62900144|sp|Q5FRF4|NTPA_GLUOX RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|58002148|gb|AAW61042.1| Nucleoside-triphosphatase [Gluconobacter oxydans 621H]
          Length = 208

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 127/220 (57%), Gaps = 24/220 (10%)

Query: 1   MRKLIE-NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKS 59
           MRKL   + IV+ASHN  K+ E  +L+   GI   SA EL+L  PEET  +F  NA IK+
Sbjct: 2   MRKLSPGSKIVLASHNAGKLREFSTLLAESGITVISAAELDLPEPEETEETFTGNAAIKA 61

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
           L AA+ +G+PAL+DDSG  +  LD +PG++SARW       +D  +AM+++      +  
Sbjct: 62  LAAARASGLPALADDSGFCVSALDNRPGVYSARWGGPT---KDMQVAMERVHR----EMG 114

Query: 120 HDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
            +P  R A F++ L LAWPDG      G+  G +VWPPRG  G GYDP+F P G  RTF 
Sbjct: 115 DNPDQR-AFFVAALCLAWPDGETRTVQGECHGTVVWPPRGDHGHGYDPMFVPEGESRTFA 173

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EM+E EKN                +SHR RA   F++ CL
Sbjct: 174 EMSEAEKNA---------------VSHRGRALTAFLNTCL 198


>gi|209966226|ref|YP_002299141.1| HAM1 family protein [Rhodospirillum centenum SW]
 gi|226737270|sp|B6IVK5|NTPA_RHOCS RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|209959692|gb|ACJ00329.1| HAM1 family protein [Rhodospirillum centenum SW]
          Length = 203

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 91/218 (41%), Positives = 124/218 (56%), Gaps = 20/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+   + +VIASHN  K+ E+  L+        SA EL+L  PEET  +F  NA +K+  
Sbjct: 5   RRFAGDTLVIASHNRGKVREIADLLAAHVRHFPSAAELDLPEPEETEATFIGNAALKARA 64

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G+PAL+DDSGL +D LDG PGI+SARWA     E+DF  AM+++   L +  A D
Sbjct: 65  AALASGLPALADDSGLWVDALDGAPGIYSARWAGP---EKDFGAAMERVRRELEA--AAD 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
                A F+  L+LAWPDGHVE   G   G + +PPRG  GFGYDP+F P+G+  T+ E+
Sbjct: 120 RRGDRARFVCALALAWPDGHVEAVEGTAHGTLTFPPRGGKGFGYDPVFIPDGHACTYAEL 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
               K+                +SHRA AF+  +  C 
Sbjct: 180 DPAHKHA---------------ISHRADAFRQLLARCF 202


>gi|326387916|ref|ZP_08209522.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207962|gb|EGD58773.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 208

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/219 (42%), Positives = 128/219 (58%), Gaps = 21/219 (9%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M +L    +VIA+HN  K+ E+ +L+ P G+   SA EL L  P+ETG +F ENA++K+ 
Sbjct: 1   MPRLTPGKLVIATHNAGKLKEIRALLAPYGMDCISAGELGLPEPDETGTTFVENALLKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE----RDFDMAMQKIENALRS 116
            AA+ A +PAL+DDSGL +  L G PG+++A WAE    E    RD+ MAM K+E  L  
Sbjct: 61  AAAQAANLPALADDSGLSVTALGGAPGVYTADWAEKGPREGGPGRDWYMAMGKVEGKLAE 120

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
                P  R A F  VL++AWPDG    + G++ G + WPPRG+LGFGYDP+F   G+DR
Sbjct: 121 LGPDTP--RDAWFSCVLAIAWPDGGEAVYEGRIDGTLTWPPRGKLGFGYDPVFVARGHDR 178

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           TF E+   +K                 +SHRA AF   V
Sbjct: 179 TFAELDPADKQA---------------ISHRADAFAKLV 202


>gi|313680800|ref|YP_004058539.1| non-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Oceanithermus profundus DSM 14977]
 gi|313153515|gb|ADR37366.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Oceanithermus profundus DSM 14977]
          Length = 203

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 123/209 (58%), Gaps = 22/209 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +VIA+ N  K  E+   + PLG       +  + +PEETG +FE+NA++K+ T A+   
Sbjct: 2   QVVIATSNPGKYRELARGLEPLGWELRPLPDFGVELPEETGTTFEDNALMKAATVAQKTR 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSGLV+D L G+PGI+SAR+    T +RD ++ +      L       P  R+A
Sbjct: 62  LPALADDSGLVVDALGGEPGIYSARYG-GRTNDRDRNVYL------LERLRGVPPEQRTA 114

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F++VL+LA+PDGHVE++ G+V G+I+  PRG+ GFGYDP+F     +RTF EM  EEK 
Sbjct: 115 RFVAVLALAYPDGHVESYRGEVEGVILEAPRGEGGFGYDPLFYLPELERTFAEMAPEEKA 174

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVD 216
                            SHRARA    ++
Sbjct: 175 ---------------RHSHRARALAKLLE 188


>gi|302381543|ref|YP_003817366.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302192171|gb|ADK99742.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 200

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 119/212 (56%), Gaps = 22/212 (10%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           +R +    +V A+HN  K  E+ +L+     + T A E+NL  P ET  +F  NAM+K+ 
Sbjct: 3   LRLIKGMRLVAATHNAGKAREIHALLDGHYTVVT-ATEVNLPEPAETETTFVGNAMLKAR 61

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA   G   L+DDSGL +  LDG PGI SARW      +RDF++AM KIE  L    AH
Sbjct: 62  HAAAFCGEVCLADDSGLSVTALDGAPGIFSARWGGP---QRDFNVAMDKIETRLEELGAH 118

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           D   R+A F S L++AWPDG      G+V G++ +P RG  GFGYDPIF P+G+  TFGE
Sbjct: 119 D---RTAWFTSALAVAWPDGPCVVVEGRVDGVVTFPRRGDRGFGYDPIFIPDGHTLTFGE 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           M    K               D LSHR RAF+
Sbjct: 176 MKPALK---------------DSLSHRTRAFE 192


>gi|221632750|ref|YP_002521972.1| non-canonical purine NTP pyrophosphatase [Thermomicrobium roseum
           DSM 5159]
 gi|221155492|gb|ACM04619.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermomicrobium roseum DSM 5159]
          Length = 210

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 120/206 (58%), Gaps = 22/206 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + IV+A+ N  KI E+ SL+ P  +   SA  L + +P ETG +F ENA++K+  AA+ +
Sbjct: 4   HRIVLATANPGKIRELRSLLPP-NVEVVSAPALGIRLPPETGETFVENALLKARVAAQES 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+ AL+DDSGL +D L G+PG+HSAR+A    GE   D   Q I   LR       + R+
Sbjct: 63  GLIALADDSGLEVDALGGRPGVHSARYA----GEHADD--AQNIARLLRELRDVPLSQRT 116

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F +V+++  PDG      G V G I   PRG+ GFGYDP+F P GYDRTF EMT EEK
Sbjct: 117 ARFRAVVAIVAPDGREAVVEGTVEGCIAEKPRGRGGFGYDPVFIPCGYDRTFAEMTLEEK 176

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                LSHRA+A +
Sbjct: 177 N---------------RLSHRAQALQ 187


>gi|144897367|emb|CAM74231.1| Ham1-like protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 198

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/219 (44%), Positives = 121/219 (55%), Gaps = 23/219 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK     ++IASHN  K+ E+  L+        SA  L L  PEETG +F  NA +K+L 
Sbjct: 3   RKFTAGPLIIASHNAGKVREIGELLGRFDAQVVSAGTLGLDEPEETGATFAANAELKALA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK A +PAL+DDSGL ++ L G PGI+SARWA      +DF  AM+ + + +      D
Sbjct: 63  AAKAANLPALADDSGLAVNALGGDPGIYSARWAGPT---KDFGAAMKLVHDKM-----GD 114

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F+  L+LAWPDGHVE F G V G IVWPPRG  GFGYDP F P G   TFGEM
Sbjct: 115 TPDRGARFVCALALAWPDGHVETFEGVVEGDIVWPPRGANGFGYDPFFLPTGGSLTFGEM 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
               K+                +SHRA AF   V  C +
Sbjct: 175 EAAAKHA---------------ISHRADAFAKLVAACFQ 198


>gi|221233084|ref|YP_002515520.1| deoxyribonucleotide triphosphate pyrophosphatase [Caulobacter
           crescentus NA1000]
 gi|220962256|gb|ACL93612.1| xanthosine triphosphate pyrophosphatase [Caulobacter crescentus
           NA1000]
          Length = 200

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 121/207 (58%), Gaps = 22/207 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +V A+HN  K+ E+ +L+     + T+  +L L  P+ET ++F  NA++K+  AA 
Sbjct: 7   VGAKLVAATHNPGKVPEIAALLDGRFEIVTAG-QLGLPEPDETESTFVGNALLKARHAAD 65

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PAL+DDSGL +  LDG PGI SARWA      +DF +AM+K+E  L    + D   
Sbjct: 66  LSGLPALADDSGLSVTALDGAPGIFSARWAGPG---KDFALAMKKVEERLEETASDD--- 119

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F S L++AWP+G      G+V G +V+P RG  GFGYDPIF P G+  TFGEM   
Sbjct: 120 RTAWFTSALAVAWPNGPAVVVEGRVDGTLVFPGRGTRGFGYDPIFVPEGHALTFGEMEPA 179

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAF 211
            K               D +SHRARAF
Sbjct: 180 AK---------------DAMSHRARAF 191


>gi|330991185|ref|ZP_08315138.1| Nucleoside-triphosphatase [Gluconacetobacter sp. SXCC-1]
 gi|329761771|gb|EGG78262.1| Nucleoside-triphosphatase [Gluconacetobacter sp. SXCC-1]
          Length = 206

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 97/216 (44%), Positives = 124/216 (57%), Gaps = 23/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + +V+A+HN  KI E  +L+   GI   SA +L+L  PEET +SF  NA IK++ AAK A
Sbjct: 12  DTLVLATHNKGKIAEFAALLGGYGIHVRSAGDLSLPEPEETADSFAGNAAIKAVAAAKAA 71

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +PAL+DDSG  +  L G PGI SARWA     ++D+  AM++I   +      D   R 
Sbjct: 72  NLPALADDSGFCVSALGGAPGIFSARWAGP---DKDYPDAMRRIHEQI-----GDSPDRG 123

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A FISVL LAWPDG  E F G++ G +VWPP G  G GYDPIF P    RTF +MT+ +K
Sbjct: 124 AWFISVLCLAWPDGQTETFEGRIDGHVVWPPHGTNGHGYDPIFAPGDGARTFADMTDTQK 183

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           N                +SHR  AF  F D CL  D
Sbjct: 184 NA---------------ISHRGLAFALFRDACLPQD 204


>gi|16124401|ref|NP_418965.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Caulobacter crescentus CB15]
 gi|22653771|sp|Q9ABS4|NTPA_CAUCR RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|13421257|gb|AAK22133.1| Ham1 family protein [Caulobacter crescentus CB15]
          Length = 194

 Score =  151 bits (381), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 120/204 (58%), Gaps = 22/204 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V A+HN  K+ E+ +L+     + T+  +L L  P+ET ++F  NA++K+  AA  +G
Sbjct: 4   KLVAATHNPGKVPEIAALLDGRFEIVTAG-QLGLPEPDETESTFVGNALLKARHAADLSG 62

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSGL +  LDG PGI SARWA      +DF +AM+K+E  L    + D   R+A
Sbjct: 63  LPALADDSGLSVTALDGAPGIFSARWAGPG---KDFALAMKKVEERLEETASDD---RTA 116

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F S L++AWP+G      G+V G +V+P RG  GFGYDPIF P G+  TFGEM    K 
Sbjct: 117 WFTSALAVAWPNGPAVVVEGRVDGTLVFPGRGTRGFGYDPIFVPEGHALTFGEMEPAAK- 175

Query: 188 GGIDSATLFSILSTDLLSHRARAF 211
                         D +SHRARAF
Sbjct: 176 --------------DAMSHRARAF 185


>gi|329770517|ref|ZP_08261895.1| Ham1 family protein [Gemella sanguinis M325]
 gi|328836266|gb|EGF85935.1| Ham1 family protein [Gemella sanguinis M325]
          Length = 194

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 123/212 (58%), Gaps = 27/212 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +++AS+N+ K+ E+ S++    I+T + +     I EE GN+FEENA+IK+ T AK AG 
Sbjct: 4   LILASNNLHKVEEIKSILNNYNILTLNEIGFTDEI-EENGNTFEENALIKARTIAKFAGK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
            A++DDSGL ID+LDG+PG+ SAR+++  T E++ +  +          F  D  +  A 
Sbjct: 63  TAIADDSGLAIDLLDGRPGVFSARYSKEQTDEKNIEKVL----------FELDGNYSKAK 112

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F+SV++   PDG  + F G+  G I++  RG  GFGYDPIF     D+TF E+T EEKN 
Sbjct: 113 FVSVIAYVTPDGVEKTFRGECHGEIIFEKRGNNGFGYDPIFYVPELDKTFAEITSEEKNS 172

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
                          +SHR+ + K F  N LR
Sbjct: 173 ---------------ISHRSESLKKF-SNYLR 188


>gi|295691350|ref|YP_003595043.1| non-canonical purine NTP pyrophosphatase, rdgb/HAM1 family
           [Caulobacter segnis ATCC 21756]
 gi|295433253|gb|ADG12425.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caulobacter segnis ATCC 21756]
          Length = 200

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 85/204 (41%), Positives = 121/204 (59%), Gaps = 22/204 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V A+HN  K+ E+ +L+     + T+  +L L  PEET ++F  NA++K+  AA  +G
Sbjct: 10  KLVAATHNPGKVPEIMALLDGRFEIVTAG-QLGLPEPEETESTFVGNALLKARHAADRSG 68

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           + AL+DDSGL +  L+G PG++SARWA  +   +DF  AM+K+E  L    + D   RSA
Sbjct: 69  LVALADDSGLSVAALEGSPGVYSARWAGPS---KDFMAAMRKVEERLEETSSDD---RSA 122

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F S L++AWP G      G++ G++ +PPRG  GFGYDPIF P G++ TFGEM    K 
Sbjct: 123 WFTSALAVAWPHGPAVVVEGRIDGMLTFPPRGDRGFGYDPIFIPAGHETTFGEMEPAAK- 181

Query: 188 GGIDSATLFSILSTDLLSHRARAF 211
                         D +SHRARAF
Sbjct: 182 --------------DAMSHRARAF 191


>gi|315497098|ref|YP_004085902.1| ham1 family protein [Asticcacaulis excentricus CB 48]
 gi|315415110|gb|ADU11751.1| Ham1 family protein [Asticcacaulis excentricus CB 48]
          Length = 203

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 93/208 (44%), Positives = 120/208 (57%), Gaps = 22/208 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             ++ A+HN  K  E+DSL+        SA  L L  P+ET NSF  NA++K+  AA  A
Sbjct: 9   QKLIAATHNPGKAREIDSLLNGR-FEVVSAGSLGLPEPDETENSFIGNAILKARHAAMAA 67

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL I  L+G PGI+SARWA     ++DF  AM+ I + +     H+P   S
Sbjct: 68  GLPALADDSGLSIAALNGDPGIYSARWAGP---QKDFPRAMEIIHHKMIQAEVHNPETYS 124

Query: 127 --AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
             A F S L++AWP+GH   F G V G IV  PRG  GFGYDPIFQP+GY+ T+ EM + 
Sbjct: 125 TRAWFTSALAVAWPEGHAVVFEGVVHGNIV-APRGDKGFGYDPIFQPDGYEITYAEMDDV 183

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
            K               D LSHR  AF+
Sbjct: 184 LK---------------DSLSHRHLAFE 196


>gi|254418110|ref|ZP_05031834.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brevundimonas sp. BAL3]
 gi|196184287|gb|EDX79263.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brevundimonas sp. BAL3]
          Length = 192

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 119/205 (58%), Gaps = 24/205 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMP-LGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
            IV A+HN  K+ E+ +L+     I+T  A +LNL  P+ET  +F  NAM+K+  AA  +
Sbjct: 2   RIVAATHNPGKVPEIAALLGEDYEILT--AGQLNLSEPDETETTFAGNAMLKARHAAALS 59

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G  AL+DDSG+ +  LDG PGI SARWA      +DF +AM+K+E+ L    A D   R+
Sbjct: 60  GEVALADDSGMSVAALDGAPGIFSARWAGPG---KDFAVAMKKVEDRLEEIGATD---RA 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F S L++AWPDG      G+V G + +PPRG  GFGYDPIF P G D TFGEM    K
Sbjct: 114 AWFTSALAVAWPDGPCVVVEGEVHGRLTFPPRGDRGFGYDPIFIPEGGDLTFGEMEPAAK 173

Query: 187 NGGIDSATLFSILSTDLLSHRARAF 211
                          + +SHR RAF
Sbjct: 174 ---------------EAISHRTRAF 183


>gi|325282280|ref|YP_004254821.1| Nucleoside-triphosphatase rdgB [Deinococcus proteolyticus MRP]
 gi|324314089|gb|ADY25204.1| Nucleoside-triphosphatase rdgB [Deinococcus proteolyticus MRP]
          Length = 206

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 121/207 (58%), Gaps = 27/207 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ EM   +  LG      L   + +PEETG ++EENA +K+ T A   
Sbjct: 16  KRVVVATSNPGKVREMAEALAGLG-WELMPLPAGIAMPEETGTTYEENASLKACTIATRL 74

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAE-SNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PAL+DDSG+ +D LDG+PG++SAR+ + ++  ER+       + + LR K     + R
Sbjct: 75  GLPALADDSGIEVDALDGQPGVYSARFGDCASDTERN-----TYLLDRLRGK-----SDR 124

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            AHF SV+ LA+PDG +E + G VSG ++  PRG  GFGYDP+F P+G  R+FGEM+ EE
Sbjct: 125 RAHFRSVVILAYPDGDMECYEGVVSGTLLEGPRGTQGFGYDPLFVPDGETRSFGEMSVEE 184

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFK 212
           K                 LSHR  A K
Sbjct: 185 KR---------------PLSHRGLALK 196


>gi|313205577|ref|YP_004044754.1| non-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Riemerella anatipestifer DSM 15868]
 gi|312444893|gb|ADQ81248.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Riemerella anatipestifer DSM 15868]
 gi|315022693|gb|EFT35718.1| Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Riemerella anatipestifer RA-YM]
 gi|325334993|gb|ADZ11267.1| Ham [Riemerella anatipestifer RA-GD]
          Length = 191

 Score =  144 bits (364), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 88/212 (41%), Positives = 120/212 (56%), Gaps = 27/212 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTT-SALELNLIIPEETGNSFEENAMIKSLTAA 63
           ++  I+IA+HN  K  E+  ++    I+ + S  +LN  I E+ GN+FEENA IK+    
Sbjct: 1   MKKEILIATHNQHKKEEIQQILGDGFIVKSLSDYQLNDEIVED-GNTFEENAFIKASYCF 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G+P+L DDSGLV+D LDG+PGI+SAR+A    G  DF   + K+   ++ K      
Sbjct: 60  QKTGIPSLGDDSGLVVDALDGRPGIYSARYA----GNHDFKANIAKVLEEMQGK-----T 110

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+AHFI+VL L   +G    F GKV G ++   RG  GFGYDPIF PNGY+ TF EM  
Sbjct: 111 NRAAHFITVLCLVDENG-TSYFEGKVHGHLLEEDRGHQGFGYDPIFVPNGYETTFAEMAP 169

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           EEKN                +SHR  A   F+
Sbjct: 170 EEKNA---------------ISHRKNALDQFL 186


>gi|320451389|ref|YP_004203485.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Thermus
           scotoductus SA-01]
 gi|320151558|gb|ADW22936.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Thermus
           scotoductus SA-01]
          Length = 203

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 118/208 (56%), Gaps = 22/208 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V+A+ N  K+ E+   + PLG    S  +  L +P+E G +F ENA++K+   AK  G
Sbjct: 2   RLVLATSNPGKVQELKEGLAPLGWTLLSLADFPLRMPKEEGATFLENALLKAAYVAKATG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSGL +  L G+PG++SAR+    T +R+ ++ + +    L+ +       R A
Sbjct: 62  LPALADDSGLEVPALGGEPGVYSARYGGRET-DRERNVYLLERMRHLKGE------ERKA 114

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F++VL LA+PDGHVE + G+V G I+  PRG+ GFGYDP+F      +TF EMT EEK 
Sbjct: 115 RFVAVLVLAYPDGHVETYEGQVEGYILEAPRGEGGFGYDPLFYVPEAGKTFAEMTLEEKA 174

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFV 215
                            SHR +A K  +
Sbjct: 175 ---------------RYSHRGQAIKALL 187


>gi|297565610|ref|YP_003684582.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Meiothermus silvanus DSM 9946]
 gi|296850059|gb|ADH63074.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Meiothermus silvanus DSM 9946]
          Length = 421

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 120/210 (57%), Gaps = 24/210 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +++A+ N  K  E+   + PLG    S L+    +P E G++FE+NAM+K+  A K  G
Sbjct: 220 RVLVATSNAGKFKELREGLAPLGWQLFSLLDYPFKLPHEDGSTFEDNAMLKAAFATKQVG 279

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARW-AESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           +PAL+DDSGL ++ L G+PG++SAR+  +S+  ER+  +      + LR     +   R 
Sbjct: 280 IPALADDSGLEVEALQGEPGVYSARYGGKSSDTERNLYLL-----DRLRHVKGEE---RR 331

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F++VL LA+PDGH+E + G+  G+I+  PRG+ GFGYDP+F      +TF EM+ EEK
Sbjct: 332 AKFVAVLVLAYPDGHLEAYRGEAHGLILEAPRGEGGFGYDPLFYVPEAGKTFAEMSLEEK 391

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVD 216
                             SHR +A +  ++
Sbjct: 392 AH---------------YSHRGKALRALLE 406



 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 91/180 (50%), Gaps = 8/180 (4%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            ++  + N  K   +  L+ PLG    S  E  + IPE    S  ++A++++  AAK +G
Sbjct: 2   RVLATTTNPLKAQRLQELLRPLGWQVISLAEQQVPIPEVPHLSPLDSALVRAAAAAKASG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PA++D+S   + V +GK   +S  +   NT        ++++      +       R A
Sbjct: 62  IPAIADESVFELQV-NGKLEHYSMHFGPWNTALERNLRLLERLRGLPIER-------RGA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            FI+V++LA P G +E F G+ +G+I+     Q G GYDP+F      +T  +MT EE+ 
Sbjct: 114 RFITVMALAQPSGALEVFQGETAGLILQRMENQGGIGYDPLFFVTEASKTLADMTPEERE 173


>gi|328949912|ref|YP_004367247.1| Nucleoside-triphosphatase rdgB [Marinithermus hydrothermalis DSM
           14884]
 gi|328450236|gb|AEB11137.1| Nucleoside-triphosphatase rdgB [Marinithermus hydrothermalis DSM
           14884]
          Length = 203

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 116/209 (55%), Gaps = 22/209 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            ++IA+ N  K  E+   + PLG    S L+  L +P+E G +FE+NA++K+  AAK  G
Sbjct: 2   RVLIATSNPGKFQELRQGLEPLGWACVSLLDYPLKMPKEEGATFEDNALLKAAFAAKETG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           + AL+DDSGL +D LDG+PG++SAR+    T        ++++           P  R+A
Sbjct: 62  LAALADDSGLEVDALDGEPGVYSARYGGKTTDTERNIYLLERLRGV-------PPEQRTA 114

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+ VL+LA+PDGHVE + G+V G I+  PRG  GFGYDP+F      RTF EM  EEK 
Sbjct: 115 RFVCVLALAYPDGHVETYRGEVEGRILEAPRGSGGFGYDPLFYLPEAGRTFAEMPPEEKA 174

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVD 216
                            SHR RA +  ++
Sbjct: 175 ---------------RYSHRGRALRALIE 188


>gi|329766986|ref|ZP_08258514.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Gemella
           haemolysans M341]
 gi|328837711|gb|EGF87336.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Gemella
           haemolysans M341]
          Length = 194

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 122/206 (59%), Gaps = 26/206 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +++AS+N  K+ E+ S++    I+T   +     I E+ G++FEENA+IK+ T +K +G 
Sbjct: 4   LILASNNAHKVEEIKSILEDYNILTLKDINYTEEIVED-GSTFEENALIKARTISKYSGK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
            A+SDDSGL +D+LDG+PG++SAR+++  T E++ +  + ++ N  +SK         A 
Sbjct: 63  TAISDDSGLSVDLLDGRPGVYSARYSKEQTDEKNIEKVLLEL-NGQKSK---------AK 112

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F+SV++L  PDG    F G+  G I++  RG  GFGYDPIF     D+TF E++ E+KN 
Sbjct: 113 FVSVIALVKPDGTELTFRGECHGEIIFEKRGTNGFGYDPIFYVPSLDKTFAELSAEQKNS 172

Query: 189 GIDSATLFSILSTDLLSHRARAFKCF 214
                          +SHR ++ + F
Sbjct: 173 ---------------ISHRKQSLEKF 183


>gi|325955205|ref|YP_004238865.1| nucleoside-triphosphatase rdgB [Weeksella virosa DSM 16922]
 gi|323437823|gb|ADX68287.1| Nucleoside-triphosphatase rdgB [Weeksella virosa DSM 16922]
          Length = 191

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 77/181 (42%), Positives = 109/181 (60%), Gaps = 12/181 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           ++ A+HN DK+ E+ +L +P  I   S  +LN     EETGN+FEENA IK+ T  +   
Sbjct: 3   LIFATHNQDKLKELQAL-LPETIQLQSLTDLNFHDDIEETGNTFEENAFIKTKTIYEKFH 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
            P  +DDSGLVID L+G+PG+ SAR+A +   E +    ++++E           + R A
Sbjct: 62  QPVFADDSGLVIDALNGRPGVFSARYAGTKNSEDNIAKVLKELEGI---------SNRKA 112

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           +FISV  L   D  V  F G++ G I+   +G  GFGYDPIF+P+G+D TF EM+ EEKN
Sbjct: 113 YFISVFCLMIND-EVHYFEGRIEGEIMNENKGNKGFGYDPIFRPSGFDYTFAEMSAEEKN 171

Query: 188 G 188
            
Sbjct: 172 A 172


>gi|218296249|ref|ZP_03497005.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Thermus
           aquaticus Y51MC23]
 gi|218243321|gb|EED09851.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Thermus
           aquaticus Y51MC23]
          Length = 203

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 119/208 (57%), Gaps = 22/208 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V+A+ N  K+ E+ + + PLG    S  +  L +P+E G++F ENA++K+   A+  G
Sbjct: 2   RVVLATSNPGKVRELKAGLEPLGWTLLSLADFPLRMPKEEGSTFLENALLKAAYVARATG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSGL +  L G+PG++SAR+    T +R+ ++ + +    L+ +       R A
Sbjct: 62  LPALADDSGLEVFALGGEPGVYSARYGGRET-DRERNVYLLERMRHLKGE------ERRA 114

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F++VL LA+PDGH E + G V G+I+  PRG+ GFGYDP+F      +TF EM+ EEK 
Sbjct: 115 RFVAVLVLAYPDGHAEAYEGSVEGVILEAPRGEGGFGYDPLFFIPEAGKTFAEMSLEEKA 174

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFV 215
                            SHR RA +  +
Sbjct: 175 ---------------RYSHRGRALQALL 187


>gi|55981623|ref|YP_144920.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Thermus
           thermophilus HB8]
 gi|62900175|sp|Q5SHS6|NTPA_THET8 RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|55773036|dbj|BAD71477.1| nucleoside-triphosphatase (HAM1 protein) [Thermus thermophilus HB8]
          Length = 207

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 117/209 (55%), Gaps = 22/209 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V+A+ N  K+ E+   + PLG    +  +  L +P+E G +F ENA++K+   AK  G
Sbjct: 6   KVVLATGNPGKVRELKEGLAPLGWTLLTLADFALRMPKEEGATFLENALLKAAYVAKATG 65

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSGL +  L G+PG++SAR+    T +R+ ++ + +    L+ +       R A
Sbjct: 66  LPALADDSGLEVYALGGEPGVYSARYGGRAT-DRERNVYLLERMRHLKGE------ERKA 118

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F++VL LA+PDGH E + G V G+I+  PRG+ GFGYDP+F      +TF EM  EEK 
Sbjct: 119 RFVAVLVLAYPDGHAEAYEGSVEGVILEAPRGEGGFGYDPLFYVPEAGKTFAEMGLEEKA 178

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVD 216
                            SHR +A +  ++
Sbjct: 179 ---------------RYSHRGKALRALLE 192


>gi|291295491|ref|YP_003506889.1| non-canonical purine NTP pyrophosphatase rdgB/HAM1 family
           [Meiothermus ruber DSM 1279]
 gi|290470450|gb|ADD27869.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Meiothermus ruber DSM 1279]
          Length = 203

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 120/209 (57%), Gaps = 22/209 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +++IA+ N  K  E+   + PLG    S L+    +P E G++FE+NA++K+  AAK++G
Sbjct: 2   HLLIATSNPGKFREIREGLAPLGWTLFSLLDYPFKLPPEEGSTFEDNAVLKAAFAAKHSG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +P L+DDSGL +  L G+PG++SAR+   +T        +++++   R++       R A
Sbjct: 62  LPTLADDSGLEVAALGGEPGVYSARYGNKSTDTERNVYLLERLKGVPRAE-------RKA 114

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F++VL +A+PDG++E + G+  G I+  PRG+ GFGYDP+F      +TF EMT EEK 
Sbjct: 115 RFVAVLVMAYPDGYMELYRGETEGEILEAPRGEWGFGYDPLFYLPEAGKTFAEMTLEEKA 174

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVD 216
                            SHR +A +  ++
Sbjct: 175 A---------------YSHRGKALRQLLE 188


>gi|94986308|ref|YP_605672.1| Ham1-like protein protein [Deinococcus geothermalis DSM 11300]
 gi|167016362|sp|Q1IW81|NTPA_DEIGD RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|94556589|gb|ABF46503.1| Xanthosine triphosphate pyrophosphatase [Deinococcus geothermalis
           DSM 11300]
          Length = 199

 Score =  138 bits (347), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 83/209 (39%), Positives = 121/209 (57%), Gaps = 30/209 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKNAG 67
           +V+A+ N  K+ E+   +  LG        LN L +PEETG ++EENA +K+  AA   G
Sbjct: 3   VVVATGNAGKVREIAEALSELGWQLEG---LNGLTLPEETGTTYEENAALKACAAALAKG 59

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           +PAL+DDSGL +  LDG+PG++SAR+    N  ER+  + ++K+      +   D   R 
Sbjct: 60  LPALADDSGLEVAALDGQPGVYSARFGNRPNDTERNLYL-LEKL------RGVQD---RR 109

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+SV+ LA+PDGHVE + G+++G ++  PRG+ GFGYDP+F P+G  RT  EMT  EK
Sbjct: 110 AKFVSVVMLAYPDGHVETYRGELTGTLLEGPRGENGFGYDPLFVPDGETRTLAEMTVAEK 169

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFV 215
                            +SHR RA    +
Sbjct: 170 R---------------TISHRGRALAALL 183


>gi|46199592|ref|YP_005259.1| nucleoside-triphosphatase [Thermus thermophilus HB27]
 gi|62900235|sp|Q72I42|NTPA_THET2 RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|46197218|gb|AAS81632.1| nucleoside-triphosphatase [Thermus thermophilus HB27]
          Length = 207

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 116/209 (55%), Gaps = 22/209 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V+ + N  K+ E+   + PLG    +  +  L +P+E G +F ENA++K+   AK  G
Sbjct: 6   KVVLTTGNPGKVRELKEGLAPLGWTLLTLADFALRMPKEEGATFLENALLKAAYVAKATG 65

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSGL +  L G+PG++SAR+    T +R+ ++ + +    L+ +       R A
Sbjct: 66  LPALADDSGLEVYALGGEPGVYSARYGGRAT-DRERNVYLLERMRHLKGE------ERKA 118

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F++VL LA+PDGH E + G V G+I+  PRG+ GFGYDP+F      +TF EM  EEK 
Sbjct: 119 RFVAVLVLAYPDGHAEAYEGSVEGVILEAPRGEGGFGYDPLFYVPEAGKTFAEMGLEEKA 178

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVD 216
                            SHR +A +  ++
Sbjct: 179 ---------------RYSHRGKALRALLE 192


>gi|262277777|ref|ZP_06055570.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [alpha
           proteobacterium HIMB114]
 gi|262224880|gb|EEY75339.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [alpha
           proteobacterium HIMB114]
          Length = 203

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 104/181 (57%), Gaps = 7/181 (3%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +++A++N  K  E+   I+P  I      +  L  P E G +F+ NA IKSL AAK  
Sbjct: 11  QKLLLATNNPGKFRELKE-ILPKKIKYFKPKDFRLREPVENGKTFKSNAKIKSLYAAKRT 69

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+  +SDDSGL +D +  KPGI+SARWA      ++FD+A++K+                
Sbjct: 70  GLVCISDDSGLEVDAISKKPGIYSARWAGPT---KNFDIAIKKV---FNLLNKKKKLNSK 123

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A FI  +S+A+PDG    F GKV G I +P RG+ GFGYDPIF P G  +TF ++ + +K
Sbjct: 124 ARFICAISIAFPDGKSFEFQGKVEGHISFPARGKKGFGYDPIFIPKGEKKTFAQIGKLKK 183

Query: 187 N 187
           N
Sbjct: 184 N 184


>gi|329847438|ref|ZP_08262466.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Asticcacaulis biprosthecum C19]
 gi|328842501|gb|EGF92070.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Asticcacaulis biprosthecum C19]
          Length = 204

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 87/208 (41%), Positives = 114/208 (54%), Gaps = 21/208 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             ++ A+HN  K  E+ +L+     + T+A  LNL  P+ET  SF  NA++K+  AA  A
Sbjct: 9   QKLIAATHNPGKAREISALLDGRFEVVTAA-SLNLPEPDETEVSFIGNAILKARHAATKA 67

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH--DPAF 124
           GM AL+DDSGL I  L+G PG++SARWA  +   +DF  A + I + LR       D   
Sbjct: 68  GMTALADDSGLSIAALNGDPGVYSARWAGPD---KDFTRAGEVIGHKLRKAREELGDAFT 124

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
             A F   L++AWP+G    F G V G IV P RG  GFGYDPIF+P+GYD TF EM   
Sbjct: 125 LKAWFTCALAVAWPEGPAAVFEGVVHGEIVLPGRGDKGFGYDPIFRPDGYDTTFAEMDPN 184

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
            K               D +SHR  AF+
Sbjct: 185 AK---------------DAISHRHLAFE 197


>gi|330813339|ref|YP_004357578.1| nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486434|gb|AEA80839.1| nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 203

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/217 (37%), Positives = 124/217 (57%), Gaps = 28/217 (12%)

Query: 1   MRKLIE----NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAM 56
           M KL E    ++I+IA++N  K  E+  L +P  I      +  L  P+ET   F+ NA 
Sbjct: 1   MNKLKELKKISSILIATNNPGKFKELKEL-LPKHIKYFRPQDFKLKEPKETAKDFKGNAR 59

Query: 57  IKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIEN-ALR 115
           IKSL  AK +G+ ++SDDSGL ++ L+G+PGI+SARWA      ++F +A++KI    L+
Sbjct: 60  IKSLYCAKKSGLISISDDSGLEVEDLNGQPGIYSARWAGK---LKNFSLAIEKIRKLLLK 116

Query: 116 SKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYD 175
           +K +       A+F   +S+ +P+G    F GKV G + +PP+G+ GFGYDPIF  N   
Sbjct: 117 NKLSES----KANFTCCISVGFPNGKSYEFLGKVFGKVTFPPKGKRGFGYDPIFVANKEL 172

Query: 176 RTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           +TFG++  + KN                +SHR +AFK
Sbjct: 173 KTFGQLPAKYKNS---------------ISHRYQAFK 194


>gi|281356158|ref|ZP_06242651.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Victivallis vadensis ATCC BAA-548]
 gi|281317527|gb|EFB01548.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Victivallis vadensis ATCC BAA-548]
          Length = 201

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 116/205 (56%), Gaps = 27/205 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNAG 67
           IV A+ N  K+ E   L+    +   S L+       EE G SF ENA IK+L A K   
Sbjct: 4   IVAATANAHKVDEYRKLLEGQNVELKSLLDYPGFPGVEENGRSFIENAGIKALAACKYCD 63

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PA +DDSGL ++ LDG+PGI+SAR+A ++  ER     + ++ + ++ +       R A
Sbjct: 64  VPAFADDSGLEVEALDGRPGIYSARYAPTDK-ER-----IARLLDEMKGQ-----TNRRA 112

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+  +++A     +E+F G++ G IV  PRG+ GFGYDP+FQP+GYD+TFGEM  E KN
Sbjct: 113 RFVCAIAIAINGEVIESFEGEIKGTIVDAPRGESGFGYDPVFQPDGYDQTFGEMAPELKN 172

Query: 188 GGIDSATLFSILSTDLLSHRARAFK 212
                           +SHRA AFK
Sbjct: 173 ---------------RISHRANAFK 182


>gi|332655283|ref|ZP_08421023.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Ruminococcaceae bacterium D16]
 gi|332515788|gb|EGJ45398.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Ruminococcaceae bacterium D16]
          Length = 197

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 117/208 (56%), Gaps = 24/208 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNA 66
            +V+AS N  K+ EM+ ++  LGI   S  +  + +  EETG +FEEN+M+K+    + +
Sbjct: 2   KLVLASKNQKKLKEMNEILSQLGIEVCSEADAGVDVEVEETGTTFEENSMLKAKAVMEAS 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           GMPA++DDSGL +D L+G PG++SAR+     GE   D    ++   L +     P  R+
Sbjct: 62  GMPAIADDSGLCVDALNGAPGVYSARYG----GEGLDDTGRYRL--LLENMRGQTP--RT 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+SV++  +P+G V    G+  G I + P G+ GFGYDP+F   G  +TF ++T EEK
Sbjct: 114 AKFVSVITCCFPNGDVLTARGECPGTIAFAPMGEGGFGYDPVFFMPGLKKTFAQLTPEEK 173

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCF 214
           N                +SHR +A + F
Sbjct: 174 NA---------------ISHRGKALEDF 186


>gi|226356946|ref|YP_002786686.1| deoxyribonucleotide triphosphate pyrophosphatase [Deinococcus
           deserti VCD115]
 gi|259514625|sp|C1CXX6|NTPA_DEIDV RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
          Length = 202

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 119/209 (56%), Gaps = 28/209 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E++  +  L    T    + L  PEETG ++EENA +K+  AA   
Sbjct: 4   RQVVVATGNAGKVREIEQALAGLDWRLTGLGSVTL--PEETGATYEENAALKACAAAVAC 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PAL+DDSGL ++ LDG+PG++SAR+    N  ER+  + ++K+              R
Sbjct: 62  GLPALADDSGLEVEALDGQPGVYSARFGNRPNDRERNLYL-LEKLRGETN---------R 111

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F+SV+ LA+PDGH+E + G+++G ++  PRG+ GFGYDP+F P+G  R+  EMT EE
Sbjct: 112 RAKFVSVVILAYPDGHLETYRGEMTGQLLEGPRGENGFGYDPLFVPDGETRSLAEMTVEE 171

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCF 214
           K                 +SHR RA    
Sbjct: 172 KRA---------------ISHRGRALAAL 185


>gi|315271303|gb|ACO46932.2| putative HAM1 protein [Deinococcus deserti VCD115]
          Length = 208

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 119/209 (56%), Gaps = 28/209 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E++  +  L    T    + L  PEETG ++EENA +K+  AA   
Sbjct: 10  RQVVVATGNAGKVREIEQALAGLDWRLTGLGSVTL--PEETGATYEENAALKACAAAVAC 67

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PAL+DDSGL ++ LDG+PG++SAR+    N  ER+  + ++K+              R
Sbjct: 68  GLPALADDSGLEVEALDGQPGVYSARFGNRPNDRERNLYL-LEKLRGETN---------R 117

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F+SV+ LA+PDGH+E + G+++G ++  PRG+ GFGYDP+F P+G  R+  EMT EE
Sbjct: 118 RAKFVSVVILAYPDGHLETYRGEMTGQLLEGPRGENGFGYDPLFVPDGETRSLAEMTVEE 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCF 214
           K                 +SHR RA    
Sbjct: 178 KRA---------------ISHRGRALAAL 191


>gi|167644144|ref|YP_001681807.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Caulobacter sp. K31]
 gi|167346574|gb|ABZ69309.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caulobacter sp. K31]
          Length = 201

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 114/206 (55%), Gaps = 23/206 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V A+HN  K  E+ +L+        +A  L L  P+ET  +F  NA++K+  AA  +G
Sbjct: 10  KLVAATHNPGKAKELAALLDGR-FEVLAAGTLGLPEPDETEMTFVGNALLKARHAADLSG 68

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             AL+DDSGL +  LDG PGI+SARWA      +DF +AM K+   +    + D   R+A
Sbjct: 69  HIALADDSGLSVAALDGAPGIYSARWAGPT---KDFAVAMDKVAERVEEAGSED---RAA 122

Query: 128 HFISVLSLAWPDGH-VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F   L++AWP+G       G+V G + +PPRG  GFGYDPIF P G+D+TFGEM    K
Sbjct: 123 WFTCALAVAWPNGGPAVVVQGEVHGTLTFPPRGDRGFGYDPIFIPEGFDQTFGEMEPAAK 182

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
                          D +SHRA AF+
Sbjct: 183 ---------------DAMSHRAVAFE 193


>gi|51891482|ref|YP_074173.1| hypothetical protein STH344 [Symbiobacterium thermophilum IAM
           14863]
 gi|62900197|sp|Q67SL4|NTPA_SYMTH RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|51855171|dbj|BAD39329.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 197

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 117/213 (54%), Gaps = 32/213 (15%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAA 63
           +  +V+A+ N  K+ E  SL+   G        L+   PE  ETG++FEENA+IK+  A+
Sbjct: 3   QKRLVLATKNQGKVREFRSLLAGAGFEIVG---LDPDAPEVSETGDTFEENALIKARAAS 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
              G+PAL++DSG+V+D L G+PG+HSARW   +  +R           AL ++ A  PA
Sbjct: 60  ALTGLPALAEDSGIVVDALGGEPGVHSARWVPGSDEDRV---------RALLARMAEVPA 110

Query: 124 -FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A ++SV+++  P G  E F G++ G +   PRG  GFGYDPIF      RT  EM 
Sbjct: 111 ERRTARYVSVIAVVLPSGREELFRGELEGRLAEAPRGTGGFGYDPIFV-VADGRTVAEMA 169

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAF-KCF 214
            EEKNG               +SHR+RA  +C 
Sbjct: 170 LEEKNG---------------ISHRSRALARCL 187


>gi|310657898|ref|YP_003935619.1| nucleoside-triphosphatase [Clostridium sticklandii DSM 519]
 gi|308824676|emb|CBH20714.1| Nucleoside-triphosphatase [Clostridium sticklandii]
          Length = 443

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 124/210 (59%), Gaps = 25/210 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTAA 63
           +  +VIAS N  KI E+ S++   GI   S  ++ L  +  EETG++FEENA+IK+    
Sbjct: 246 KQEMVIASSNSHKIEEIGSILADFGIELLSLKDVGLEGLEIEETGSTFEENAIIKAKEVM 305

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDP 122
           K  G  A++DDSGL++DVL G+PG++SAR++ E  T E++     +K+   L+    +D 
Sbjct: 306 KLTGKAAIADDSGLMVDVLGGRPGVYSARFSGEGATDEKN----NEKLLGLLK---GYDL 358

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F+S +++ +PD       G   G+I +  +G +GFGYDP+F P+  D+TF ++T
Sbjct: 359 DSRTAKFVSAIAVVYPDSRQYIAKGICKGLIGFEGKGDMGFGYDPLFTPDALDKTFAQLT 418

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           +EEKN                +SHRA++ +
Sbjct: 419 KEEKNK---------------ISHRAKSLE 433


>gi|288573193|ref|ZP_06391550.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288568934|gb|EFC90491.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 197

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 114/209 (54%), Gaps = 26/209 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +VIAS N  K  E   L+ PL +      +++ +  EETG SF ENA +K+ + A+  
Sbjct: 4   RKMVIASGNRHKFEEFRDLLAPLEVELIFGRDISSLDVEETGTSFLENASLKARSWAEET 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G PAL+DDSG+ ++ LDG+PGI+SAR A  + G R++      +  +L+ K     + R 
Sbjct: 64  GFPALADDSGIEVNALDGRPGIYSARVASDDEGCRNW------LLKSLQGK-----SDRG 112

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A + + L LA+PDG + +  G   GI+   PRG  GFGYDPIF P GYD TFGE+    K
Sbjct: 113 ARYTAALVLAFPDGKLWSVEGHCYGIVAQEPRGFNGFGYDPIFVPEGYDMTFGELDPSIK 172

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFV 215
                            +SHRA+A   F+
Sbjct: 173 A---------------RISHRAKASASFL 186


>gi|259502882|ref|ZP_05745784.1| ribonuclease PH/Ham1 protein [Lactobacillus antri DSM 16041]
 gi|259169133|gb|EEW53628.1| ribonuclease PH/Ham1 protein [Lactobacillus antri DSM 16041]
          Length = 199

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 110/211 (52%), Gaps = 23/211 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +VIA++N  K  E   ++ P  +   +  +      +E G SFEENA IK+ TA    G
Sbjct: 4   TLVIATNNAGKAREYREMLAPFQVTVKTLADFPPFPIDEDGTSFEENAFIKAQTAVAKLG 63

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +P ++DDSGLV+D L+G PGIHSAR+A    G+ D      K+   LR       A R+A
Sbjct: 64  LPVMADDSGLVVDALNGAPGIHSARYA----GDHDDAANNAKL---LRELAGVPAAQRTA 116

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGY-DRTFGEMTEEEK 186
           HF + +    PDG     +G+V G I+  PRGQ GFGYDP+F P  +  R+  E+T  EK
Sbjct: 117 HFYTTIIALKPDGAKLETTGRVDGHILTEPRGQNGFGYDPLFMPEEFAGRSMAELTPAEK 176

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           N                +SHR RA +  +D 
Sbjct: 177 N---------------RISHRGRALRALMDQ 192


>gi|262038578|ref|ZP_06011947.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Leptotrichia goodfellowii F0264]
 gi|261747447|gb|EEY34917.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Leptotrichia goodfellowii F0264]
          Length = 196

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 118/214 (55%), Gaps = 26/214 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           I++A+ N  KI E + L   + I   S L+ N+  P+  E G +FEEN+  K+   AK  
Sbjct: 3   IILATKNEGKIKEFEKLTEGMNIEVLSILD-NIDFPDVVEDGKTFEENSAKKAKEIAKYT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+  +SDDSGL +D+L+G+PGI+S+R++ E+ T   + +  ++ + N  + K       R
Sbjct: 62  GITTVSDDSGLCVDILNGEPGIYSSRYSGENATDASNMEKLLKNLSNIQKEK-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            AHF+SV+S+A+PDG V++F G+  G I++   G  GFGYDPIF      ++FG    EE
Sbjct: 115 KAHFVSVVSIAFPDGSVKSFRGETEGEILFEKEGNNGFGYDPIFYSYDLKKSFGNAMPEE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           K                 +SHR RAF+      L
Sbjct: 175 KKS---------------VSHRGRAFQKLKKEVL 193


>gi|269837326|ref|YP_003319554.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sphaerobacter thermophilus DSM 20745]
 gi|269786589|gb|ACZ38732.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sphaerobacter thermophilus DSM 20745]
          Length = 228

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 74/182 (40%), Positives = 106/182 (58%), Gaps = 7/182 (3%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
           E  +V+AS+N  K+ E+  L +P  +   +A +  + +PEETG +F  NA++K+  A + 
Sbjct: 11  EVTVVLASNNPGKVDELRRL-LPEWVRILTASDAGVTLPEETGTTFAANALLKARAAVQQ 69

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  AL+DDSGL +D L G+PG+ SAR+A    GE   D A   +   L    A   A R
Sbjct: 70  TGHIALADDSGLEVDALGGEPGVRSARYA----GEPTDDAANNAL--LLERLRAVPSAER 123

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F S +++  P+G      G V G+I+  PRG  GFGYDP+FQP G DRT  E+  +E
Sbjct: 124 TARFRSAVAIVTPEGREHVAEGTVEGVILEQPRGSGGFGYDPLFQPAGSDRTMAELATDE 183

Query: 186 KN 187
           KN
Sbjct: 184 KN 185


>gi|291166728|gb|EFE28774.1| ribonuclease PH/Ham1 protein [Filifactor alocis ATCC 35896]
          Length = 471

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 118/207 (57%), Gaps = 23/207 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIM--PLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
           + V+A+ N  K+ E+  LI    + I++   + L  I   E G+SFEENA+IK+   AK 
Sbjct: 275 DFVLATSNPHKVEELQKLIRLKSVEILSLDDVGLKGIEIVEDGDSFEENALIKAREIAKR 334

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  A++DDSGL +D+L G+PGI+SAR+A    GE   D A    E  L     ++ + R
Sbjct: 335 TGKIAIADDSGLSVDILKGQPGIYSARFA----GEPTDDHANN--EKLLDRMKDYEESLR 388

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F+ V+++ +P+G  + F G   G I +  RG+ GFGYDP+F  +G D+T+ EMT++E
Sbjct: 389 LAKFVCVIAVVFPNGLEKTFKGITMGRIGFEYRGEHGFGYDPLFLVDGTDKTYAEMTQDE 448

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFK 212
           KN                +SHRARA K
Sbjct: 449 KN---------------RVSHRARALK 460


>gi|304320169|ref|YP_003853812.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Parvularcula bermudensis HTCC2503]
 gi|303299072|gb|ADM08671.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Parvularcula bermudensis HTCC2503]
          Length = 206

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 105/208 (50%), Gaps = 20/208 (9%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           L    +++A+HN  K+ E  + + P  I  +SA + +L  PEET   F  NA +K+  A 
Sbjct: 7   LRARGLLLATHNQGKVREFSAWLAPYAISISSAADHDLPEPEETATDFLGNATLKAEAAM 66

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
              G+PAL+DDSGL +  L G PG++SARWA  +   RD+  A  +I   L    A    
Sbjct: 67  AATGLPALADDSGLAVAALGGAPGLYSARWAGPD---RDYQRAFDRIAAELGGAQAM--E 121

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
             +A F+ VL L  P        G+V G +   PRG  GFGYDPIF+P G  RTF EMT 
Sbjct: 122 GAAAAFVCVLVLTLPGDTPLVAEGQVEGTLTASPRGAAGFGYDPIFRPEGEARTFAEMTM 181

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAF 211
            EK                  SHRARA 
Sbjct: 182 AEKA---------------QFSHRARAM 194


>gi|317495244|ref|ZP_07953614.1| Ham1 family protein [Gemella moribillum M424]
 gi|316914666|gb|EFV36142.1| Ham1 family protein [Gemella moribillum M424]
          Length = 194

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 119/207 (57%), Gaps = 26/207 (12%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           N+++AS+N  K+ E+  ++    I+T   +     I E+ G+SFEENA+IK+ T AK +G
Sbjct: 3   NLILASNNAHKVKEIKQILTGYNILTLKEVNFTEDIIED-GDSFEENALIKARTIAKYSG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             A++DDSGL +D L+G+PG++SAR++   T E++ +  + ++    +SK         A
Sbjct: 62  KAAIADDSGLSVDKLNGRPGVYSARYSPEQTDEKNIEKVLTELAGE-QSK---------A 111

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+SV+++  P+G    F G+  G I++  RG  GFGYDPIF     ++TF E++ +EKN
Sbjct: 112 KFVSVIAMVTPEGDEFTFRGECEGEIIFEKRGTNGFGYDPIFYVPELNKTFAEISSDEKN 171

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCF 214
                           +SHR ++ + F
Sbjct: 172 A---------------ISHRKKSLEKF 183


>gi|256832125|ref|YP_003160852.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Jonesia
           denitrificans DSM 20603]
 gi|256685656|gb|ACV08549.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Jonesia
           denitrificans DSM 20603]
          Length = 210

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 118/217 (54%), Gaps = 34/217 (15%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIM-------TTSALELNLIIPEETGNSFEENAMIKSLT 61
           IV+A+HN  K+ E+ +++     +         SA   ++  P E   +FE+NA+IK+  
Sbjct: 5   IVLATHNDHKVRELAAILAAEPALAFLKDGAVVSASAFDVTPPVEDAVTFEDNALIKARV 64

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAH 120
            A+  G+ A++DDSGL +DVL G PGI SARWA  +  ++ + D+ ++++E+        
Sbjct: 65  LAQETGLVAIADDSGLAVDVLGGAPGIFSARWAGGHGDDQGNLDLLLRQLEDVPTEH--- 121

Query: 121 DPAFRSAHFISVLSLAWPDG--HVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
               RSA F+   +L  P+G  HVE   G + G ++  PRG+ GFGYDPI  P GYDR+ 
Sbjct: 122 ----RSARFVCAAALVTPNGDEHVER--GTLEGTLLTAPRGEGGFGYDPILLPLGYDRSC 175

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            E++ EEKN                +SHR  AF+  V
Sbjct: 176 AELSAEEKNA---------------ISHRGNAFRALV 197


>gi|290967729|ref|ZP_06559284.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Megasphaera genomosp. type_1 str. 28L]
 gi|290782245|gb|EFD94818.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Megasphaera genomosp. type_1 str. 28L]
          Length = 195

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 110/201 (54%), Gaps = 16/201 (7%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL--NLIIPEETGNSFEENAMIKSLTAAK 64
             +V+A+HN  KI E+ +++ P G    +  E+   L  PEETG +F ENA +KS   AK
Sbjct: 2   RQLVLATHNAGKIRELRTMLSPAGYEVVAVREVLPTLKEPEETGQTFLENARLKSQYYAK 61

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA-LRSKFAH-DP 122
             G P L+DDSGL ++ L G+PG++SAR+A    G    D A     NA L ++  H  P
Sbjct: 62  ATGRPCLADDSGLCVEALQGRPGVYSARYA----GIHGDDAA----NNAKLLTEIRHLPP 113

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           A R+A++  VL L++PDG      GK  G+I+  P G  GFGYDP F      +T  E+T
Sbjct: 114 AMRTAYYACVLVLSFPDGREIVAEGKCHGMIIETPVGTNGFGYDPYFYLPQKGKTMAELT 173

Query: 183 EEEKNG----GIDSATLFSIL 199
             EKN     GI    L  +L
Sbjct: 174 AIEKNTCSHRGIALKKLLQVL 194


>gi|313903086|ref|ZP_07836480.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermaerobacter subterraneus DSM 13965]
 gi|313466588|gb|EFR62108.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermaerobacter subterraneus DSM 13965]
          Length = 221

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 117/214 (54%), Gaps = 30/214 (14%)

Query: 8   NIVIASHNVDKIHEMDSLI----MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
            +V+A+HN  K+ E++ L+    +P+ ++T   +   + +PEETG++F ENA +K+   A
Sbjct: 19  RLVLATHNPGKVRELEELLEAAKLPVQVLTLDQVG-PVRLPEETGSTFLENARLKAEAVA 77

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA-LRSKFAH-D 121
           + AG+PAL+DDSGL +D L G+PG+HSAR+A           A     NA L ++ A   
Sbjct: 78  RQAGLPALADDSGLCVDALGGRPGVHSARFAGPG--------ATDAANNARLLAELAGVP 129

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           PA R+A F  V+ LA P G      G+  G I+  PRGQ GFGYDP+F  +    TF E 
Sbjct: 130 PARRTARFRCVVVLALPGGRWTWAEGEAPGRILEAPRGQGGFGYDPLFYSDELGMTFAEA 189

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
             E KN                +SHR+RA +  +
Sbjct: 190 GAEAKN---------------RVSHRSRALRALL 208


>gi|289422671|ref|ZP_06424511.1| tRNA nucleotidyltransferase [Peptostreptococcus anaerobius 653-L]
 gi|289156850|gb|EFD05475.1| tRNA nucleotidyltransferase [Peptostreptococcus anaerobius 653-L]
          Length = 475

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 118/215 (54%), Gaps = 25/215 (11%)

Query: 10  VIASHNVDKIHEMDSLIMPL--GIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           VIA+ N+ K+ E+ +++  L   I++   ++L  +   E G +FE NA+IK+ T AK  G
Sbjct: 277 VIATGNMHKLEEIKTMLSDLDFKILSMKDVDLEGLEIIENGRTFEHNALIKARTIAKKTG 336

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           M A+ DDSG+ +D LD +PGI+SAR+A E+ T E + +   +++E     K       R+
Sbjct: 337 MIAIGDDSGIEVDALDKRPGIYSARYAGENATDEDNRNKMFEELEGVPMDK-------RT 389

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+ V++L +PDG      GKV G I     G  GFGYD +F P GYD TFG ++ E K
Sbjct: 390 ARFVCVIALVFPDGKEILARGKVEGKIAIKTSGDNGFGYDSMFIPEGYDETFGVLSPEIK 449

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           N                 SHR+RA +   D  ++I
Sbjct: 450 NS---------------FSHRSRALEIMKDKLIKI 469


>gi|302545023|ref|ZP_07297365.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Streptomyces hygroscopicus ATCC 53653]
 gi|302462641|gb|EFL25734.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Streptomyces himastatinicus ATCC 53653]
          Length = 213

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 118/219 (53%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ S      I+  + L++ L+       +P+  ETG SF ENA++
Sbjct: 15  RRLILATRNAYKITELRS------ILGEAGLDVELVGADAYPEVPDVKETGVSFAENALL 68

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRS 116
           K+   A+  G PA++DDSGL +DVL G PGI SARW+ S+  +R + D+ + ++ +    
Sbjct: 69  KAHALAQATGHPAIADDSGLCVDVLGGAPGIFSARWSGSHGDDRANLDLLLAQLRDVPDE 128

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
                   R+AHF    +LA PDG     SG+++G +   P G  GFGYDPI QP+G  R
Sbjct: 129 -------HRTAHFECAAALALPDGTERVVSGRLTGTLRHEPTGGGGFGYDPILQPHGDTR 181

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T +EKN                +SHR +AF+   
Sbjct: 182 TCAELTPDEKNA---------------ISHRGQAFRAMA 205


>gi|269795789|ref|YP_003315244.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sanguibacter keddieii DSM 10542]
 gi|269097974|gb|ACZ22410.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sanguibacter keddieii DSM 10542]
          Length = 207

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 115/219 (52%), Gaps = 30/219 (13%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIM-------TTSALELNLIIPEETGNSFEENAM 56
           + +  +V+A+HN  K+ E+ ++++  G +          A     + P E G +FE NA+
Sbjct: 1   MTDPRLVLATHNDHKVGELRAILLADGTVPGLLPDEVVGAARFTDVEPVEDGVTFEANAL 60

Query: 57  IKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALR 115
           IK+   A  +G+PA++DDSGL +DVL G PGI SARWA  +  ++ + D+ + ++ +   
Sbjct: 61  IKARALAAVSGLPAVADDSGLAVDVLGGAPGIFSARWAGRHGDDQANLDLLLAQLGDIA- 119

Query: 116 SKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYD 175
                 P  R A F+   +L  PDG      G++ G ++  PRG  GFGYDPI QP+G  
Sbjct: 120 ------PEHRRARFVCAAALVTPDGVEHVVRGELVGTLLTAPRGAGGFGYDPILQPDGET 173

Query: 176 RTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
           R+  E+T  EKN                +SHR +AF+  
Sbjct: 174 RSCAELTAAEKNA---------------ISHRGQAFRAL 197


>gi|15805215|ref|NP_293903.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Deinococcus radiodurans R1]
 gi|22653783|sp|Q9RXX6|NTPA_DEIRA RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|6457848|gb|AAF09767.1|AE001880_4 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 200

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 72/176 (40%), Positives = 108/176 (61%), Gaps = 11/176 (6%)

Query: 12  ASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPAL 71
           A+ N  K+ E+   + PLG        + L  PEETG+++EENA +K+  AA   G+PAL
Sbjct: 18  ATSNAGKVRELQGALAPLGWQCEGLGAVTL--PEETGSTYEENAALKACAAAMATGLPAL 75

Query: 72  SDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFIS 131
           +DDSG+ +  L G+PG++SAR+   N+   D +  +  +E   R         R A F+S
Sbjct: 76  ADDSGIEVLALGGQPGVYSARFGNVNS---DVERNVLLLEKMRRH------TDRRAKFVS 126

Query: 132 VLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           VL LA+PDG +E + G+V+G ++  PRG+ GFGYDP+F P+G + + GEMT E+K 
Sbjct: 127 VLVLAYPDGKLEEYRGEVTGQLLEGPRGESGFGYDPLFLPDGSELSMGEMTLEQKQ 182


>gi|295836836|ref|ZP_06823769.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Streptomyces sp. SPB74]
 gi|197697481|gb|EDY44414.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Streptomyces sp. SPB74]
          Length = 200

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 114/218 (52%), Gaps = 36/218 (16%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
           + +++A+ N  K+ E+ +      I++ + L   L+       IP+  ETG +F ENA++
Sbjct: 2   SRLILATRNAGKVTELHA------ILSEAGLGHELVGADAYPEIPDVKETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSK 117
           K+   A+  G+PA++DDSGL +DVL+G PGI SARWA    G    D A   +  A  S 
Sbjct: 56  KAHALARATGLPAVADDSGLCVDVLNGAPGIFSARWA----GRHGDDEANLNLLLAQLSD 111

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
            A  P  R+A F+   +LA PDG      G + G +   P G  GFGYDP+ QP G DRT
Sbjct: 112 IA--PEHRAAGFVCAAALALPDGTERVVEGHLRGTLRLEPAGTNGFGYDPVLQPEGLDRT 169

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
             E+T  EKN                +SHR +AF+  V
Sbjct: 170 CAELTPAEKNA---------------ISHRGKAFRALV 192


>gi|290960060|ref|YP_003491242.1| HAM1-like protein [Streptomyces scabiei 87.22]
 gi|260649586|emb|CBG72701.1| HAM1 protein homolog [Streptomyces scabiei 87.22]
          Length = 200

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 116/219 (52%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ NV K+ E+ +      I+  + L  +L+       IP+  ETG +F ENA++
Sbjct: 2   TRLILATRNVGKLTELKA------ILADAGLAHDLVGADAYPDIPDVRETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRS 116
           K+   A+  G PA++DDSGL +DVL+G PGI SARWA  +  ++ + D+ + ++ +    
Sbjct: 56  KAHALARATGYPAIADDSGLCVDVLNGAPGIFSARWAGRHGDDKANLDLLLAQLGDIADE 115

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
                   R AHF    +LA PDG      G++ G +   P G  GFGYDPI QP+G  R
Sbjct: 116 H-------RGAHFNCAAALALPDGTERVVEGQLRGTLRHAPTGTGGFGYDPILQPDGDTR 168

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T EEKN                +SHR +AF+  V
Sbjct: 169 TCAELTAEEKNA---------------ISHRGKAFRGLV 192


>gi|159897479|ref|YP_001543726.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Herpetosiphon aurantiacus ATCC 23779]
 gi|159890518|gb|ABX03598.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Herpetosiphon aurantiacus ATCC 23779]
          Length = 199

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 110/185 (59%), Gaps = 12/185 (6%)

Query: 7   NNIVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
             ++I S+N  K+ E+ ++   +P  ++T +   ++  + EETG +F ENA +K+ T A+
Sbjct: 2   QKLLIGSNNAHKVGELRAIFSGLPFELLTLADAGIDYEV-EETGTTFVENARLKAETYAQ 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWA--ESNTGERDFDMAMQKIENALRSKFAHDP 122
            +G+P L+DDSGL +  LDGKPGI++ARWA  + N   R +   +++    L+ K  HD 
Sbjct: 61  ISGLPTLADDSGLEVAALDGKPGIYTARWALPDLNNPHRAYARVLEE----LKGKPFHD- 115

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F+ V+++AWP    E   G + G+I   PRG  GFGYDP+F    YD+   E+ 
Sbjct: 116 --RIARFVCVIAIAWPGQPTEVVEGILPGVIAEEPRGVGGFGYDPVFYLLDYDKHLAELD 173

Query: 183 EEEKN 187
            EEKN
Sbjct: 174 PEEKN 178


>gi|295695310|ref|YP_003588548.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bacillus tusciae DSM 2912]
 gi|295410912|gb|ADG05404.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bacillus tusciae DSM 2912]
          Length = 207

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 114/219 (52%), Gaps = 25/219 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLG--IMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            +V+A+HN  K+ E   ++ PLG  +   SA     + P ETG +F ENA+IK+  AA+ 
Sbjct: 3   TVVLATHNKGKVREFREMLRPLGWDVFPLSAFP-GYVPPPETGATFCENALIKARDAAER 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            G+PAL+DDSGL ++ L+G+PG+ SAR+A    T E +  + + ++E       +  P  
Sbjct: 62  LGLPALADDSGLEVEALEGRPGVFSARFAGPGATDEENNRLLLAELER------SPAPPP 115

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
            +A F+  L+   P G    F G+  G I+  PRG  GFGYDP+F      +TFGE   E
Sbjct: 116 WAARFVCCLAWVEPSGETHTFHGETRGWILAQPRGSGGFGYDPLFWSPELQQTFGEAPPE 175

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
            KN                +SHR RA +  V    R ++
Sbjct: 176 AKN---------------RVSHRKRALEALVQALSRPEK 199


>gi|146296020|ref|YP_001179791.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145409596|gb|ABP66600.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 204

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 115/215 (53%), Gaps = 31/215 (14%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLG--IMTTSALELNLIIPEETGNSFEENAMIK 58
           MRKL+     +A+ N  K  E+  LI      I+T S  + N+ I E+ G +FEENA+ K
Sbjct: 1   MRKLL-----VATKNRGKAKEIKELIGDFFDIILTLSDFDENINIIED-GKTFEENALKK 54

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESN-TGERDFDMAMQKIENALRSK 117
           S T      +P L+DDSGL +D LDG+PG++SAR+A  N T E      +++++N    K
Sbjct: 55  SKTIYSLYKLPTLADDSGLEVDALDGRPGVYSARYAGDNATDEEKIKKLLEELKNIPEEK 114

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                  R A F+ VL+    +G +    G   G I + P+G  GFGYDPIF P GY+ T
Sbjct: 115 -------RGAQFVCVLTFIDENGRMYQTRGVCRGKIGFAPKGLNGFGYDPIFIPEGYNAT 167

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           F E+  +EKN                +SHRARAF+
Sbjct: 168 FAELESDEKN---------------RISHRARAFE 187


>gi|317123034|ref|YP_004103037.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermaerobacter marianensis DSM 12885]
 gi|315593014|gb|ADU52310.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermaerobacter marianensis DSM 12885]
          Length = 238

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 120/213 (56%), Gaps = 28/213 (13%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGI-MTTSALEL--NLIIPEETGNSFEENAMIKSLTAAK 64
           ++V+A+HN  K+ E+++L+   G+ +  + L+   ++ +PEETG++F ENA +K+   A+
Sbjct: 36  DLVLATHNRGKVRELENLLAEAGLALRVATLDRFPHVALPEETGSTFLENARLKAEAVAR 95

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA-LRSKFAHDPA 123
             G+PAL+DDSGL +D L G+PG++SAR+A  +        A     NA L  + A  PA
Sbjct: 96  QTGLPALADDSGLCVDALGGRPGVYSARFAGPD--------ANDAANNARLLRELAGVPA 147

Query: 124 -FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             RSA F SV+ LA PDG     +G+  G I+  PRG  GFGYDP+F  +    TF E  
Sbjct: 148 ERRSARFRSVVVLALPDGRWTWAAGEARGRILEAPRGAGGFGYDPLFYSDELGMTFAEAG 207

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            + KN                +SHRARA +  +
Sbjct: 208 LDAKNA---------------VSHRARALRALL 225


>gi|188586563|ref|YP_001918108.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|226737268|sp|B2A6I7|NTPA_NATTJ RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|179351250|gb|ACB85520.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 201

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 117/211 (55%), Gaps = 24/211 (11%)

Query: 9   IVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           +V+AS N  K++E+ +L+   P+ I + S    N+   +ETG +F ENA+IK+   A + 
Sbjct: 3   LVLASGNQGKLNELKALLSKQPVEIYSMSDFN-NIKEAQETGKTFAENAIIKAQNVADST 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G  +L+DDSGL +D LDG PG++SAR+A  N  ++D +  +      LRS        R+
Sbjct: 62  GYLSLADDSGLEVDALDGAPGVYSARYAGENACDQDNNNKL------LRSLKDIPYKQRT 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F  V+++A+PD     F+G   G I+  P+G  GFGYDP+F      +TFGE+ +EEK
Sbjct: 116 ARFKCVIAIAYPDTPPVTFTGTCEGYILREPKGDRGFGYDPLFYHPDMGKTFGELYQEEK 175

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           +                +SHR +A +  V N
Sbjct: 176 SS---------------ISHRGKALEKLVAN 191


>gi|225621292|ref|YP_002722550.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brachyspira hyodysenteriae WA1]
 gi|225216112|gb|ACN84846.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brachyspira hyodysenteriae WA1]
          Length = 197

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 115/205 (56%), Gaps = 27/205 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           +VIA+ N  K+ E++SL    G +    L +   I E  E G++F EN++IK+ T   + 
Sbjct: 5   LVIATANKHKLKEIESLFK--GTVIKEILSMPSDIGEIIEDGSTFIENSLIKAKTVYNHT 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +P+L+DDSGL ++ L GKPGI+SAR+   N G ++    MQ + + L+     D   R+
Sbjct: 63  KLPSLADDSGLCVNALGGKPGIYSARYGGENLGYKE---KMQMLLDELK-----DKKDRT 114

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A+FI+       D +     G+V+G I+  PRG  GFGYDPIFQP+GY+ T+ EM+ EEK
Sbjct: 115 AYFITSAVCVLDDNYYIAVEGRVNGKIIENPRGFDGFGYDPIFQPDGYNVTYAEMSLEEK 174

Query: 187 NGGIDSATLFSILSTDLLSHRARAF 211
           N                +SHRA A 
Sbjct: 175 NS---------------MSHRALAM 184


>gi|255994312|ref|ZP_05427447.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Eubacterium saphenum ATCC 49989]
 gi|255993025|gb|EEU03114.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Eubacterium saphenum ATCC 49989]
          Length = 198

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 112/208 (53%), Gaps = 23/208 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTAAKNA 66
           +V+AS N  KI E+  ++ PLGI+ T+  E     +  EETG++F EN+ IK+       
Sbjct: 3   VVLASGNAHKIKEIKEILSPLGIVITTLSENGYPDLDIEETGSTFSENSKIKAEAVHDLL 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G  AL+DDSGL +D LDG PG+ SAR+A  +   +D D   +K+   L  K   + A R 
Sbjct: 63  GKAALADDSGLCVDALDGAPGVFSARYAGVD---KDDDRNNKKLLAELSKK---EGASRK 116

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           AH+  VL+L   +G     SGK  G I +   G  GFGYDP+F P+G+D+TF E+   +K
Sbjct: 117 AHYECVLTLITDEGSEVVVSGKCHGTIGYSEVGDNGFGYDPLFIPDGFDKTFAELEPSQK 176

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCF 214
           N                +SHR RA +  
Sbjct: 177 NA---------------ISHRRRALEAL 189


>gi|300871933|ref|YP_003786806.1| non-canonical purine NTP pyrophosphatase [Brachyspira pilosicoli
           95/1000]
 gi|300689634|gb|ADK32305.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brachyspira pilosicoli 95/1000]
          Length = 199

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 119/210 (56%), Gaps = 36/210 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE------ETGNSFEENAMIKSL 60
           N +VIA+ N  K+ E+ +      I   SA E+ L +P       E GNSF EN++IK+ 
Sbjct: 3   NKLVIATANKHKLIEIQN------IFKDSAKEI-LPMPSDIGEIIEDGNSFIENSLIKAK 55

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
               +  +P+L+DDSG+ I+ L+G+PGI+SAR+   N G ++    MQ I + L++K  +
Sbjct: 56  AVYNHTKLPSLADDSGICINALNGEPGIYSARYGGENLGYKE---KMQMILDKLKNK--N 110

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           D   R+A+FI+       D +     G V+G+IV  P+G  GFGYDPIF+PNGYD T+ E
Sbjct: 111 D---RTAYFITSAVCVLDDNYYIALEGIVNGVIVESPKGFDGFGYDPIFKPNGYDITYAE 167

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARA 210
           MT E+KN                +SHRA A
Sbjct: 168 MTLEQKNS---------------MSHRAIA 182


>gi|111220955|ref|YP_711749.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Frankia
           alni ACN14a]
 gi|123044767|sp|Q0RQL6|NTPA_FRAAA RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|111148487|emb|CAJ60158.1| conserved hypothetical protein; putative HAM1 domain [Frankia alni
           ACN14a]
          Length = 202

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 110/213 (51%), Gaps = 32/213 (15%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPE-----ETGNSFEENAMIKSLT 61
            +V+AS N  K+ E+        I+  S L + L+ +P+     ETG +F ENA+IK+  
Sbjct: 2   RVVLASRNEAKLTELRR------ILAASGLSVELVALPDGEEVAETGTTFAENALIKARA 55

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA   G+PA++DDSGL +D L G PG+ SARW+    G R   +   +  NAL      D
Sbjct: 56  AADQTGLPAVADDSGLAVDELSGMPGVRSARWSGRRDGTR---VERDEANNALLLAQLDD 112

Query: 122 --PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
             P  R A F+   +L  P G      G++ G+++  PRGQ GFGYDP+F  +G  RT  
Sbjct: 113 VPPERRGAAFVCAAALVTPAGVERVTHGELRGVLLTEPRGQAGFGYDPLFLADGQTRTNA 172

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           E+T  EK               D +SHR  AF+
Sbjct: 173 ELTAAEK---------------DAISHRGLAFR 190


>gi|16079888|ref|NP_390714.1| nucleoside-triphosphatase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|22653751|sp|P94558|NTPA_BACSU RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|1770060|emb|CAA99555.1| hypothetical protein [Bacillus subtilis]
 gi|2635301|emb|CAB14796.1| inosine/xanthosine triphosphate pyrophosphatase (subunit A)
           [Bacillus subtilis subsp. subtilis str. 168]
          Length = 198

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 108/210 (51%), Gaps = 22/210 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTA 62
           +I    +IA+HN  K+ E   ++ P G    S  E+      EETG++FEENA++K+   
Sbjct: 2   IIMKEAIIATHNPGKVKEFKEILEPRGYDVKSLAEIGFTEEIEETGHTFEENAIMKAEAV 61

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           AK      ++DDSGL ID L G+PG++SAR+A    GE+  D A   IE  L      + 
Sbjct: 62  AKAVNKMVIADDSGLSIDNLGGRPGVYSARYA----GEQKDDQA--NIEKVLSELKGIEK 115

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F   L+++ P    +   G V G I   PRG+ GFGYDPIF     D+T  E+T
Sbjct: 116 EQRTARFRCALAVSIPGEETKTVEGHVEGYIAEEPRGEYGFGYDPIFIVKDKDKTMAELT 175

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHRA A K
Sbjct: 176 SDEKNK---------------ISHRADALK 190


>gi|304440366|ref|ZP_07400255.1| ribonuclease PH/Ham1 protein [Peptoniphilus duerdenii ATCC
           BAA-1640]
 gi|304371118|gb|EFM24735.1| ribonuclease PH/Ham1 protein [Peptoniphilus duerdenii ATCC
           BAA-1640]
          Length = 435

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 112/184 (60%), Gaps = 12/184 (6%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTAAK 64
           N +V+++ NV KI EM+S++  + ++  S  ++ L  +  +E   + E NA  K+   +K
Sbjct: 238 NYLVLSTDNVHKIKEMESILSDIDLIVESKSDVGLQDLQVDEDQETLEGNARKKAEEISK 297

Query: 65  NAGMP-ALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
             G    +SDD+GL ++ L+G+PG+HSAR+   +  +++ +  ++K++         D  
Sbjct: 298 LVGYKNVISDDTGLFVNALNGEPGVHSARYCGDHDDKKNIEKILEKLQ---------DKE 348

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            RSA+F + ++L  P   ++ FSG++ G I +  RG+ GFGYD +F PNGYD+TF E+ E
Sbjct: 349 DRSAYFQTSIALVEPSKEIKLFSGRIDGTIAYEERGEEGFGYDSVFIPNGYDKTFAELGE 408

Query: 184 EEKN 187
           EEKN
Sbjct: 409 EEKN 412


>gi|321312369|ref|YP_004204656.1| nucleoside-triphosphatase [Bacillus subtilis BSn5]
 gi|291485266|dbj|BAI86341.1| hypothetical protein BSNT_04138 [Bacillus subtilis subsp. natto
           BEST195]
 gi|320018643|gb|ADV93629.1| nucleoside-triphosphatase [Bacillus subtilis BSn5]
          Length = 195

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 106/204 (51%), Gaps = 22/204 (10%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAGM 68
           +IA+HN  K+ E   ++ P G    S  E+      EETG++FEENA++K+   AK    
Sbjct: 5   IIATHNPGKVKEFKEILEPRGYDVKSLAEIGFTEEIEETGHTFEENAILKAEAVAKAVNK 64

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
             ++DDSGL ID L G+PG++SAR+A    GE+  D A   IE  L      +   R+A 
Sbjct: 65  MVIADDSGLSIDNLGGRPGVYSARYA----GEQKDDQA--NIEKVLSELKGIEKEQRTAR 118

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F   L+++ P    +   G V G I   PRG+ GFGYDPIF     D+T  E+T +EKN 
Sbjct: 119 FRCALAVSIPGEETKTVEGHVEGYIAEEPRGEYGFGYDPIFIVKDKDKTMAELTSDEKNK 178

Query: 189 GIDSATLFSILSTDLLSHRARAFK 212
                          +SHRA A K
Sbjct: 179 ---------------ISHRADALK 187


>gi|229824722|ref|ZP_04450791.1| hypothetical protein GCWU000182_00070 [Abiotrophia defectiva ATCC
           49176]
 gi|229791051|gb|EEP27165.1| hypothetical protein GCWU000182_00070 [Abiotrophia defectiva ATCC
           49176]
          Length = 196

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/206 (36%), Positives = 112/206 (54%), Gaps = 22/206 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
           + IV A+ N  KI E+  ++    +   S  E+N+    EE G +FEEN++IK+   +K 
Sbjct: 2   DKIVFATTNAGKIKEIKEILSDFDVEVVSMKEMNITADIEENGATFEENSLIKARAVSKL 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PAL+DDSGL +D L+G+PGI+SAR+   +T   D+D     I + L+     +   R
Sbjct: 62  TGLPALADDSGLEVDYLNGEPGIYSARYLGRDT---DYDYKNNYIIDKLKEAKGEE---R 115

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           SA F+ V+SL  PDG      G + G I +  +G+ GFGYDPIF    Y +T  E++ EE
Sbjct: 116 SARFVCVISLVLPDGREFVKKGVMEGRIGYEIKGENGFGYDPIFFLPEYGKTSAEISAEE 175

Query: 186 KNGGIDSATLFSILSTDLLSHRARAF 211
           KN                +SHR +A 
Sbjct: 176 KNK---------------ISHRGKAL 186


>gi|256396653|ref|YP_003118217.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Catenulispora acidiphila DSM 44928]
 gi|256362879|gb|ACU76376.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Catenulispora acidiphila DSM 44928]
          Length = 205

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 113/221 (51%), Gaps = 34/221 (15%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGI--MTTSALELNLIIPE--ETGNSFEENAMIKSLTA 62
             IV+A+ N  KI E+  +++  G+  +  +  EL   +P+  ETG +F  NA+IK+   
Sbjct: 2   RQIVLATRNAKKITELQRILLAAGLTDVELAGPELYAALPDIPETGLTFAANALIKARAV 61

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWA------ESNTGE--RDFDMAMQKIENAL 114
           A   G+PA++DDSGL +D L+G PGI SARW+       S  G    +  + + ++ +  
Sbjct: 62  AAATGLPAVADDSGLCVDALNGMPGILSARWSGRFGDLPSGPGRDVANLQLVLDQVGDVP 121

Query: 115 RSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGY 174
                       A+F    +L  PDG      G V+G +V  PRG+ GFGYDP+F P G 
Sbjct: 122 EESL-------GANFTCAAALVTPDGAEHVVEGVVTGRLVRAPRGEGGFGYDPVFVPEGE 174

Query: 175 DRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            RT  E++ EEK               D +SHR+RAF+  V
Sbjct: 175 TRTTAELSAEEK---------------DAISHRSRAFRALV 200


>gi|297160098|gb|ADI09810.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Streptomyces bingchenggensis BCW-1]
          Length = 200

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 116/219 (52%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ S      I++ + L++ L+       IP+  ETG +F ENA +
Sbjct: 2   KRLILATRNTYKIVELRS------ILSDAGLDVELVGADAYPEIPDVKETGVTFAENAFL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSK 117
           K+   A+  G PA++DDSGL +DVL G PGI SARW    +G    D A  ++   L ++
Sbjct: 56  KAHALARATGHPAVADDSGLCVDVLGGAPGIFSARW----SGRHGDDRANLEL---LLAQ 108

Query: 118 FAHDP-AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
            A  P   R+AHF    +LA PDG     +G++ G +   P G  GFGYDPI QP+G  R
Sbjct: 109 LADVPDEHRAAHFECAAALALPDGTERVVTGRLPGTLRREPVGGGGFGYDPILQPDGETR 168

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T EEKN                +SHR +AF+   
Sbjct: 169 TCAELTPEEKNA---------------ISHRGKAFRALA 192


>gi|221310777|ref|ZP_03592624.1| hypothetical protein Bsubs1_15491 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315102|ref|ZP_03596907.1| hypothetical protein BsubsN3_15397 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320020|ref|ZP_03601314.1| hypothetical protein BsubsJ_15303 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324303|ref|ZP_03605597.1| hypothetical protein BsubsS_15457 [Bacillus subtilis subsp.
           subtilis str. SMY]
          Length = 195

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 106/204 (51%), Gaps = 22/204 (10%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAGM 68
           +IA+HN  K+ E   ++ P G    S  E+      EETG++FEENA++K+   AK    
Sbjct: 5   IIATHNPGKVKEFKEILEPRGYDVKSLAEIGFTEEIEETGHTFEENAIMKAEAVAKAVNK 64

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
             ++DDSGL ID L G+PG++SAR+A    GE+  D A   IE  L      +   R+A 
Sbjct: 65  MVIADDSGLSIDNLGGRPGVYSARYA----GEQKDDQA--NIEKVLSELKGIEKEQRTAR 118

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F   L+++ P    +   G V G I   PRG+ GFGYDPIF     D+T  E+T +EKN 
Sbjct: 119 FRCALAVSIPGEETKTVEGHVEGYIAEEPRGEYGFGYDPIFIVKDKDKTMAELTSDEKNK 178

Query: 189 GIDSATLFSILSTDLLSHRARAFK 212
                          +SHRA A K
Sbjct: 179 ---------------ISHRADALK 187


>gi|241889994|ref|ZP_04777292.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Gemella
           haemolysans ATCC 10379]
 gi|241863616|gb|EER68000.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Gemella
           haemolysans ATCC 10379]
          Length = 194

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 115/206 (55%), Gaps = 26/206 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +++AS+N  K+ E+ S++    I+T   +     I E+ G +FEENA+IK+ T +K +G 
Sbjct: 4   LILASNNAHKVEEIKSILSDYNILTLKDINFTDEIIED-GLTFEENALIKARTISKYSGK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
            A++DDSGL +++L+G+PG++SAR+++  T  ++ +  + ++          D     A 
Sbjct: 63  TAIADDSGLSVELLEGRPGVYSARYSKEQTDAKNIEKVLSEL----------DGKKSKAK 112

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F+SV++L  PDG    F G+  G I+   RG  GFGYDPIF     ++TF E++ +EKN 
Sbjct: 113 FVSVIALVKPDGTELTFRGECHGEIISEQRGNNGFGYDPIFYVPSLEKTFAELSSDEKNS 172

Query: 189 GIDSATLFSILSTDLLSHRARAFKCF 214
                          +SHR  + + F
Sbjct: 173 ---------------ISHRKESLEKF 183


>gi|52081337|ref|YP_080128.1| nucleoside-triphosphatase [Bacillus licheniformis ATCC 14580]
 gi|52786715|ref|YP_092544.1| YsnA [Bacillus licheniformis ATCC 14580]
 gi|319647245|ref|ZP_08001467.1| nucleoside-triphosphatase [Bacillus sp. BT1B_CT2]
 gi|62900190|sp|Q65GG3|NTPA_BACLD RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|52004548|gb|AAU24490.1| conserved protein YsnA [Bacillus licheniformis ATCC 14580]
 gi|52349217|gb|AAU41851.1| YsnA [Bacillus licheniformis ATCC 14580]
 gi|317390592|gb|EFV71397.1| nucleoside-triphosphatase [Bacillus sp. BT1B_CT2]
          Length = 196

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 107/208 (51%), Gaps = 24/208 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             ++IA+ N  K+ E  +++ P G    S L++      EETG +FEENA+IK+ T +K 
Sbjct: 2   KEVIIATKNEGKVREFKAMLEPRGYDVKSLLDIGYTPEIEETGQTFEENAVIKAETISKE 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAF 124
            G   ++DDSGL +D L G PG++SAR+A    GE   D+A ++K+   L      D   
Sbjct: 62  TGKIVIADDSGLSVDYLGGSPGVYSARYA----GEEKNDLANLKKLLKELEGVEKED--- 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           RSA F   L++  P    +   G V G I   PRG  GFGYDP+F     D+T  E++  
Sbjct: 115 RSARFRCALAICIPGQETKTVEGSVEGYITEEPRGTNGFGYDPVFLVKDKDQTMAELSSG 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
           EKN                +SHRA A K
Sbjct: 175 EKNK---------------ISHRAEALK 187


>gi|269123879|ref|YP_003306456.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Streptobacillus moniliformis DSM 12112]
 gi|268315205|gb|ACZ01579.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Streptobacillus moniliformis DSM 12112]
          Length = 193

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 105/204 (51%), Gaps = 22/204 (10%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IV+A+ N  K+ E  S+   L I   S  E N+    E G +FEEN++IK+   ++ +G+
Sbjct: 3   IVLATKNEGKLEEFRSMFKDLNIEILSEKEFNVGEIVEDGLTFEENSLIKAKAVSEISGL 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
           PA+SDDSGL ID LDGKPG+H+ARW   N  E   D   + IE   +         R A 
Sbjct: 63  PAISDDSGLCIDALDGKPGVHTARWF--NEFENYNDRCKKMIELVDKKN-----TNRDAK 115

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           FISV++L +P+G    F G+  G I    +G LG GYDPIF        F E   E KN 
Sbjct: 116 FISVITLYFPNGEKYIFRGETEGSISHELKGNLGHGYDPIFYSKDLKMNFAEAGTELKN- 174

Query: 189 GIDSATLFSILSTDLLSHRARAFK 212
                          +SHR RAFK
Sbjct: 175 --------------TVSHRGRAFK 184


>gi|78043192|ref|YP_359185.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Carboxydothermus hydrogenoformans Z-2901]
 gi|77995307|gb|ABB14206.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 202

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 113/208 (54%), Gaps = 24/208 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLTAAK 64
             IVIAS N  KI E  +L+  LG    S L+   I  IPE+ G +FE+NA  K++T + 
Sbjct: 2   QRIVIASKNQGKIKEFSALLSSLGFSFVSLLDFPEIGEIPEK-GTTFEDNARQKAVTVSN 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PAL+DDSGLV+D L G+PG+ SAR+A    GE   D  ++ I+  L+         
Sbjct: 61  FTGLPALADDSGLVVDALGGRPGVFSARYA----GEPKDD--LKNIQKLLKELEGVPWEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F++VL L +PDG +    G+  G I+   RG  GFGYDP+F    Y +T  E+  E
Sbjct: 115 RTARFVAVLCLYFPDGSLVTARGECEGYILEEMRGSGGFGYDPVFYLPDYGKTMAELPLE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
            KN                +SHRARA +
Sbjct: 175 IKNK---------------ISHRARALE 187


>gi|16331126|ref|NP_441854.1| deoxyribonucleotide triphosphate pyrophosphatase [Synechocystis sp.
           PCC 6803]
 gi|22653750|sp|P74432|NTPA_SYNY3 RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|1653620|dbj|BAA18532.1| slr0402 [Synechocystis sp. PCC 6803]
          Length = 194

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 109/205 (53%), Gaps = 29/205 (14%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +++A+ N  K+ EM + + PLG   T  L+   I  EETG++F ENA +K+   AK   
Sbjct: 3   TLIVATGNPGKLAEMQTYLEPLGCQLT--LKPTEIEVEETGSTFYENACLKASQVAKAVN 60

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             A++DDSGL +D LDG PG++SAR+   NT        +Q +E   +         R A
Sbjct: 61  QWAIADDSGLAVDALDGAPGLYSARYG--NTDRERIAKLLQALEGVSQ---------RQA 109

Query: 128 HFISVLSLAWPDGHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            FI V+S+A PDG ++ +  G  SG I   PRG  GFGYDPIF    + +TF EMT+ EK
Sbjct: 110 QFICVVSIAAPDGSIQLSTKGICSGEITHSPRGDQGFGYDPIFWLPEHKKTFAEMTKVEK 169

Query: 187 NGGIDSATLFSILSTDLLSHRARAF 211
                            +SHR +AF
Sbjct: 170 QK---------------VSHRGKAF 179


>gi|72162763|ref|YP_290420.1| Ham1-like protein [Thermobifida fusca YX]
 gi|71916495|gb|AAZ56397.1| Ham1-like protein [Thermobifida fusca YX]
          Length = 207

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 112/211 (53%), Gaps = 19/211 (9%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGI-MTTSALELNLIIPE--ETGNSFEENAMIKSLTAA 63
           + +V+A+ N  KI E+ S++  +G+ +   +L+     PE  ET  +F  NA++K+   A
Sbjct: 5   STLVLATRNRKKIPELRSILGEVGLDIEVRSLDGYPDAPEVAETEATFTGNALLKARAIA 64

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           ++ G+PA++DDSGL +D L+G PG+ SARW+    G +  D     +E  L       P 
Sbjct: 65  EHTGLPAVADDSGLRVDALNGMPGVLSARWS-GRFGAQHGDRDAANLELVLDQLADVPPE 123

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+   +LA PDG      G + G +   PRG+ GFGYDPIF P GY +T  EM+ 
Sbjct: 124 RRGAEFVCAAALALPDGEEHVVEGVLRGSLTTEPRGKNGFGYDPIFVPEGYTQTTAEMSP 183

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
           EEKN                +SHR  AF+  
Sbjct: 184 EEKNA---------------ISHRGVAFRAL 199


>gi|206890045|ref|YP_002249628.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|226737274|sp|B5YHP2|NTPA_THEYD RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|206741983|gb|ACI21040.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 204

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 99/181 (54%), Gaps = 7/181 (3%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNA 66
            IVIAS N  KI E+  ++  L I   S  +   L   +E G +F+ENA+ K+    +  
Sbjct: 2   KIVIASRNRKKIEELKRILQGLEITILSVNDFPELEEVKEDGLTFDENALKKARYVCQQT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PALSDDSGL ++ L G+PG+ SAR+A     + D       I+  L          R+
Sbjct: 62  GLPALSDDSGLEVEALGGRPGVRSARYAGDEASDDD------NIKKLLEELAGVPSEKRT 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+  ++L +PDG    F G V G I   PRG  GFGYDP+F P G+ +TF EM+  EK
Sbjct: 116 AQFVCCIALVFPDGKEYIFWGYVRGKISEIPRGTQGFGYDPVFIPEGFKKTFAEMSPHEK 175

Query: 187 N 187
           +
Sbjct: 176 D 176


>gi|312870592|ref|ZP_07730706.1| non-canonical purine NTP pyrophosphatase RdgB [Lactobacillus oris
           PB013-T2-3]
 gi|311093867|gb|EFQ52197.1| non-canonical purine NTP pyrophosphatase RdgB [Lactobacillus oris
           PB013-T2-3]
          Length = 198

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 110/209 (52%), Gaps = 22/209 (10%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IV+A+ N  K  E   +  PLG    +  +   I   E GNSFEENA IK+ T  K   +
Sbjct: 4   IVVATKNSGKAQEYQKMFAPLGFKVKTLQDFPPITINENGNSFEENATIKATTVMKVLKL 63

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
           P L+DDSGLV+D L+G+PGIHSAR+A    G+ D     QK+ NA+R +   D   R+AH
Sbjct: 64  PVLADDSGLVVDALNGEPGIHSARYA----GDHDDAANRQKLINAMR-EVPDDQ--RTAH 116

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F + +    P+G     +G VSG I+   +G  GFGYDP+F  +    +  ++T E+KN 
Sbjct: 117 FHTTIVAIKPNGKKLVANGNVSGHILHKEQGTNGFGYDPLFYVDSLICSMADLTPEQKNK 176

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFVDN 217
                          +SHR  A +  + N
Sbjct: 177 ---------------ISHRGNALRVLMKN 190


>gi|257126445|ref|YP_003164559.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Leptotrichia buccalis C-1013-b]
 gi|257050384|gb|ACV39568.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Leptotrichia buccalis C-1013-b]
          Length = 197

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 74/218 (33%), Positives = 123/218 (56%), Gaps = 25/218 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           + +A+ N  KI + + L   + +   + L+  L IP+  E G +FEEN+  K+   A   
Sbjct: 3   VFLATKNKGKIKDFEKLTEGINLEVVTILD-GLDIPDVVEDGETFEENSQKKAKEIADYT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +  +SDDSGL +D LDG PG++SAR+   NT + + +  M +I   L+     D   R 
Sbjct: 62  NIVTVSDDSGLCVDALDGGPGVYSARFGGENTSDSEKNQKMLEI---LKDVKKED---RK 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           AHF+SV+S+A+P+G + +F G++ G I++  +G  GFGY+PIF      ++FG+ ++EE+
Sbjct: 116 AHFVSVVSIAFPNGEIHSFRGEIEGEILFEAQGNNGFGYNPIFYSYELGKSFGQASDEER 175

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
                            +SHRARAF+  + + L ++EK
Sbjct: 176 KS---------------VSHRARAFRKLIASGL-LEEK 197


>gi|88808049|ref|ZP_01123560.1| Ham1-like protein [Synechococcus sp. WH 7805]
 gi|88788088|gb|EAR19244.1| Ham1-like protein [Synechococcus sp. WH 7805]
          Length = 197

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 107/198 (54%), Gaps = 14/198 (7%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +VIAS N  KI E + L+  L +  T+  E  L + EETG +F  NA +K++  A   
Sbjct: 6   RTLVIASGNRGKIREFEHLLSSLPLRITAQPE-GLEV-EETGQTFAANARLKAIAVANAT 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
              AL+DDSGL +D L+G PG+HSAR+A ++          Q+I   L +   HD   RS
Sbjct: 64  DSWALADDSGLSVDALNGAPGVHSARYAPTDP---------QRISRLLEALQDHDD--RS 112

Query: 127 AHFISVLSLAWP-DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           AHF + L LA P DG +    G+  G I   PRG+ GFGYDPIF+ +G   TF EM+  E
Sbjct: 113 AHFCAALCLAAPGDGVLLEVQGRCEGQITRSPRGEGGFGYDPIFEVDGTASTFAEMSTPE 172

Query: 186 KNGGIDSATLFSILSTDL 203
           K         F++L   L
Sbjct: 173 KKAHGHRGRAFALLEPQL 190


>gi|229821214|ref|YP_002882740.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Beutenbergia cavernae DSM 12333]
 gi|229567127|gb|ACQ80978.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Beutenbergia cavernae DSM 12333]
          Length = 209

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 80/224 (35%), Positives = 120/224 (53%), Gaps = 30/224 (13%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPL--GIM---TTSALELNLIIPEETGNSFEENAMIKSL 60
           +  +V+A+HN  KI E+ +++ PL  G+       A ++    P E G +F ENA+IK+ 
Sbjct: 7   DARLVLATHNAHKIVELRAILTPLLPGLAEGAVVGAADVGAAEPVEDGVTFAENALIKAR 66

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             A + G+PA++DDSG+ +DVL G PGI S RW    +G    D A  ++  A  S    
Sbjct: 67  ALAAHTGLPAVADDSGIAVDVLGGAPGIFSGRW----SGRHGDDEANLRLLLAQLSDVRD 122

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +   R+A F+   +L  PDG      G+++G ++  PRG  GFGYDPI +P+G++RT  E
Sbjct: 123 E--HRAAAFVCAAALVLPDGAEHVREGRLAGTLLRAPRGDGGFGYDPILRPDGHERTCAE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCF----VDNCLR 220
           +  EEKN                +SHR RAF+      V+  LR
Sbjct: 181 LDPEEKNA---------------ISHRGRAFRALAPLVVETLLR 209


>gi|318042768|ref|ZP_07974724.1| dITP/XTP pyrophosphatase [Synechococcus sp. CB0101]
          Length = 200

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 107/209 (51%), Gaps = 24/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +VIAS N  K+ E   L+  LG+      E  L + EETG++F ENA +K+   A+  
Sbjct: 2   TTLVIASGNAGKVREFGRLLADLGLEAQPQPE-GLEV-EETGSTFAENARLKAEAVARAT 59

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G  AL+DDSGL +D L G PG+HSAR+A+++T        +Q++   L    A  P+ RS
Sbjct: 60  GCWALADDSGLSVDALGGAPGVHSARYADTDTAR------IQRLLQELADAGATTPSARS 113

Query: 127 AHFISVLSLAWPDGHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           A F + L+LA P+G V     G   G I+  PRG+ GFGYDP+F       TF EM   +
Sbjct: 114 AQFTAALALASPEGEVVLEVEGICPGTILEAPRGEGGFGYDPVFFVPEAKFTFAEMPHSQ 173

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCF 214
           K                 L HR RAF   
Sbjct: 174 KA---------------ELGHRGRAFAAL 187


>gi|289450600|ref|YP_003475109.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Clostridiales genomosp. BVAB3 str. UPII9-5]
 gi|289185147|gb|ADC91572.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Clostridiales genomosp. BVAB3 str. UPII9-5]
          Length = 199

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 106/183 (57%), Gaps = 9/183 (4%)

Query: 7   NNIVIASHNVDKIHEMDSLIM-PLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK- 64
           N ++IA+HN +K+ E   ++     +++ S L LN  IPE TG +F EN +IK  T AK 
Sbjct: 6   NRLIIATHNRNKLREFTKILGDKFQVISLSELNLNEEIPE-TGTTFTENCLIKLHTLAKL 64

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 L+DDSGL ID L+G PG++SAR+    T    +D+ ++++++ LR         
Sbjct: 65  YPNDYILADDSGLCIDALNGAPGVYSARFCGETT---SYDVKIKQLQSLLREV---PEEA 118

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+AHF+ VL+L +PDG  +   G+  G+I     G  GFGYDPIF    Y  T  E++E 
Sbjct: 119 RTAHFVCVLALHYPDGQEKIMEGRCDGLIAHKTAGSNGFGYDPIFYLPHYGCTMAELSET 178

Query: 185 EKN 187
           EKN
Sbjct: 179 EKN 181


>gi|332702709|ref|ZP_08422797.1| Nucleoside-triphosphatase rdgB [Desulfovibrio africanus str. Walvis
           Bay]
 gi|332552858|gb|EGJ49902.1| Nucleoside-triphosphatase rdgB [Desulfovibrio africanus str. Walvis
           Bay]
          Length = 212

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 108/212 (50%), Gaps = 24/212 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLTAAK 64
             IV+A+ N  KI E+ +++ PL +          I  IPE TG +FEENA+IK+    +
Sbjct: 2   QKIVLATRNRGKIAELSAMLGPLDVEVVGLDAFPEIGEIPE-TGKTFEENALIKARAVCQ 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            AG+PAL+DDSGLV+D L G PG++SAR+A    GER  D         LR      P  
Sbjct: 61  AAGLPALADDSGLVVDALAGAPGVYSARFA----GERATD--ADNNAKLLREMATVPPER 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           RSAHF+ V++   P+G      G   G I   P+GQ GFGYDP+F       +  E+  E
Sbjct: 115 RSAHFVCVVAAVAPNGATVTARGTWDGEIARKPKGQGGFGYDPLFLDPELGMSAAELDPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +KN                 SHR RA +  +D
Sbjct: 175 QKNA---------------RSHRGRALRKLMD 191


>gi|320335007|ref|YP_004171718.1| Nucleoside-triphosphatase rdgB [Deinococcus maricopensis DSM 21211]
 gi|319756296|gb|ADV68053.1| Nucleoside-triphosphatase rdgB [Deinococcus maricopensis DSM 21211]
          Length = 207

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 68/181 (37%), Positives = 109/181 (60%), Gaps = 11/181 (6%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + +V+A+ N  K+ E    +  LG  T   L+  L++P E   ++EENA +K+   A   
Sbjct: 9   DRVVVATTNPGKVREFTEALAGLG-WTLQPLD-GLMLPPEDAATYEENAALKACAVAVQT 66

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL ++ L+G+PGI+SAR+   ++   D +  +  +E   R +   D   R 
Sbjct: 67  GLPALADDSGLEVESLNGEPGIYSARFGNRSS---DLERNLYLLE---RLRGHKD---RR 117

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+S + LA+PDGH+E + G+V+G I+  PRG  GFGYDP+F+ +G  +T  E+   +K
Sbjct: 118 AKFVSAIVLAYPDGHLETYRGEVAGRILEGPRGDGGFGYDPLFEVDGLGKTMAELDLAQK 177

Query: 187 N 187
            
Sbjct: 178 R 178


>gi|159902847|ref|YP_001550191.1| xanthosine triphosphate pyrophosphatase [Prochlorococcus marinus
           str. MIT 9211]
 gi|159888023|gb|ABX08237.1| Xanthosine triphosphate pyrophosphatase [Prochlorococcus marinus
           str. MIT 9211]
          Length = 211

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 113/216 (52%), Gaps = 41/216 (18%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP------EETGNSFEENAMIKSL 60
           NN+V+AS N+ K+ E   L+        S L LN+I        +ETG +F +NA +K+L
Sbjct: 19  NNLVVASGNMGKVEEFKQLL--------SGLSLNIISQPDGVKVDETGETFSDNAKLKAL 70

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             AK  G  AL+DDSGLV++ LDG PG++SAR+  ++          ++++  LR     
Sbjct: 71  YVAKFTGEFALADDSGLVVEALDGAPGVYSARYGNTDK---------ERVDRLLRELLPF 121

Query: 121 DPAFRSAHFISVLSLAWP-DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
               R+A FIS L LA   DG +    G+  GII +  RG  GFGYDP+F+  G   TF 
Sbjct: 122 KN--RNASFISSLCLASAEDGVLFEVEGRCEGIITYTARGNKGFGYDPVFEVRGTGLTFA 179

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           EM  ++K                L+SHR +AF+  +
Sbjct: 180 EMRAKDKR---------------LVSHRGKAFEALM 200


>gi|312134723|ref|YP_004002061.1| non-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Caldicellulosiruptor owensensis OL]
 gi|311774774|gb|ADQ04261.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor owensensis OL]
          Length = 203

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 115/214 (53%), Gaps = 29/214 (13%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPL--GIMTTSALELNLIIPEETGNSFEENAMIK 58
           MRKL+     +A+ N  K  E+  LI      ++T +  + ++ I E+ G +FEENA+ K
Sbjct: 1   MRKLL-----VATKNEGKAKEIKQLIGSYFDDVVTLNDFDSSVNIIED-GRTFEENALKK 54

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
           +       G P L+DDSGL +D LDG+PG+ SAR+A  N  + D    ++K+ N L+S  
Sbjct: 55  AKMIYTLYGQPTLADDSGLEVDALDGRPGVMSARYAGENATDED---RIKKLLNELKS-V 110

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
             D   R A F+ VL      G +    G   G I + PRG+ GFGYDP+F P+G+DRTF
Sbjct: 111 PEDK--RGAQFVCVLVFIDQQGRIYQTKGICRGKIAFEPRGENGFGYDPVFVPDGFDRTF 168

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            E+  + KN                +SHRA+AF+
Sbjct: 169 AELDSQIKN---------------QISHRAKAFE 187


>gi|300778912|ref|ZP_07088770.1| nucleoside-triphosphatase [Chryseobacterium gleum ATCC 35910]
 gi|300504422|gb|EFK35562.1| nucleoside-triphosphatase [Chryseobacterium gleum ATCC 35910]
          Length = 195

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 118/215 (54%), Gaps = 31/215 (14%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL---IIPEETGNSFEENAMIKSLT 61
           IE  +++A+HN  K  E+   I+  G +  S  + N+   I+  E G+SF  NA+IK+  
Sbjct: 3   IEMELLVATHNEHKKEEIQQ-ILGSGCVVKSLTDYNIHEEIV--EDGDSFHANALIKAKY 59

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
             +  G+P+L DDSGLV++ LDG+PGI SAR+A    G+ DF   ++K+   ++      
Sbjct: 60  CFEKTGIPSLGDDSGLVVESLDGRPGIFSARYA----GDHDFAKNIEKVLEEMQG----- 110

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A+F++VL     +G  + F G+V G ++   +G  GFGYDPIF P GY+RTF EM
Sbjct: 111 IENRKAYFVTVLCYYDENG-AQYFEGRVHGNLLTENKGFKGFGYDPIFVPEGYERTFAEM 169

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
              +KN                +SHR +A   F+D
Sbjct: 170 DPADKNK---------------ISHRKQALDLFMD 189


>gi|296331616|ref|ZP_06874085.1| nucleoside-triphosphatase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305675425|ref|YP_003867097.1| inosine/xanthosine triphosphate pyrophosphatase (subunit A)
           [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296151211|gb|EFG92091.1| nucleoside-triphosphatase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305413669|gb|ADM38788.1| inosine/xanthosine triphosphate pyrophosphatase (subunit A)
           [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 195

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 105/204 (51%), Gaps = 22/204 (10%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAGM 68
           +IA+HN  K+ E   ++ P G    S  E+      EETG++FEENA++K+   AK    
Sbjct: 5   IIATHNPGKVKEFKEILEPKGYDVKSLAEIGFTEEIEETGHTFEENAILKAQAVAKAVNK 64

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
             ++DDSGL ID L G+PG++SAR+A    GE+  D A   I   L      +   R+A 
Sbjct: 65  MVIADDSGLSIDNLGGRPGVYSARYA----GEQKDDQA--NIAKVLSELKGIEKEQRTAR 118

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F   L+++ P    +   G V G I   PRG+ GFGYDPIF     D+T  E+T +EKN 
Sbjct: 119 FRCALAVSIPGEETKTVEGHVEGYIAEEPRGEYGFGYDPIFIVKDKDKTMAELTSDEKNK 178

Query: 189 GIDSATLFSILSTDLLSHRARAFK 212
                          +SHRA A K
Sbjct: 179 ---------------ISHRADALK 187


>gi|291542644|emb|CBL15754.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ruminococcus bromii L2-63]
          Length = 198

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 110/206 (53%), Gaps = 27/206 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP--EETGNSFEENAMIKSLTAAKNA 66
            +IAS+N  K+ E++ ++ PLGI   +  E  + +   EE G +F ENA +K+  A    
Sbjct: 3   FIIASNNKKKLAELERILNPLGINAVTPKEEGITLDDVEENGTTFAENAFLKANAAYLKT 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARW-AESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D LDG+PG+++AR+  E  T E  +   + +++N        D   R
Sbjct: 63  GLPAVADDSGLCVDALDGRPGVYTARYGGEGLTDEERYIKLLDEMKNV-------DDDKR 115

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           SAHF S +    PDG      G   G I + P G+ GFGYDPIF     D++F E++ EE
Sbjct: 116 SAHFTSSICCILPDGSKITAEGICEGKIGYEPIGKDGFGYDPIFMFG--DKSFAELSAEE 173

Query: 186 KNGGIDSATLFSILSTDLLSHRARAF 211
           K               D +SHR +A 
Sbjct: 174 K---------------DAVSHRGKAL 184


>gi|288553635|ref|YP_003425570.1| non-canonical purine NTP pyrophosphatase [Bacillus pseudofirmus
           OF4]
 gi|288544795|gb|ADC48678.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Bacillus pseudofirmus OF4]
          Length = 195

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 113/210 (53%), Gaps = 24/210 (11%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAA 63
           ++N  +IA+ N  K+ E + +    G   TS LE + I   EETG +F ENA +K+ T A
Sbjct: 1   MKNQFIIATKNKGKVREFEQMFAHDGYQVTSLLEYDEIPDIEETGKTFAENAALKAETLA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDP 122
           K      ++DDSGLVID LDG+PG++SAR+A    GE   D A  +K+ N ++   + D 
Sbjct: 61  KALNQKVIADDSGLVIDALDGRPGVYSARYA----GEEKSDKANNEKVLNEMKDIPSED- 115

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F+  +++A P        G   GII   P G  GFGYDPI    G+++T  +++
Sbjct: 116 --RTARFVCTIAVASPGEPTYVVEGTCEGIIALEPAGANGFGYDPIMFLPGFNKTMAQLS 173

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHRA+A +
Sbjct: 174 AQEKN---------------QISHRAKALE 188


>gi|300088104|ref|YP_003758626.1| non-canonical purine NTP pyrophosphatase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527837|gb|ADJ26305.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dehalogenimonas lykanthroporepellens BL-DC-9]
          Length = 203

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 106/206 (51%), Gaps = 24/206 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAKN 65
             +V+A+ N  K+ E   L+   G    +  EL L + PEETG +F +NA+IK+   A+ 
Sbjct: 5   RRLVLATGNTGKVREYRRLLAGTGFGIVTPAELGLDVRPEETGATFADNAVIKAEALAEA 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFAHDPAF 124
            GMP+L+DDSGL +D L G+PG+ SAR+  +   +   F + ++++      +       
Sbjct: 65  TGMPSLADDSGLEVDALGGQPGVESARYGGAGLDDIGRFLLVLRRLAGVPEER------- 117

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   ++LA P        G V G I    RG+ GFGYDP+F P G  RT  E++  
Sbjct: 118 RTARFRCAIALAAPRRETVVVEGTVEGRIALEARGEGGFGYDPVFLPEGRRRTMAELSPG 177

Query: 185 EKNGGIDSATLFSILSTDLLSHRARA 210
           EK               D LSHRARA
Sbjct: 178 EK---------------DALSHRARA 188


>gi|78183838|ref|YP_376272.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Synechococcus sp. CC9902]
 gi|78168132|gb|ABB25229.1| Ham1-like protein [Synechococcus sp. CC9902]
          Length = 196

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/211 (39%), Positives = 109/211 (51%), Gaps = 32/211 (15%)

Query: 4   LIENNI-VIASHNVDKIHEMDSLIMPLGIMTTSALE-LNLIIPEETGNSFEENAMIKSLT 61
           + EN + VIAS N  KIHE   L+  L +      E L++   EETG +F  NA IK+L 
Sbjct: 1   MTENRVLVIASGNQGKIHEFQGLLSGLPLEVKPQPEGLDV---EETGATFAANARIKALA 57

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            A+  G  AL+DDSGL +  L+G PG+HSAR+A ++          ++IE  L +    +
Sbjct: 58  VAQTTGHWALADDSGLSVSALNGAPGVHSARYAPTDP---------ERIEKLLAALLQCN 108

Query: 122 PAFRSAHFISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
              RSAHF + L +A PDG V     G+  G I   PRG  GFGYDPIF+ N   RTF E
Sbjct: 109 E--RSAHFSAALCVAAPDGAVLLEVEGRCEGQITKTPRGDQGFGYDPIFEVNNTGRTFAE 166

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
           M+  EK                   HR RAF
Sbjct: 167 MSLAEKKS---------------YGHRGRAF 182


>gi|118580725|ref|YP_901975.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Pelobacter propionicus DSM 2379]
 gi|118503435|gb|ABK99917.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Pelobacter propionicus DSM 2379]
          Length = 207

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 111/210 (52%), Gaps = 24/210 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAK 64
             +V+A+ N  K++E+ + +  +    + A +     PE  E G +FE+NA+ K+  A +
Sbjct: 2   KELVVATRNRGKLNEIRAFLSGVVERVSCASDFE-GFPETVEDGATFEQNALKKAREAMR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PAL+DDSGLV+D LDG+PG+ SAR+    +GE   D A  +    L       P  
Sbjct: 61  FTGLPALADDSGLVVDALDGRPGVLSARF----SGEEGGDGANNR--KLLEEMGGMPPQG 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F+  L+   PDG    F G+V G I+   RG+ GFGYDP+F  +G+ RT  E+  E
Sbjct: 115 RGAAFVCALAYVTPDGGERLFFGRVGGRILEQERGEGGFGYDPLFLVDGFQRTMAELGME 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCF 214
           EKNG               +SHR  A + F
Sbjct: 175 EKNG---------------ISHRGEALRGF 189


>gi|332981493|ref|YP_004462934.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Mahella
           australiensis 50-1 BON]
 gi|332699171|gb|AEE96112.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Mahella
           australiensis 50-1 BON]
          Length = 199

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 112/210 (53%), Gaps = 22/210 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNA 66
           +I+IAS+N  KI E+  ++ PLG+   S  E  + +  EE GNSF+ENA+ K++T  K A
Sbjct: 5   DIIIASNNKGKIAEIKHILTPLGVNICSMQEKGIYVAVEEDGNSFQENAIKKAMTVCKVA 64

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
               L+DDSGL++  L G+PGI+SAR+A  N  + D     +K+ + +R     D   R 
Sbjct: 65  NEWTLADDSGLIVQALGGRPGIYSARFAGLNASDED---NRRKLLDMMRD-VPWDK--RK 118

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F   ++L  PDG+V    G+  G I +   G  GFGYDP+F    Y++TF ++    K
Sbjct: 119 AFFYCCVALVSPDGYVIMADGRCDGYIAYEEMGSDGFGYDPVFLIPEYNKTFAQLDISVK 178

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           N                +SHRARA     D
Sbjct: 179 NE---------------MSHRARALDALKD 193


>gi|148238613|ref|YP_001224000.1| HAM1 NTPase family protein [Synechococcus sp. WH 7803]
 gi|147847152|emb|CAK22703.1| HAM1 NTPase family protein [Synechococcus sp. WH 7803]
          Length = 197

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 110/198 (55%), Gaps = 14/198 (7%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +VIAS N+ KI E + L+  L +  T+  + + +  EETG +F  NA +K++  A   
Sbjct: 6   RTLVIASGNLGKIREFEHLLTGLPLQITA--QPDGLDVEETGQTFAANARLKAVAVADAT 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
              AL+DDSGL +D L+G PG+ SAR+A ++  ER     + ++  AL+     D   RS
Sbjct: 64  ASWALADDSGLSVDALNGAPGVQSARYAPTDP-ER-----ISRLLEALK-----DRDDRS 112

Query: 127 AHFISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           AHF + L LA P G V     G+ +G I   PRG+ GFGYDPIF+ +G  RTF EMT  E
Sbjct: 113 AHFSAALCLAAPGGRVLLEVEGRCAGQITRSPRGEGGFGYDPIFEVDGTARTFAEMTTPE 172

Query: 186 KNGGIDSATLFSILSTDL 203
           K         F++L   L
Sbjct: 173 KKAQGHRGRAFALLEPKL 190


>gi|296118695|ref|ZP_06837271.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Corynebacterium ammoniagenes DSM 20306]
 gi|295968184|gb|EFG81433.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Corynebacterium ammoniagenes DSM 20306]
          Length = 202

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 113/213 (53%), Gaps = 27/213 (12%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEET----GNSFEENAMIKSLTAA 63
            +++AS+N  K+ E++ ++   GI +   + L  + P E     G +F +NA+IK+   A
Sbjct: 2   KLLVASNNSKKLQELEKILADAGIDSVQLVPLRDVDPYEEPVEDGRTFADNALIKAHAGA 61

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G+  ++DDSG+ ++ L+G PG+ SARW    +GE   D A  ++   L ++ AH P 
Sbjct: 62  RETGLACIADDSGIAVEELNGMPGVLSARW----SGEHGNDEANNQL---LLAQMAHVPE 114

Query: 124 -FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F+SV ++  P G      G+  G ++  PRG+ GFGYDP+FQP G  R+  E++
Sbjct: 115 ERRQAAFVSVCAVVTPAGQEHVAEGRWPGRLLTSPRGEAGFGYDPLFQPEGDSRSAAELS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            EEKN                 SHR RA    V
Sbjct: 175 PEEKNAA---------------SHRGRALAQLV 192


>gi|254455624|ref|ZP_05069053.1| Ham1 family protein [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082626|gb|EDZ60052.1| Ham1 family protein [Candidatus Pelagibacter sp. HTCC7211]
          Length = 198

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 106/190 (55%), Gaps = 13/190 (6%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M+K+  + ++I ++N  K  E+  L +P  I T S  E  L  P+E G +F+EN++IKS 
Sbjct: 1   MKKI--SKLLIGTNNKGKYKEIKDL-LPKHIKTYSTKEFKLKSPKEDGLTFKENSIIKSK 57

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             +K   +  L+DDSGL ID+L+  PGI+SARW   N    DF  A+ ++    R+ F  
Sbjct: 58  YFSKKTNLICLADDSGLEIDLLNKAPGIYSARWGGKNG---DFKKAINRV---YRNLFRI 111

Query: 121 DPAFRS----AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
           D  ++S    A FI  LS+   D  + +  GKV G I   P+G  GFGYDPIF P     
Sbjct: 112 DKNWQSKKIKARFICALSIYNLDKKIASVQGKVEGFISNEPKGNNGFGYDPIFLPKNKKE 171

Query: 177 TFGEMTEEEK 186
           TFGEM   EK
Sbjct: 172 TFGEMKSLEK 181


>gi|302534680|ref|ZP_07287022.1| ribonuclease PH/Ham1 protein [Streptomyces sp. C]
 gi|302443575|gb|EFL15391.1| ribonuclease PH/Ham1 protein [Streptomyces sp. C]
          Length = 350

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 115/219 (52%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  K+ E+ +      I++ + L   L+       IP+  ETG +F ENA++
Sbjct: 151 TRLILATRNAGKVTELRA------ILSAAGLPHELVGADAYPEIPDVKETGVTFAENALL 204

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRS 116
           K+   A+  G PA++DDSGL +DVL+G PGI SARWA ++  +R + D+ + ++ +    
Sbjct: 205 KAHALARATGHPAIADDSGLCVDVLNGAPGIFSARWAGAHGNDRANLDLLLAQLGDIPDE 264

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
                   R AHF    +LA PDG      G++ G +   P G  GFGYDPI QP G  R
Sbjct: 265 -------HRGAHFFCAAALALPDGTERVVEGRLLGTLRRTPVGGGGFGYDPILQPLGETR 317

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T +EKN                +SHR +AF+  +
Sbjct: 318 TCAELTADEKNA---------------ISHRGQAFRGLI 341


>gi|84494375|ref|ZP_00993494.1| hypothetical protein JNB_06254 [Janibacter sp. HTCC2649]
 gi|84383868|gb|EAP99748.1| hypothetical protein JNB_06254 [Janibacter sp. HTCC2649]
          Length = 210

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 114/221 (51%), Gaps = 32/221 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI----IPE-----ETGNSFEENAMI 57
             +V+A+ N  K+HE+  ++  L       L L ++     P+     E+  +F  NA +
Sbjct: 2   TKLVLATQNEHKVHELRQILAEL----VDELGLEIVGASDFPDAPDVVESEVTFVGNARL 57

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA--LR 115
           K++  AK  G+P+++DDSGL +DVL G PG+ SARW+ S+ G  D   A +   N   L 
Sbjct: 58  KAVAVAKATGLPSVADDSGLAVDVLGGSPGVFSARWSGSHAGA-DAPRAARDGANVSLLL 116

Query: 116 SKFAHDP-AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGY 174
            +    P   RSA F+    LA PDG +E+  G+V G I   P G+ GFGYDPIF P+G 
Sbjct: 117 EQIGDVPDEHRSASFVCAAVLAMPDGTIESVEGRVPGTINREPVGENGFGYDPIFVPDGD 176

Query: 175 DRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            R   E T+ EKN                +SHR RAF+  +
Sbjct: 177 TRAMAEYTDVEKN---------------EISHRGRAFRAMI 202


>gi|83589384|ref|YP_429393.1| Ham1-like protein [Moorella thermoacetica ATCC 39073]
 gi|83572298|gb|ABC18850.1| Ham1-like protein [Moorella thermoacetica ATCC 39073]
          Length = 201

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 107/207 (51%), Gaps = 22/207 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
           N +V+A+ N  K  E   L+  LG+   + L+     +P ETG++F +NA+ K+   A  
Sbjct: 3   NKLVLATKNAGKAREFRELLQDLGVEIETLLDFPGFNLPPETGSTFVDNALFKARLTASM 62

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PAL DDSGL +D L+G PG++SAR+A   T +R  +  + ++   +  +       R
Sbjct: 63  TGLPALGDDSGLEVDFLEGAPGVYSARFAGEPTDDRRNNAKLLQLMEGVPWE------RR 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F  VL+L   DG      G + G+I   PRG  GFGYDP+F    YD T  E+  E 
Sbjct: 117 TARFRCVLALVTEDGDTHLAEGTLEGLIATEPRGHQGFGYDPLFYLPEYDLTLAELGGEV 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFK 212
           KN                LSHRARA K
Sbjct: 177 KNK---------------LSHRARAVK 188


>gi|297620325|ref|YP_003708462.1| deoxyribonucleotide triphosphate pyrophosphatase [Waddlia
           chondrophila WSU 86-1044]
 gi|297375626|gb|ADI37456.1| deoxyribonucleotide triphosphate pyrophosphatase [Waddlia
           chondrophila WSU 86-1044]
          Length = 200

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 111/182 (60%), Gaps = 10/182 (5%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALE--LNLIIPEETGNSFEENAMIKSLTAAKNA 66
           +++A+HN+ KI E   ++  +  +   +L    +  +PEETG +F+ENA +K+L AAK  
Sbjct: 3   LILATHNLHKIREFRQILKEVKGLDLISLRNFPDYQLPEETGKTFQENADLKALHAAKML 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESN-TGERDFDMAMQKIENALRSKFAHDPAFR 125
               L+DDSGLV+  L G PGI+SAR+A S+ T + + +  MQ++E     KF  +   R
Sbjct: 63  KAIVLADDSGLVVPALQGAPGIYSARYASSDATDKENREKLMQEME-----KF--EDLDR 115

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           SA++   +++A P+G ++       G+I    +G+ GFGYDPIF  + YD+TF E+ E+ 
Sbjct: 116 SAYYECCITIAGPEGILKTAKATCEGLIGEQEKGRNGFGYDPIFIKHDYDKTFAELEEQT 175

Query: 186 KN 187
           KN
Sbjct: 176 KN 177


>gi|227833920|ref|YP_002835627.1| putative xanthosine triphosphate pyrophosphatase [Corynebacterium
           aurimucosum ATCC 700975]
 gi|262184923|ref|ZP_06044344.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Corynebacterium aurimucosum ATCC 700975]
 gi|227454936|gb|ACP33689.1| putative xanthosine triphosphate pyrophosphatase [Corynebacterium
           aurimucosum ATCC 700975]
          Length = 203

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 113/209 (54%), Gaps = 27/209 (12%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII----PEETGNSFEENAMIKSLTAA 63
            +++AS+N  K+ E++ ++   GI     L L+ +     P E G +F +NA+IK+    
Sbjct: 3   KLLVASNNAKKLKELEKILADAGIAGIELLPLSAVEAYPEPVEDGRTFADNALIKARAGV 62

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           ++ G+  ++DDSGL ++ L+G PG+ SARW    +G    D A  ++   L  + +  PA
Sbjct: 63  QHTGLATIADDSGLAVEELNGMPGVLSARW----SGGHGDDEANNRL---LLGQMSDVPA 115

Query: 124 -FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F+SV +L  PDG      G+  G ++  P+G+ GFGYDP+FQP G  R+  EM+
Sbjct: 116 ERRAAAFVSVCALVTPDGQEHVVEGRWPGSLLTAPQGENGFGYDPLFQPEGESRSAAEMS 175

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAF 211
            EEKN                +SHR RA 
Sbjct: 176 PEEKNA---------------VSHRGRAL 189


>gi|15615629|ref|NP_243933.1| hypothetical protein BH3067 [Bacillus halodurans C-125]
 gi|22653777|sp|Q9K8D9|NTPA2_BACHD RecName: Full=Nucleoside-triphosphatase 2; AltName: Full=Nucleoside
           triphosphate phosphohydrolase 2; Short=NTPase 2
 gi|10175689|dbj|BAB06786.1| BH3067 [Bacillus halodurans C-125]
          Length = 194

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 105/204 (51%), Gaps = 22/204 (10%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAGM 68
           ++A+ N  K+ E ++++   G    S L+   I   EETG++F ENA IK+   A+    
Sbjct: 5   IVATKNKGKVAEFEAILGKRGFSVKSLLDYPAIEDIEETGSTFNENATIKAEAIAERFQR 64

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
           P L+DDSGL+ID LDG+PGI SAR+A    GE   D   + IE  LR         R+A 
Sbjct: 65  PVLADDSGLIIDALDGRPGIFSARYA----GEEKDD--QKNIEKVLRELQDIPWKARTAR 118

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F   ++LA P      F G   G I   P+G  GFGYDPIF    +D+T  E+T+EEKN 
Sbjct: 119 FHCSIALARPQAETIVFEGTCEGYITTEPKGTGGFGYDPIFYVPSHDKTMAELTQEEKNK 178

Query: 189 GIDSATLFSILSTDLLSHRARAFK 212
                          LSHR  A K
Sbjct: 179 ---------------LSHRYHALK 187


>gi|78211779|ref|YP_380558.1| Ham1-like protein [Synechococcus sp. CC9605]
 gi|78196238|gb|ABB34003.1| Ham1-like protein [Synechococcus sp. CC9605]
          Length = 193

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 102/198 (51%), Gaps = 14/198 (7%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +VIAS N  KI E   L+  L +      E  L + EETG +F  NA +K+   A   
Sbjct: 2   KTLVIASGNAGKIREFQGLLQSLPVSVQPQRE-GLEV-EETGTTFAANAQLKAQAVAAAT 59

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G  AL+DDSGL +D LDG PG+HSAR+A ++          ++I   L++    D   R 
Sbjct: 60  GEWALADDSGLSVDALDGAPGVHSARYAPTDP---------ERIARLLQALNGSDQ--RQ 108

Query: 127 AHFISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           A+F + L +A PDG +     G+  G+I   PRG  GFGYDPIF+  G  RTF EM   E
Sbjct: 109 AYFCAALCVAAPDGTILLEVEGRCDGLITAAPRGDQGFGYDPIFEVAGTGRTFAEMPLAE 168

Query: 186 KNGGIDSATLFSILSTDL 203
           K         F++L   L
Sbjct: 169 KKQHGHRGKAFTLLEPRL 186


>gi|296127249|ref|YP_003634501.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brachyspira murdochii DSM 12563]
 gi|296019065|gb|ADG72302.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brachyspira murdochii DSM 12563]
          Length = 197

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 107/182 (58%), Gaps = 10/182 (5%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           N +VIA+ N  K+ E++ +     I     +  ++    E GN+F +N++IK+       
Sbjct: 3   NKLVIATSNKHKLKEIEDIFKGRAIKEILPMPKDIGEIIEDGNTFIKNSIIKAKAVYNFT 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD-FDMAMQKIENALRSKFAHDPAFR 125
            +P+L+DDSGL ++ L+G+PGI SAR+   N G ++   M +++++         D + R
Sbjct: 63  KLPSLADDSGLCVNALEGRPGIFSARYGGENLGYKEKMHMLLEELK---------DKSDR 113

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           SA+FI+       D +     G+V+GII+  PRG  GFGYDPIFQP+GY+ T+ EM+ EE
Sbjct: 114 SAYFITSAVCVLDDNYYIAVEGRVNGIIIDNPRGFDGFGYDPIFQPDGYNVTYAEMSLEE 173

Query: 186 KN 187
           KN
Sbjct: 174 KN 175


>gi|281421638|ref|ZP_06252637.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella copri DSM 18205]
 gi|281404272|gb|EFB34952.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella copri DSM 18205]
          Length = 215

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 110/214 (51%), Gaps = 24/214 (11%)

Query: 9   IVIASHNVDKIHEM-DSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           IV A++N  K+ E+ D L     +++   +E ++ IPE TGN+ EENA+ K+     +  
Sbjct: 16  IVFATNNQHKLQEIRDILGSDYEVVSLKEIECDVDIPE-TGNTLEENALQKAQYVYDHYH 74

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +   +DD+GL ++ LDG PG+HSAR+AE    + D +  M K+   L  K      FR+ 
Sbjct: 75  VSCFADDTGLEVEALDGAPGVHSARYAEGT--DHDSEANMAKLLRELDGKENRQARFRTV 132

Query: 128 HFISVLSLAWPDG-----HVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
                     P G      +  F G V+G I    RG  GFGYDPIF P GYD++F E+ 
Sbjct: 133 ICYIEKQDVCPCGCTSIKKIHQFEGIVNGHIATEKRGTEGFGYDPIFVPEGYDQSFAELG 192

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           EE KNG               +SHRARA K  V+
Sbjct: 193 EEIKNG---------------ISHRARAVKKLVE 211


>gi|116071551|ref|ZP_01468819.1| Ham1-like protein [Synechococcus sp. BL107]
 gi|116065174|gb|EAU70932.1| Ham1-like protein [Synechococcus sp. BL107]
          Length = 196

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 84/205 (40%), Positives = 109/205 (53%), Gaps = 31/205 (15%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALE-LNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +VIAS N  KI E   L+  L ++     E L++   EETG +F  NA IK+L  A+  G
Sbjct: 7   LVIASGNQGKILEFQGLLNGLPLLVEPQPEGLDV---EETGTTFAANARIKALAVAQATG 63

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             AL+DDSGL +  L+G PG+HSAR+A ++  ER     ++K+  ALR    H+   RSA
Sbjct: 64  HWALADDSGLSVSALNGAPGVHSARYAPTDP-ER-----IKKLLEALRP--CHE---RSA 112

Query: 128 HFISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           +F + L +A PDG V     G+  G I   PRG  GFGYDPIF+ N   RTF EM   EK
Sbjct: 113 YFSAALCIAAPDGEVLVEVEGRCEGQITKAPRGDQGFGYDPIFEVNNTGRTFAEMALSEK 172

Query: 187 NGGIDSATLFSILSTDLLSHRARAF 211
                              HR RAF
Sbjct: 173 KS---------------YGHRGRAF 182


>gi|187251710|ref|YP_001876192.1| non-canonical purine NTP pyrophosphatase [Elusimicrobium minutum
           Pei191]
 gi|226737261|sp|B2KEA9|NTPA_ELUMP RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|186971870|gb|ACC98855.1| Non-canonical purine NTP pyrophosphatase [Elusimicrobium minutum
           Pei191]
          Length = 197

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 119/212 (56%), Gaps = 30/212 (14%)

Query: 8   NIVIASHNVDKIHEMDSLIMP--LGIMTTSALEL----NLIIPEETGNSFEENAMIKSLT 61
            I++A+ N  K  E+   I+P  +G      L L    +L +PEETG + EENA++K+  
Sbjct: 2   KILLATGNEQKAKEL-KCILPKNIGNKEIEYLTLGDFPDLRMPEETGKTLEENAILKARE 60

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAH 120
           AA+ AG+ AL+DD+GL +D L+G+PG+ SAR+A    GE  D D   +K+ ++L   F  
Sbjct: 61  AARQAGIAALADDTGLEVDALNGEPGVRSARYA----GEYCDPDENNRKLLDSLDGLFLG 116

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R+A F +V  LA P+G  E   G + G+I +  RG+ GFGYDP+F   G  +T  E
Sbjct: 117 Q---RTARFKTVACLATPEGEYELAEGVLGGLIGFGYRGENGFGYDPLFIVKGKSKTLAE 173

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           +T +EKN                +SHR +AF+
Sbjct: 174 LTLDEKNK---------------ISHRRKAFE 190


>gi|320355378|ref|YP_004196717.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfobulbus propionicus DSM 2032]
 gi|320123880|gb|ADW19426.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfobulbus propionicus DSM 2032]
          Length = 226

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 113/213 (53%), Gaps = 26/213 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAA 63
           ++N IV+A+ N +K+ E   L+    +   S  +   +  P E G +F++NA  K+L  A
Sbjct: 1   MDNIIVLATSNQNKLKEFRELLKNAPVTIKSLADFGPMPEPVEDGATFDDNAYKKALHYA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDP 122
           K  G+P L+DDSGLV+D LDG+PG++SAR++    T   + D  + ++E           
Sbjct: 61  KVLGLPCLADDSGLVVDALDGRPGVYSARYSGPEATDWSNCDKLLGEMEGQTN------- 113

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             RSAHF+ VLSLA P G    + G+  G ++   RG+ GFGYDP+F      +TF E+T
Sbjct: 114 --RSAHFVCVLSLATPGGPALTWEGRCDGELLTERRGEAGFGYDPLFYSPELGKTFAELT 171

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            EEK+                +SHR RA   F 
Sbjct: 172 MEEKS---------------RVSHRGRAMAEFA 189


>gi|148656373|ref|YP_001276578.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Roseiflexus sp. RS-1]
 gi|148568483|gb|ABQ90628.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Roseiflexus sp. RS-1]
          Length = 204

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 108/184 (58%), Gaps = 13/184 (7%)

Query: 8   NIVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            ++IA+ N  K+ E  ++   +PL + T S L +   + EETG +F ENA IK+   A+ 
Sbjct: 3   RLLIATTNPGKLREYAAIFADLPLDLYTLSDLHIEDDV-EETGATFAENARIKAEYYARR 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA--ESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +GMP L+DDSGL +  L G+PG++SAR+A  E+   ER+  + ++K+E            
Sbjct: 62  SGMPTLADDSGLEVAALGGEPGVYSARYAGPEATDAERN-ALLLRKLEGVPFHA------ 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+ V++LA P+G +E   G +SG+I + P+G  GFGYDPIF     D T  E+  
Sbjct: 115 -RLARFVCVIALALPNGSIEFVEGVLSGVIEFEPKGHYGFGYDPIFYVLDEDATLAELPP 173

Query: 184 EEKN 187
           E KN
Sbjct: 174 ERKN 177


>gi|296129174|ref|YP_003636424.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Cellulomonas flavigena DSM 20109]
 gi|296020989|gb|ADG74225.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Cellulomonas flavigena DSM 20109]
          Length = 213

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 112/219 (51%), Gaps = 30/219 (13%)

Query: 8   NIVIASHNVDKIHEMDSLIMP----LGIMTT-SALELNLIIPEETGNSFEENAMIKSLTA 62
            +V+A+HN  K+ E+ +++ P    LG      A +++   P E G +F  NAMIK+   
Sbjct: 13  RLVLATHNAHKVGELRAILAPHLPDLGPAAVLGARDVHAPEPVEDGVTFVANAMIKARAL 72

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A   G+PA++DDSGL +DVL G PGI SARWA    G    D A   +  A  +  A  P
Sbjct: 73  AAATGLPAVADDSGLSVDVLGGAPGIFSARWA----GRHGDDAANLDLLLAQLADIA--P 126

Query: 123 AFRSAHFISVLSLAWPDG--HVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             R A F+   +L  PDG  HVE   G + G +   PRG  GFGYDP+  P G  RT  E
Sbjct: 127 EHRRARFVCAAALVTPDGTEHVE--VGTLEGTLAAAPRGANGFGYDPVLVPLGGTRTCAE 184

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           +  EEKN                +SHR +AF+  V + +
Sbjct: 185 LAPEEKNA---------------ISHRGQAFRALVPHLV 208


>gi|225175206|ref|ZP_03729202.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dethiobacter alkaliphilus AHT 1]
 gi|225169382|gb|EEG78180.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dethiobacter alkaliphilus AHT 1]
          Length = 200

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 114/208 (54%), Gaps = 26/208 (12%)

Query: 8   NIVIASHNVDKIHEMDSLIM--PLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            ++IAS N  K+ E   L+   PL  ++ SA   NL   EETG++F ENA +K+ T A+ 
Sbjct: 2   KLIIASRNEGKLREFAQLLADSPLEPVSLSAYP-NLPEIEETGSTFRENAALKAETVARL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-AF 124
            G  AL+DDSGL +D L G+PG++SAR+A    GE   D A  K    L  K A  P   
Sbjct: 61  TGEWALADDSGLEVDALGGEPGVYSARYA----GEGQGDEANNK---KLLDKLADVPEEK 113

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F +V+++A P    +   G V GII + P+G  GFGYDP+F      +TF +MT E
Sbjct: 114 RTARFRAVIAIARPGKDTQFAEGAVEGIIAFSPQGSGGFGYDPLFLVPHTGKTFAQMTGE 173

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
           EKN                +SHRARA +
Sbjct: 174 EKN---------------RISHRARAME 186


>gi|255535704|ref|YP_003096075.1| Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Flavobacteriaceae bacterium 3519-10]
 gi|255341900|gb|ACU08013.1| Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Flavobacteriaceae bacterium 3519-10]
          Length = 191

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 109/183 (59%), Gaps = 18/183 (9%)

Query: 9   IVIASHNVDKIHEMDSLI---MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
           I+IA+HN  K  E+  ++     +  +T   +   ++   E G+SF ENA+IK+    + 
Sbjct: 5   ILIATHNQHKKEEIQQILGEDFHVDSLTDYDIHDEIV---EDGDSFHENALIKAKYCFEK 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G P++ DDSGLV++ LDG+PGI+SAR+A    G+ DF   M K+ + L+     +   R
Sbjct: 62  TGKPSVGDDSGLVVEALDGRPGIYSARYA----GDHDFAKNMAKVLDELK-----ETENR 112

Query: 126 SAHFISVLSLAWPDGHVEN-FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           +A+F++V  +   DG  E+ F G+V G +    RG  GFGYDPIF P+G+D TF EM  E
Sbjct: 113 NAYFVTV--MCHVDGAGEHYFEGRVYGQLTREIRGAKGFGYDPIFIPDGHDITFAEMKAE 170

Query: 185 EKN 187
           +KN
Sbjct: 171 DKN 173


>gi|172058160|ref|YP_001814620.1| nucleoside-triphosphatase [Exiguobacterium sibiricum 255-15]
 gi|226737262|sp|B1YJW5|NTPA_EXIS2 RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|171990681|gb|ACB61603.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Exiguobacterium sibiricum 255-15]
          Length = 198

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 108/207 (52%), Gaps = 24/207 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAKNA 66
            I++A+ N  K+ E  +++  LG    S L+ +     EETG++FEENA +KS  AA   
Sbjct: 2   KIIVATRNAGKVGEFQAMLGRLGYDVESLLDYDTAPETEETGSTFEENAELKSKEAAAYF 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA-FR 125
           G   LSDDSGL +D LDG PG++SAR+A    GE   D A   +   L  K A  PA  R
Sbjct: 62  GHAVLSDDSGLEVDALDGAPGVYSARFA----GEDKSDAANNAL---LLEKLADTPADRR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F+  LSLA P G      G + G I +  +G  GFGYDP+F     ++T  E+T+ E
Sbjct: 115 TARFVCALSLAKPSGETLTVRGTMEGQIGFEQKGTNGFGYDPLFLIPSLNQTAAELTKSE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFK 212
           K                 +SHR +A K
Sbjct: 175 KAA---------------ISHRGQALK 186


>gi|302390318|ref|YP_003826139.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermosediminibacter oceani DSM 16646]
 gi|302200946|gb|ADL08516.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermosediminibacter oceani DSM 16646]
          Length = 198

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 108/203 (53%), Gaps = 21/203 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           ++VIA+ N  K+ E   ++  + +   S L+   I  EE+G++FEENA++K+    +  G
Sbjct: 3   DLVIATKNRGKLKEFKEMLSDIPLNIISLLDFPGIEVEESGSTFEENAVMKAKKVLELTG 62

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           + +L DDSGL +  L G+PG+H+AR+A    G+ D    + K+ N L+         R A
Sbjct: 63  IASLGDDSGLEVAALGGRPGVHTARFAGPGAGDVD---NINKLLNELKGVPWEK---RQA 116

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+  L  A PDG V    G + G+I + PRG +GFGYDP+F      +T  E T EEKN
Sbjct: 117 RFVCCLCFALPDGRVFVEYGYLKGLITFEPRGTMGFGYDPVFFVPELGKTLAEATPEEKN 176

Query: 188 GGIDSATLFSILSTDLLSHRARA 210
                           +SHRARA
Sbjct: 177 A---------------VSHRARA 184


>gi|302871437|ref|YP_003840073.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302574296|gb|ADL42087.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 203

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 113/216 (52%), Gaps = 33/216 (15%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPL--GIMTTSALE--LNLIIPEETGNSFEENAM 56
           MRKL+     IA+ N  K  EM  LI      ++T +  +  +N+I   E G +FEENA+
Sbjct: 1   MRKLL-----IATKNEGKAKEMKQLIGSYFDDVVTLNDFDGSVNII---EDGRTFEENAL 52

Query: 57  IKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRS 116
            K+         P L+DDSGL +D LDGKPG+ SAR+A  N  + D    ++K+ + L+ 
Sbjct: 53  KKARVIYTLYRQPTLADDSGLEVDALDGKPGVMSARYAGENATDED---RIKKLLDELKD 109

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
               D   R A F+ VL      G +    G   G I + PRG+ GFGYDP+F P+G+DR
Sbjct: 110 -VPDDK--RGAQFVCVLVFIDKQGRIYQTKGICRGKIAFEPRGENGFGYDPVFVPDGFDR 166

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           TF E+  + KN                +SHRA+AF+
Sbjct: 167 TFAELDSQIKN---------------QISHRAKAFE 187


>gi|152967705|ref|YP_001363489.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Kineococcus radiotolerans SRS30216]
 gi|151362222|gb|ABS05225.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Kineococcus radiotolerans SRS30216]
          Length = 215

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 111/221 (50%), Gaps = 32/221 (14%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPL----GIMTTSALELNLIIPE--ETGNSFEEN 54
           M       +V+A+ N  K+ E+ +++ PL     ++T  A E    +PE  ET  +F  N
Sbjct: 1   MSATTPQRVVLATRNAHKVGELRAVLAPLLPDVEVLTVDAFEG---VPEVAETEVTFAGN 57

Query: 55  AMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENAL 114
           A++K+   A   G+PA++DDSG+ +DVL G PGI SARWA    G    D A  ++   L
Sbjct: 58  ALLKARAVAAATGVPAIADDSGISVDVLGGAPGIFSARWA----GRHGDDAANLEL---L 110

Query: 115 RSKFAHDPA-FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNG 173
            ++ A  PA  R   F+   +LA P G     +G++ G I   P G  GFGYDP+F P G
Sbjct: 111 LAQIADVPAEHRGGAFVCAAALALPGGTSAVRTGELRGTIATAPGGSGGFGYDPVFVPAG 170

Query: 174 YDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
             RT  E + EEKN                +SHR  AF+  
Sbjct: 171 AGRTLAEHSAEEKNA---------------ISHRGAAFRAL 196


>gi|186896651|ref|YP_001873763.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pseudotuberculosis PB1/+]
 gi|186699677|gb|ACC90306.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Yersinia pseudotuberculosis PB1/+]
          Length = 197

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 2   QKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQTT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD-FDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR+A ++  ++D  +  +  ++N    K       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQDNLEKLLVALQNVPEEK-------R 114

Query: 126 SAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+     F G+  G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 GAQFHCVLVYMR---HAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPALGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKHA---------------VSHRGQALKLMLD 192


>gi|255308380|ref|ZP_05352551.1| ribonuclease PH [Clostridium difficile ATCC 43255]
          Length = 449

 Score =  121 bits (303), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 113/209 (54%), Gaps = 25/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAK 64
           N +VIA++N  K+ E+  ++        S  +++L   E  E G +FE NA+IK+ T AK
Sbjct: 251 NEVVIATNNAHKLEEIGEILKDFEYKVYSLKDVDLAGIEIVEDGKTFEHNALIKARTIAK 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPA 123
              + A+SDDSGL +D L  KPG++SAR+A E  T E +    ++ ++N   SK      
Sbjct: 311 KTKLIAISDDSGLEVDALGKKPGVYSARYAGEHATDEENRKKLLKAMQNVPMSK------ 364

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+S +++ +PDG      G   G+I +  +G+ GFGYD +F   GYD+TFGE+  
Sbjct: 365 -RNARFVSAIAVVFPDGKEFVVRGICEGMIGFEEKGKNGFGYDSLFIVKGYDKTFGEIPS 423

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
             KN                +SHRA A K
Sbjct: 424 VIKNS---------------ISHRANALK 437


>gi|255102475|ref|ZP_05331452.1| ribonuclease PH [Clostridium difficile QCD-63q42]
          Length = 449

 Score =  121 bits (303), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 113/209 (54%), Gaps = 25/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAK 64
           N +VIA++N  K+ E+  ++        S  +++L   E  E G +FE NA+IK+ T AK
Sbjct: 251 NEVVIATNNAHKLEEIGEILKDFEYKVYSLKDVDLAGIEIVEDGKTFEHNALIKARTIAK 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPA 123
              + A+SDDSGL +D L  KPG++SAR+A E  T E +    ++ ++N   SK      
Sbjct: 311 KTKLIAISDDSGLEVDALGKKPGVYSARYAGEHATDEENRKKLLKAMQNVPMSK------ 364

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+S +++ +PDG      G   G+I +  +G+ GFGYD +F   GYD+TFGE+  
Sbjct: 365 -RNARFVSAIAVVFPDGKEFVVRGICEGMIGFEEKGKNGFGYDSLFIVKGYDKTFGEIPS 423

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
             KN                +SHRA A K
Sbjct: 424 VIKNS---------------ISHRANALK 437


>gi|154500956|ref|ZP_02038994.1| hypothetical protein BACCAP_04642 [Bacteroides capillosus ATCC
           29799]
 gi|150269980|gb|EDM97499.1| hypothetical protein BACCAP_04642 [Bacteroides capillosus ATCC
           29799]
          Length = 199

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 104/201 (51%), Gaps = 9/201 (4%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNA 66
            +V+AS N  K+ EM  ++   G+      ++   +  EETG +FEENA++K+    +  
Sbjct: 2   KMVLASKNNHKLKEMQDILSAQGVEVVLESDVGADVDVEETGTTFEENALLKAKAVMEAT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSGL +D L+G PG++SAR+     G  D       +EN +R +       R 
Sbjct: 62  GLPAIADDSGLCVDALNGAPGVYSARYG--GPGLDDVGRYKLLLEN-MRGQLD-----RR 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
             F+S +   +P+G      G+  G + + P+G  GFGYDPIF   G  +TF E+  EEK
Sbjct: 114 CKFVSAICCCFPNGDTVTARGECQGTLAYAPKGADGFGYDPIFFVPGLKKTFAELLPEEK 173

Query: 187 NGGIDSATLFSILSTDLLSHR 207
           N         +I    L  +R
Sbjct: 174 NAISHRGNALAIFKDKLAEYR 194


>gi|311069328|ref|YP_003974251.1| nucleoside-triphosphatase [Bacillus atrophaeus 1942]
 gi|310869845|gb|ADP33320.1| nucleoside-triphosphatase [Bacillus atrophaeus 1942]
          Length = 195

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 106/204 (51%), Gaps = 22/204 (10%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAGM 68
           +IA+HN  K+ E   ++ P G    S  ++  +   EETG++FEENA++K+   AK    
Sbjct: 5   IIATHNPGKVKEFKDILAPKGYDVKSLADIGFLEEIEETGHTFEENAVLKAEAVAKAVNK 64

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
             ++DDSGL +D L G PG++SAR+A    GE+  D A   I   L+     +   R+A 
Sbjct: 65  MVIADDSGLSVDNLGGSPGVYSARYA----GEQKDDTA--NINKVLQELKGIEKEQRTAR 118

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F   L+++ P    +   G V G I   P+G+ GFGYDPIF     D+T  E+T +EKN 
Sbjct: 119 FRCALAVSIPGKETKTVEGHVEGYIAEEPKGENGFGYDPIFIVKDKDKTMAELTSDEKNK 178

Query: 189 GIDSATLFSILSTDLLSHRARAFK 212
                          +SHRA A K
Sbjct: 179 ---------------ISHRANALK 187


>gi|210621777|ref|ZP_03292806.1| hypothetical protein CLOHIR_00751 [Clostridium hiranonis DSM 13275]
 gi|210154541|gb|EEA85547.1| hypothetical protein CLOHIR_00751 [Clostridium hiranonis DSM 13275]
          Length = 449

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 113/209 (54%), Gaps = 25/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
            ++VIA+ N  K+ E+  ++      +M+   +EL+ I   E G +FE NA+IK+ T +K
Sbjct: 251 KDVVIATGNKHKLQEIGDILKDFDYNVMSLKDVELDGIEIVEDGKTFEHNALIKARTISK 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQ-KIENALRSKFAHDPA 123
                +++DDSGLV+D L GKPGI+SAR+A    GE   D   + K+  A++     D  
Sbjct: 311 LTKKISIADDSGLVVDCLGGKPGIYSARYA----GEHATDEENRVKLFEAMKDVPMED-- 364

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+S + +  PDG      G V G I +   G+ GFGYD +F P+G+D TFGE+  
Sbjct: 365 -RTARFVSAIGVVLPDGKEFTVRGTVEGKITFEEHGENGFGYDCMFMPDGFDTTFGEIDP 423

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
           E KN                +SHRA A K
Sbjct: 424 EIKNS---------------MSHRANALK 437


>gi|157693250|ref|YP_001487712.1| HAM1 protein [Bacillus pumilus SAFR-032]
 gi|157682008|gb|ABV63152.1| HAM1 protein [Bacillus pumilus SAFR-032]
          Length = 197

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 105/204 (51%), Gaps = 22/204 (10%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAGM 68
           +IA+HN  K  E  +++ P G    +  ++  I   EETG++FEENA+IK+      AG 
Sbjct: 5   IIATHNAGKAKEFKAILEPKGFTVKTLADIGFIEEIEETGHTFEENAVIKAEAIQAKAGE 64

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
             ++DDSGL ID L GKPG++SAR+A    GE   D   + +E  L      +   R+A 
Sbjct: 65  MVIADDSGLSIDYLGGKPGVYSARYA----GEHKND--AENVEKVLSELQGIEKEDRTAR 118

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F   L+++ P    +   G V G I   P G+ GFGYDPIF     D+T  E++ EEKN 
Sbjct: 119 FRCALAVSIPGKETKTVEGSVEGFIAEEPIGENGFGYDPIFIVKDKDQTMAELSPEEKNK 178

Query: 189 GIDSATLFSILSTDLLSHRARAFK 212
                          +SHRA A +
Sbjct: 179 ---------------ISHRAVALQ 187


>gi|160934417|ref|ZP_02081804.1| hypothetical protein CLOLEP_03290 [Clostridium leptum DSM 753]
 gi|156867090|gb|EDO60462.1| hypothetical protein CLOLEP_03290 [Clostridium leptum DSM 753]
          Length = 202

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 110/208 (52%), Gaps = 26/208 (12%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGI--MTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             V+A++N+ K  EM+ ++  LGI  +T      +L   EETG +FEENA IK+  A   
Sbjct: 2   QFVMATNNLKKRDEMERILKELGIEVLTAKQAGADLGDVEETGTTFEENAYIKAKAALDL 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARW-AESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            G  +++DDSGL++D L+G+PG++SAR+     T E      ++ IEN    K       
Sbjct: 62  TGKASIADDSGLMVDALNGEPGVYSARYGGPGATDEERVQKLLKNIENVPEEK------- 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+S +   +P+G      G+  G I + P G+ GFGYDP+F   G  +TF E+T +
Sbjct: 115 RTARFVSAICCLFPNGKELMVRGECPGKIAYAPAGEGGFGYDPVFVVEG-GKTFAELTAK 173

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
           EK               D +SHR  A +
Sbjct: 174 EK---------------DAVSHRGAALR 186


>gi|255657266|ref|ZP_05402675.1| ribonuclease PH [Clostridium difficile QCD-23m63]
 gi|296451893|ref|ZP_06893610.1| ribonuclease PH/Ham1 protein [Clostridium difficile NAP08]
 gi|296879712|ref|ZP_06903687.1| ribonuclease PH/Ham1 protein [Clostridium difficile NAP07]
 gi|296259275|gb|EFH06153.1| ribonuclease PH/Ham1 protein [Clostridium difficile NAP08]
 gi|296429301|gb|EFH15173.1| ribonuclease PH/Ham1 protein [Clostridium difficile NAP07]
          Length = 449

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 113/209 (54%), Gaps = 25/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTAAK 64
           N +VIA++N  K+ E+  ++        S  +++L  I   E G +FE NA+IK+ T AK
Sbjct: 251 NEVVIATNNAHKLEEIGEILKDFEYKVYSLKDVDLAGIDIVEDGKTFEHNALIKARTIAK 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPA 123
              + A+SDDSGL +D L  KPG++SAR+A E  T E +    ++ ++N   SK      
Sbjct: 311 KTKLIAISDDSGLEVDALGKKPGVYSARYAGEHATDEENRKKLLKAMQNVPMSK------ 364

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+S +++ +PDG      G   G+I +  +G+ GFGYD +F   GYD+TFGE+  
Sbjct: 365 -RNARFVSAIAVVFPDGKEFVVRGICEGMIGFEEKGKNGFGYDSLFIVKGYDKTFGEIPS 423

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
             KN                +SHRA A K
Sbjct: 424 VIKNS---------------ISHRANALK 437


>gi|126700927|ref|YP_001089824.1| ribonuclease PH [Clostridium difficile 630]
 gi|115252364|emb|CAJ70205.1| Bifunctional enzyme, tRNA nucleotidyltransferase ;
           Nucleoside-triphosphatase [Clostridium difficile]
          Length = 449

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 113/209 (54%), Gaps = 25/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAK 64
           N +VIA++N  K+ E+  ++        S  +++L   E  E G +FE NA+IK+ T AK
Sbjct: 251 NEVVIATNNAHKLEEIGEILKDFEYKVYSLKDVDLAGIEIVEDGKTFEHNALIKARTIAK 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPA 123
              + A+SDDSGL +D L  KPG++SAR+A E  T E +    ++ ++N   SK      
Sbjct: 311 KTKLIAISDDSGLEVDALGKKPGVYSARYAGEHATDEENRKKLLKAMQNIPMSK------ 364

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+S +++ +PDG      G   G+I +  +G+ GFGYD +F   GYD+TFGE+  
Sbjct: 365 -RNARFVSAIAVVFPDGKEFVVRGICEGMIGFEEKGKNGFGYDSLFIVKGYDKTFGEIPS 423

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
             KN                +SHRA A K
Sbjct: 424 VIKNS---------------ISHRANALK 437


>gi|260890260|ref|ZP_05901523.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Leptotrichia hofstadii F0254]
 gi|260859880|gb|EEX74380.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Leptotrichia hofstadii F0254]
          Length = 213

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 117/213 (54%), Gaps = 24/213 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           + +A+ N  KI + + L   + +   + L+    IP+  E G +FEEN+  K+   A   
Sbjct: 19  VFLATKNKGKIKDFEKLTEGMDLEVVTILD-GPDIPDVVEDGETFEENSRKKAKEIADYT 77

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +  +SDDSGL +D LDG PG++SAR+   N  + + +  M ++   ++ +       R 
Sbjct: 78  NIVTISDDSGLCVDALDGGPGVYSARFGGENATDSEKNQKMLELLKDVKKEN------RK 131

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           AHF+SV+S+A+P+G + +F G++ G I++  RG  GFGY+PIF     +++FGE  +EE+
Sbjct: 132 AHFVSVVSIAFPNGEIHSFRGEIEGEILFEARGNNGFGYNPIFYSYELEKSFGEADDEER 191

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
                            +SHRARAF+  + + L
Sbjct: 192 KS---------------VSHRARAFRKLIASGL 209


>gi|312131221|ref|YP_003998561.1| noN-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Leadbetterella byssophila DSM 17132]
 gi|311907767|gb|ADQ18208.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Leadbetterella byssophila DSM 17132]
          Length = 193

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 109/181 (60%), Gaps = 13/181 (7%)

Query: 9   IVIASHNVDKIHEMDSLIMP-LGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           I +A+HN  K  E+ S +     + T S L +   I E TG +FEEN++IK+    +  G
Sbjct: 4   ICLATHNAHKAEELKSALGDRFEVKTLSDLGVMEDITE-TGTTFEENSLIKAQYVYERFG 62

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           +  L+DDSGL ++ LDG+PG++SAR+A E +    +    MQ++E   +         RS
Sbjct: 63  IAVLADDSGLEVEALDGRPGVYSARYAGEPSDATANNLKLMQELEGISQ---------RS 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F +V++L W DG V  FSG+VSG I     G++GFGY+P+F P GY++TF EM  EE+
Sbjct: 114 ARFRTVITLIW-DGEVHQFSGEVSGDITPSFGGEVGFGYNPVFVPKGYEKTFHEMGFEER 172

Query: 187 N 187
           +
Sbjct: 173 S 173


>gi|269121567|ref|YP_003309744.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sebaldella termitidis ATCC 33386]
 gi|268615445|gb|ACZ09813.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sebaldella termitidis ATCC 33386]
          Length = 195

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 111/206 (53%), Gaps = 26/206 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           I +A+ N  KI+E   L+    I   S L+   I   EE G +FEEN+  K++  AK   
Sbjct: 3   IFLATKNTGKINEFKRLVDGKNIEVLSILDSEDIPEVEEDGETFEENSQKKAVEIAKYLN 62

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFAHDPAFRS 126
           M  +SDDSGL ++ LDG PG++SAR++  N  + ++ D  ++ +E             R+
Sbjct: 63  MYTISDDSGLCVNYLDGAPGVYSARYSGENADDSKNMDKLLKDLEGVNE---------RA 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+SV+SLA PDG V ++ G+  G I+    G  GFGYDPIF  +  ++ FGE + EEK
Sbjct: 114 AKFVSVVSLARPDGSVYSYRGEADGEIMHERHGTNGFGYDPIFFSHELNKCFGEASPEEK 173

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
                            +SHRA+AF+
Sbjct: 174 KS---------------VSHRAKAFE 184


>gi|327398724|ref|YP_004339593.1| Nucleoside-triphosphatase rdgB [Hippea maritima DSM 10411]
 gi|327181353|gb|AEA33534.1| Nucleoside-triphosphatase rdgB [Hippea maritima DSM 10411]
          Length = 197

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 121/213 (56%), Gaps = 26/213 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IV+A++N  K+ E+  ++    I+ +SA+ ++   PEE+G +F EN++IK+ + A+    
Sbjct: 9   IVVATNNKHKLKEIKEILNDFEILPSSAV-VDSFNPEESGKTFCENSLIKAKSLAEFTDY 67

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
           P L+DDSGL +  L+G+PG++S+R+  S TG +D D   + IE   R K   D   RSA 
Sbjct: 68  PVLADDSGLEVFSLNGEPGVYSSRY--SKTG-KDEDNLKKLIE---RLKGKKD---RSAR 118

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F   +SL   DG+V    G V G I+  P G+ GFGYDP+F P+GYD TF +M+ ++KN 
Sbjct: 119 FSCCMSLVV-DGNVIQREGYVYGRIIDRPIGENGFGYDPVFVPDGYDITFAQMSPKQKNA 177

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
                          +SHR RA     +   RI
Sbjct: 178 ---------------ISHRRRALAMIKEELERI 195


>gi|307244059|ref|ZP_07526178.1| tRNA nucleotidyltransferase [Peptostreptococcus stomatis DSM 17678]
 gi|306492583|gb|EFM64617.1| tRNA nucleotidyltransferase [Peptostreptococcus stomatis DSM 17678]
          Length = 486

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 114/210 (54%), Gaps = 25/210 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           E   +IA+ N+ K+ E+  ++  M   I +   ++L+ +   E G +FE NA+IK+ T +
Sbjct: 284 EREAIIATGNMHKLEEIQKMLADMDFDIKSLKDVDLDGVEIIENGKTFEHNALIKARTIS 343

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAM-QKIENALRSKFAHDP 122
           K  G  A+ DDSG+ +D L  +PGI+SAR+A  N  + +  + M +++++    K     
Sbjct: 344 KLTGKIAIGDDSGIEVDALGKRPGIYSARYAGENATDEENRIKMFEELKDVPMEK----- 398

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F+ V++  +PDG      GKV G I    RGQ GFGYD +F P GY+ TFG+++
Sbjct: 399 --RTARFVCVIATVFPDGKEMLARGKVEGRIALEERGQNGFGYDCMFIPEGYEETFGQLS 456

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            E KN                 SHR+RA +
Sbjct: 457 PEVKNS---------------FSHRSRALE 471


>gi|148543777|ref|YP_001271147.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Lactobacillus reuteri DSM 20016]
 gi|184153183|ref|YP_001841524.1| xanthosine triphosphate pyrophosphatase [Lactobacillus reuteri JCM
           1112]
 gi|227363243|ref|ZP_03847375.1| nucleoside-triphosphatase [Lactobacillus reuteri MM2-3]
 gi|325682149|ref|ZP_08161667.1| ribonuclease PH/Ham1 protein [Lactobacillus reuteri MM4-1A]
 gi|148530811|gb|ABQ82810.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Lactobacillus reuteri DSM 20016]
 gi|183224527|dbj|BAG25044.1| xanthosine triphosphate pyrophosphatase [Lactobacillus reuteri JCM
           1112]
 gi|227071699|gb|EEI09990.1| nucleoside-triphosphatase [Lactobacillus reuteri MM2-3]
 gi|324978793|gb|EGC15742.1| ribonuclease PH/Ham1 protein [Lactobacillus reuteri MM4-1A]
          Length = 195

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 107/207 (51%), Gaps = 22/207 (10%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIA+ N  K  E   ++ PLGI   +  +   I   E G +FEENA IK+ TAA    +
Sbjct: 4   IVIATKNTGKAREYQEMLAPLGIEVKTLADFAPITINENGKTFEENATIKATTAANQLQL 63

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
           P ++DDSGL++D L G PG+HSAR+A       D D A    +  L  K   D   R+AH
Sbjct: 64  PVMADDSGLMVDALGGAPGVHSARYAG------DHDDAANNAKLLLALKEVPDEK-RTAH 116

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F + +    PDG     +G+V G I+    G+ GFGYDP+F  +   ++  ++T ++KN 
Sbjct: 117 FHTTIVGIKPDGTKLVANGRVDGHILHQLTGKNGFGYDPLFYVDELGKSMAQLTADQKN- 175

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFV 215
                          +SHR RA + F+
Sbjct: 176 --------------QISHRGRALRSFM 188


>gi|154507584|ref|ZP_02043226.1| hypothetical protein ACTODO_00064 [Actinomyces odontolyticus ATCC
           17982]
 gi|153797218|gb|EDN79638.1| hypothetical protein ACTODO_00064 [Actinomyces odontolyticus ATCC
           17982]
          Length = 204

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/219 (33%), Positives = 116/219 (52%), Gaps = 30/219 (13%)

Query: 8   NIVIASHNVDKIHEMDSLIMPL------GIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            +V A+ N  K+ E+++++ P       G +   + + ++  P E G +FEEN++IK+  
Sbjct: 4   RLVFATSNAHKVSELEAILAPAWEGFEAGCVARMS-DFDVASPVEDGVTFEENSLIKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            A+  G+ A++DDSG+ +DVL G PGI SARWA    G    D A  ++   L  + +  
Sbjct: 63  LARATGLAAIADDSGITVDVLGGAPGIFSARWA----GSHGDDAANLRL---LIDQLSDV 115

Query: 122 P-AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           P A R A F+S   L  PDG      G+V G +   PRG+ GFGYDPIF P G++ T  +
Sbjct: 116 PDAHRGAAFVSAAVLVTPDGREFVERGEVRGTLTRSPRGEGGFGYDPIFVPEGFEVTTAQ 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ ++KN                +SHR  AF+  + + +
Sbjct: 176 MSADQKNA---------------ISHRGIAFRALIPHIV 199


>gi|296268928|ref|YP_003651560.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermobispora bispora DSM 43833]
 gi|296091715|gb|ADG87667.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermobispora bispora DSM 43833]
          Length = 204

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 115/223 (51%), Gaps = 38/223 (17%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEE---------TGNSFEENAMIK 58
            +V+A+ N  KI E+        I+  + L + L+  EE         TG SF ENA+IK
Sbjct: 4   RVVLATRNAGKIAELRR------ILAEARLPVELVGLEEFPGVGEIAETGGSFAENALIK 57

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSK 117
           +   A+  G+PA++DDSGL +++++G PGI SARWA  +  ++ + D+ + ++ +    +
Sbjct: 58  ARAVARETGLPAIADDSGLCVEIMNGMPGIFSARWAGRHGDDKANLDLLLAQLGDVPDER 117

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                  R AHF    +LA P G      G + G+++  PRG  GFGYDPIF P G  RT
Sbjct: 118 -------RKAHFACAAALALPSGEEHVVEGALYGVVIREPRGTNGFGYDPIFVPEGETRT 170

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             EM+ EEK               D +SHR RAF+  V    R
Sbjct: 171 TAEMSPEEK---------------DAISHRGRAFRALVPVIAR 198


>gi|282877271|ref|ZP_06286103.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella buccalis ATCC 35310]
 gi|281300612|gb|EFA92949.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella buccalis ATCC 35310]
          Length = 184

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/161 (40%), Positives = 97/161 (60%), Gaps = 26/161 (16%)

Query: 43  IPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD 102
           IPE TG++ +ENA+ K++  A++ G+   +DD+GL +D LDGKPG+HSAR+AE    + D
Sbjct: 10  IPE-TGDTLQENALQKAMYVAEHYGLDCFADDTGLEVDALDGKPGVHSARYAEGT--DHD 66

Query: 103 FDMAMQKIENALRSKFAHDPAFRSAHFISVLSL----------------AWPDGHVENFS 146
            +  MQK+   L+ K       R AHF +V++L                A P+ H   F 
Sbjct: 67  SEANMQKLLRELQGK-----NNRKAHFRTVIALLQHPKNQQEKNIDNACAAPEIHY--FE 119

Query: 147 GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           G+V G+I    RG+ GFGYDP+F PNGY+++F E+ E+ KN
Sbjct: 120 GRVDGLIAEEKRGEAGFGYDPLFIPNGYNQSFAELGEDIKN 160


>gi|51597527|ref|YP_071718.1| deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pseudotuberculosis IP 32953]
 gi|153948234|ref|YP_001399810.1| deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pseudotuberculosis IP 31758]
 gi|62900193|sp|Q666N1|NTPA_YERPS RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|51590809|emb|CAH22455.1| possible Xanthosine triphosphate pyrophosphatase [Yersinia
           pseudotuberculosis IP 32953]
 gi|152959729|gb|ABS47190.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia
           pseudotuberculosis IP 31758]
          Length = 197

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 2   QKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQTT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD-FDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR+A ++  +++  +  +  ++N    K       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQENLEKLLAALQNVPEEK-------R 114

Query: 126 SAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+     F G+  G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 GAQFHCVLVYMR---HAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPALGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKHA---------------VSHRGQALKLMLD 192


>gi|322418586|ref|YP_004197809.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacter sp. M18]
 gi|320124973|gb|ADW12533.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacter sp. M18]
          Length = 207

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 110/207 (53%), Gaps = 22/207 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             +++AS N  K+ E   L+  +     S  +   L   EE G++FE NA+ K+L+AA+ 
Sbjct: 2   KELLVASGNKGKLREFGELLRGVVDTILSPADFPELPEVEEDGDTFEANAIKKALSAARF 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G P L+DDSGL +D L G+PG+ SAR+A  +  + D +  +      LR         R
Sbjct: 62  TGKPVLADDSGLCVDYLGGRPGVFSARFAGESASDADNNALL------LRELAGVPSENR 115

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F  V++L  PDG  ++F G + G+I+  PRG+ GFGYDP+F    Y +TF E+  E 
Sbjct: 116 TAAFHCVIALCLPDGSCQSFDGMLPGVILEAPRGEGGFGYDPLFLVPEYGQTFSELPMEI 175

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFK 212
           KN               ++SHR RA +
Sbjct: 176 KN---------------VISHRGRAMQ 187


>gi|288921257|ref|ZP_06415541.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Frankia
           sp. EUN1f]
 gi|288347347|gb|EFC81640.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Frankia
           sp. EUN1f]
          Length = 214

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 110/212 (51%), Gaps = 30/212 (14%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP----EETGNSFEENAMIKSLTAA 63
            +V+AS N  K+ E+  ++   G+    A+E+  + P     ETG++F ENA+IK+  A 
Sbjct: 10  RVVLASRNDGKLRELGRILAGTGL----AIEVVALPPGPEVAETGSTFAENALIKARDAV 65

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAHD- 121
              G+ A++DDSGL +D L G PG+ SARWA   TG R D D A     NAL      D 
Sbjct: 66  ARTGLAAIADDSGLTVDELAGMPGVRSARWAGVRTGTRTDRDAA----NNALLLAQLDDV 121

Query: 122 -PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R A F+   +L  PDG      G + G ++   RG+ GFGYDP+F  +G  RT  E
Sbjct: 122 EAERRGAAFVCAAALVTPDGAEHVVHGSLRGRLLTAGRGEGGFGYDPLFVADGETRTNAE 181

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           +T +EK               DL+SHR +A +
Sbjct: 182 LTADEK---------------DLISHRGKALR 198


>gi|227544195|ref|ZP_03974244.1| nucleoside-triphosphatase [Lactobacillus reuteri CF48-3A]
 gi|300908190|ref|ZP_07125656.1| nucleoside-triphosphatase [Lactobacillus reuteri SD2112]
 gi|227185831|gb|EEI65902.1| nucleoside-triphosphatase [Lactobacillus reuteri CF48-3A]
 gi|300894617|gb|EFK87973.1| nucleoside-triphosphatase [Lactobacillus reuteri SD2112]
          Length = 195

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 107/207 (51%), Gaps = 22/207 (10%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIA+ N  K  E   ++ PLGI   +  +   I   E G +FEENA IK+ TAA    +
Sbjct: 4   IVIATKNAGKAREYQDMLAPLGIEVKTLADFAPIAINENGKTFEENATIKATTAANQLQL 63

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
           P ++DDSGL++D L G PG+HSAR+A       D D A    +  L  K   D   R+AH
Sbjct: 64  PVMADDSGLMVDALGGAPGVHSARYAG------DHDDAANNAKLLLALKEVPDEK-RTAH 116

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F + +    PDG     +G+V G I+    G+ GFGYDP+F  +   ++  ++T ++KN 
Sbjct: 117 FHTTIVGIKPDGTKLVANGRVDGHILHQLTGENGFGYDPLFYVDELGKSMAQLTADQKN- 175

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFV 215
                          +SHR RA + F+
Sbjct: 176 --------------QISHRGRALRSFM 188


>gi|257452054|ref|ZP_05617353.1| ribonuclease PH [Fusobacterium sp. 3_1_5R]
 gi|257466147|ref|ZP_05630458.1| ribonuclease PH [Fusobacterium gonidiaformans ATCC 25563]
 gi|317058602|ref|ZP_07923087.1| ribonuclease Ph [Fusobacterium sp. 3_1_5R]
 gi|313684278|gb|EFS21113.1| ribonuclease Ph [Fusobacterium sp. 3_1_5R]
          Length = 194

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 107/208 (51%), Gaps = 28/208 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           + +A+ N  KI E+ ++     +   S L+  + IPE  E G +FEEN+  K+L  AK  
Sbjct: 3   LFLATGNKHKIEEIKAIFHENEVEIFSILD-GISIPEVVEDGKTFEENSQKKALEIAKYL 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            M  ++DDSGL +D L G PG++SAR++E  T E +    +Q ++             R 
Sbjct: 62  NMMTVADDSGLCVDALGGAPGVYSARYSEEGTDEANNQKLIQNLKGIDN---------RK 112

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+SV+S A PDG V +F G+V G IV   RG+ GFGYDP F    Y +T  EM E   
Sbjct: 113 ARFVSVISFAKPDGEVFSFRGEVEGEIVDDRRGEFGFGYDPYFYVKEYGKTLAEMPE--- 169

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCF 214
                          + +SHRA A K F
Sbjct: 170 -------------VKNQISHRANALKKF 184


>gi|253583584|ref|ZP_04860782.1| Ham1 protein [Fusobacterium varium ATCC 27725]
 gi|251834156|gb|EES62719.1| Ham1 protein [Fusobacterium varium ATCC 27725]
          Length = 196

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 112/206 (54%), Gaps = 26/206 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           I +A+ N  KI E+ ++   +  +   +++  + IPE  E G++FE N+  K+L  AK  
Sbjct: 3   IFLATGNKHKIEEITAIFKNVKNIEILSIKDGIDIPEVVEDGDTFEANSAKKALEIAKYT 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           GM  ++DDSGL +D L+G PG++SAR++  N  +   D   +K+   L+ K       R 
Sbjct: 63  GMITIADDSGLCVDALNGAPGVYSARYSGENATD---DSNNKKLIRELQGK-----ENRK 114

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           AHF+SV++L  PDG   +F G+VSG I+  PRG  GFGYDP F    Y +T  EM +   
Sbjct: 115 AHFVSVITLGKPDGRSYSFRGEVSGEIIDEPRGDKGFGYDPHFFVAEYRKTLAEMPD--- 171

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
                          +++SHRA A K
Sbjct: 172 -------------IKNIISHRANALK 184


>gi|332798598|ref|YP_004460097.1| Nucleoside-triphosphatase rdgB [Tepidanaerobacter sp. Re1]
 gi|332696333|gb|AEE90790.1| Nucleoside-triphosphatase rdgB [Tepidanaerobacter sp. Re1]
          Length = 195

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 108/206 (52%), Gaps = 23/206 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +VIA+ N  K  E+  ++  +     S      I   ETG SF+ENA+IK+   AK  G
Sbjct: 3   TLVIATKNKGKYLELKKMLGDISFTLLSLEAFPHIEIRETGASFDENALIKARVTAKETG 62

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           +PAL+DDSGL +D L G+PGI +AR+A E  T E +    +++++N    K       R 
Sbjct: 63  LPALADDSGLEVDALKGEPGIFTARYAGEHATDEDNIKKLLERLKNVPFDK-------RQ 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+  L+LA+PDG +    G + G I   P G  GFGYDP+F      RT  E++ +EK
Sbjct: 116 ARFMCSLALAFPDGKIFLEHGILEGFITLKPCGIEGFGYDPVFFVPDLGRTLSEISVDEK 175

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                +SHRA+A +
Sbjct: 176 NR---------------ISHRAKALE 186


>gi|117926289|ref|YP_866906.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Magnetococcus sp. MC-1]
 gi|117610045|gb|ABK45500.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Magnetococcus sp. MC-1]
          Length = 202

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 109/212 (51%), Gaps = 30/212 (14%)

Query: 8   NIVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAA 63
            +V+A+ N  K+ E+   +   P+ ++   A       PE  E G SF ENA  K+    
Sbjct: 3   RLVLATGNRKKLIELKRALAGQPVELLGLDAFPQ---APEVVEDGESFAENAFKKAEALM 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           ++ G+ AL+DDSGLV+D L G PG+ SAR+A    GE+  D   + ++  L +   H   
Sbjct: 60  QHTGLAALADDSGLVVDALHGAPGVRSARYA----GEQASDA--ENVDKLLHAMAGHSN- 112

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+AHF   L+L  P+G    F G+V G IV    G+ GFGYDP+FQP G  RTF +M  
Sbjct: 113 -RAAHFHCTLALVTPEGGRACFEGRVDGWIVQAAVGEGGFGYDPLFQPEGEARTFAQMAP 171

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            EK               D +SHR RA   FV
Sbjct: 172 HEK---------------DAMSHRGRAVNAFV 188


>gi|227503999|ref|ZP_03934048.1| nucleoside-triphosphatase [Corynebacterium striatum ATCC 6940]
 gi|227199393|gb|EEI79441.1| nucleoside-triphosphatase [Corynebacterium striatum ATCC 6940]
          Length = 203

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 110/212 (51%), Gaps = 25/212 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII----PEETGNSFEENAMIKSLTAAK 64
           +++AS+N  K+ E++ ++   GI     L L+ +     P E G +F +NA+IK+     
Sbjct: 4   LLVASNNKKKLGELERILADAGIEGVELLSLSAVPAYDEPVEDGRTFADNALIKARAGVA 63

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           N G+  ++DDSG+ ++ L+G PG+ SARW    +G+   D A   +  A  S    +   
Sbjct: 64  NTGIATIADDSGIAVEELNGMPGVLSARW----SGQHGNDQANNDLLLAQMSDVPDE--R 117

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+SV +L  P G      G+  G ++  P+G+ GFGYDP+FQP G  R+  EM+ E
Sbjct: 118 RAAAFVSVCALVTPAGKEYVAEGRWPGTLLRAPQGENGFGYDPLFQPEGEQRSSAEMSPE 177

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           EKN                +SHR RA     D
Sbjct: 178 EKNA---------------VSHRGRALAQLTD 194


>gi|257463722|ref|ZP_05628111.1| ribonuclease PH [Fusobacterium sp. D12]
 gi|317061267|ref|ZP_07925752.1| ribonuclease PH [Fusobacterium sp. D12]
 gi|313686943|gb|EFS23778.1| ribonuclease PH [Fusobacterium sp. D12]
          Length = 195

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 108/211 (51%), Gaps = 34/211 (16%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           + +A+ N  KI E+ ++     +   S L+  + IPE  E G +FEEN+  K+L  AK+ 
Sbjct: 3   LFLATGNKHKIEEIKAIFQENELEIYSILD-GISIPEVVEDGKTFEENSQKKALEIAKHL 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE---RDFDMAMQKIENALRSKFAHDPA 123
            M  ++DDSGL +D L G PG++SAR++E  T E   +     +Q IEN           
Sbjct: 62  NMMTIADDSGLCVDALGGAPGVYSARYSEEGTDEANNQKLLRNLQGIEN----------- 110

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+SV+S A P+G V +F G+V G I+   RG  GFGYDP F    Y +T  EM E
Sbjct: 111 -RRAKFVSVISFAKPNGEVFSFRGEVEGEIIDERRGDFGFGYDPYFYVKEYGKTLAEMPE 169

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
                             + +SHRA A K F
Sbjct: 170 ----------------VKNQISHRAEALKKF 184


>gi|154686971|ref|YP_001422132.1| YsnA [Bacillus amyloliquefaciens FZB42]
 gi|154352822|gb|ABS74901.1| YsnA [Bacillus amyloliquefaciens FZB42]
          Length = 195

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 106/205 (51%), Gaps = 24/205 (11%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAGM 68
           +IA+HN  K+ E   ++ P G   +S  E+      EETG++FEENA++K+   AK    
Sbjct: 5   IIATHNQGKVKEFKEILEPKGYSVSSLAEIGFTEEIEETGHTFEENAILKAEAVAKAVNK 64

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAFRSA 127
             ++DDSGL +D L G+PG++SAR+A    GE   D A M K+ + L+     +   R+A
Sbjct: 65  MVIADDSGLSVDNLGGRPGVYSARYA----GEAKDDKANMDKVLSELK---GIEKEQRTA 117

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F   L+++ P    +   G V G I   P G  GFGYDPIF     D+T  ++T  EKN
Sbjct: 118 RFRCALAVSMPGQETKTVEGHVEGYIAEGPEGDNGFGYDPIFIVKDKDKTMAQLTSAEKN 177

Query: 188 GGIDSATLFSILSTDLLSHRARAFK 212
                           +SHRA A K
Sbjct: 178 K---------------ISHRAEALK 187


>gi|227538447|ref|ZP_03968496.1| nucleoside-triphosphatase [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227241729|gb|EEI91744.1| nucleoside-triphosphatase [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 191

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 114/209 (54%), Gaps = 29/209 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLTAAKNA 66
           ++ A++N  K+ E+ +++     M  S  ++N    IPE TG++FEENA  K+       
Sbjct: 4   LIFATNNAHKLDEVRAIVGD-AFMIKSLDDINCQDDIPE-TGDTFEENAKQKTDYLVNKY 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+    DDSGL I+ ++ +PG++SAR++ S   ER+ D+ ++K+          D   R 
Sbjct: 62  GLYCFGDDSGLEIEAINNEPGVYSARYSGSRDMERNIDLVLEKLA---------DSENRK 112

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F +V+SL + +     F G ++G I+   RG  GFGYDPIF P+GYD+TF EM+ +EK
Sbjct: 113 ARFRTVISL-FLNEQQHFFEGAITGTIISERRGAEGFGYDPIFIPDGYDKTFAEMSADEK 171

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFV 215
           NG               +SHR+ A K   
Sbjct: 172 NG---------------ISHRSIAVKALT 185


>gi|170023076|ref|YP_001719581.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pseudotuberculosis YPIII]
 gi|169749610|gb|ACA67128.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Yersinia pseudotuberculosis YPIII]
          Length = 197

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 2   QKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQTT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD-FDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR+A ++  +++  +  +  ++N    K       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQENLEKLLAALQNVPDEK-------R 114

Query: 126 SAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+     F G+  G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 GAQFHCVLVYMR---HAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPALGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKHA---------------VSHRGQALKLMLD 192


>gi|308174533|ref|YP_003921238.1| inosine/xanthosine triphosphate pyrophosphatase subunit A [Bacillus
           amyloliquefaciens DSM 7]
 gi|307607397|emb|CBI43768.1| inosine/xanthosine triphosphate pyrophosphatase (subunit A)
           [Bacillus amyloliquefaciens DSM 7]
 gi|328554455|gb|AEB24947.1| nucleoside-triphosphatase [Bacillus amyloliquefaciens TA208]
 gi|328912858|gb|AEB64454.1| inosine/xanthosine triphosphate pyrophosphatase (subunit A)
           [Bacillus amyloliquefaciens LL3]
          Length = 195

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 106/205 (51%), Gaps = 24/205 (11%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAGM 68
           +IA+HN  K+ E   ++ P G   +S  E+      EETG++FEENA++K+   AK    
Sbjct: 5   IIATHNPGKVKEFKEILEPKGYSVSSLAEIGFTEEIEETGHTFEENAILKAEAVAKAVNK 64

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAFRSA 127
             ++DDSGL +D L G+PG++SAR+A    GE   D A M K+ + L+     +   R+A
Sbjct: 65  MVIADDSGLSVDNLGGRPGVYSARYA----GEAKDDKANMDKVLSELK---GIEKEQRTA 117

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F   L+++ P    +   G V G I   P G  GFGYDPIF     D+T  ++T  EKN
Sbjct: 118 RFRCALAVSMPGQETKTVEGHVEGYIAEEPEGDNGFGYDPIFIVKDKDKTMAQLTSAEKN 177

Query: 188 GGIDSATLFSILSTDLLSHRARAFK 212
                           +SHRA A K
Sbjct: 178 K---------------ISHRAEALK 187


>gi|242373383|ref|ZP_04818957.1| nucleoside-triphosphatase [Staphylococcus epidermidis M23864:W1]
 gi|242348746|gb|EES40348.1| nucleoside-triphosphatase [Staphylococcus epidermidis M23864:W1]
          Length = 201

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 105/180 (58%), Gaps = 11/180 (6%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +IVIA++N  KI++  ++     ++  S L  +  + EETG +FEENA++KS  AAK   
Sbjct: 9   DIVIATNNQGKINDFKAIFKDDHVIGISELIQDFDV-EETGTTFEENAILKSEAAAKALN 67

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAE-SNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
              ++DDSGL +  LDG+PG++SAR+A    + + + D  +  +EN          + R 
Sbjct: 68  KRVIADDSGLEVFALDGEPGVYSARYAGLDKSDDANIDKLLSNLEN---------ESDRR 118

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+ V+S++ PD   + F G VSG I    RG+ GFGYDP+F     DRT  E++ EEK
Sbjct: 119 AQFVCVISMSAPDEETKTFKGTVSGEITRERRGENGFGYDPVFFVPDKDRTMAEISNEEK 178


>gi|282858124|ref|ZP_06267319.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Pyramidobacter piscolens W5455]
 gi|282584046|gb|EFB89419.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Pyramidobacter piscolens W5455]
          Length = 203

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 112/213 (52%), Gaps = 29/213 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGI--MTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
             +VIAS N  K  E  +L+ PLGI  +     E  L + EETG +F ENA +K+   AK
Sbjct: 10  QKLVIASGNRHKYEEFCALLAPLGIELIFGGGCERPLNV-EETGATFLENAALKACAWAK 68

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           + G+PA+SDDSG+ +  LD +PGI+S+R      GE D       I N        D + 
Sbjct: 69  HTGLPAISDDSGIEVRALDWRPGIYSSR----VGGEDDEACRQWLIANMA------DKSD 118

Query: 125 RSAHFISVLSLAWPDGHVENFS-GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           R A + + L LA+PDG V   +    +G ++   RG  GFGYDP+F P GYD TFGE+  
Sbjct: 119 RFARYAAALVLAFPDGSVHWRTLAYCNGRVIQEKRGGNGFGYDPLFIPEGYDLTFGELPA 178

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           E K                 LSHRA+A + F++
Sbjct: 179 ETKAK---------------LSHRAKASQAFIE 196


>gi|86739582|ref|YP_479982.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Frankia
           sp. CcI3]
 gi|86566444|gb|ABD10253.1| Ham1-like protein [Frankia sp. CcI3]
          Length = 220

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 110/211 (52%), Gaps = 28/211 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP----EETGNSFEENAMIKSLTA 62
             +V+AS N  K+ E+  ++   G+    A+EL  + P     ETG +F ENA+IK+  A
Sbjct: 12  TKVVLASRNEAKLAELRRILAASGL----AVELVGLPPGEEVPETGTTFAENALIKARAA 67

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAHD 121
               G+PA++DDSGL +D L G PG+ SARW+    G R + D A   +   L ++    
Sbjct: 68  VAETGLPAVADDSGLAVDELAGMPGVRSARWSGWRDGTRVERDTANNTL---LLAQLDDV 124

Query: 122 PA-FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           PA  R A F+   +L  PDG      G++ G ++  PRG  GFGYDP+F  +G  RT  E
Sbjct: 125 PADRRGAAFVCAAALVTPDGVERVAHGELRGTLLTEPRGVGGFGYDPLFLADGQTRTNAE 184

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
           ++  EK               D +SHR RAF
Sbjct: 185 LSAAEK---------------DAISHRGRAF 200


>gi|134300518|ref|YP_001114014.1| nucleoside-triphosphatase [Desulfotomaculum reducens MI-1]
 gi|172044339|sp|A4J7Y6|NTPA_DESRM RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|134053218|gb|ABO51189.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfotomaculum reducens MI-1]
          Length = 201

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 108/206 (52%), Gaps = 22/206 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNA 66
            +V+A++N  K+ E+  L+ P G    S  E       EE GN+F +NA+ K+L AA+  
Sbjct: 2   KLVLATNNKGKVKELAELLKPCGYQVVSIGEFPGFTEVEEDGNTFADNAIKKALAAAEFT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G  AL+DDSGL +D L G PG++SAR+A    GE   D A      +L      D   R+
Sbjct: 62  GELALADDSGLEVDALKGAPGVYSARFA----GEPKDDTANNAKLLSLLEGVPQD--HRT 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F  V+++A P+G +    G   G+I+   +G+ GFGYDP+F    Y +TF E+  E+K
Sbjct: 116 ARFRCVIAIAEPNGRIHTAEGSCEGVILRELKGEGGFGYDPLFYVPEYKQTFAELDMEKK 175

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                +SHR +A K
Sbjct: 176 NS---------------ISHRGKALK 186


>gi|238795056|ref|ZP_04638649.1| Nucleoside-triphosphatase [Yersinia intermedia ATCC 29909]
 gi|238725604|gb|EEQ17165.1| Nucleoside-triphosphatase [Yersinia intermedia ATCC 29909]
          Length = 197

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/215 (35%), Positives = 115/215 (53%), Gaps = 29/215 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ +L+   G+   +  EL +   +ETG +F ENA++K+  AA+  
Sbjct: 2   QKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESADETGLTFIENAILKARHAAQIT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSGL +D L G PGI+SAR+A ++  ++D    ++K+  AL+       A RS
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARFAGTDASDQD---NLEKLLVALKDV---PDAKRS 115

Query: 127 AHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  VL       H E+     F G+  G+I   P G  GFGYDPIF      +T  E+
Sbjct: 116 AQFHCVLVYMR---HAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYIPALSKTAAEL 172

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           T EEK+                +SHR +A K  +D
Sbjct: 173 TREEKHA---------------VSHRGQALKLMLD 192


>gi|254976907|ref|ZP_05273379.1| ribonuclease PH [Clostridium difficile QCD-66c26]
 gi|255316047|ref|ZP_05357630.1| ribonuclease PH [Clostridium difficile QCD-76w55]
 gi|255518704|ref|ZP_05386380.1| ribonuclease PH [Clostridium difficile QCD-97b34]
 gi|255651826|ref|ZP_05398728.1| ribonuclease PH [Clostridium difficile QCD-37x79]
 gi|260684852|ref|YP_003216137.1| ribonuclease Ph [Clostridium difficile CD196]
 gi|260688510|ref|YP_003219644.1| ribonuclease Ph [Clostridium difficile R20291]
 gi|306521613|ref|ZP_07407960.1| ribonuclease Ph [Clostridium difficile QCD-32g58]
 gi|260211015|emb|CBA66330.1| ribonuclease Ph [Clostridium difficile CD196]
 gi|260214527|emb|CBE07044.1| ribonuclease Ph [Clostridium difficile R20291]
          Length = 449

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 112/209 (53%), Gaps = 25/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAK 64
           N +VIA++N  K+ E+  ++        S  +++L   E  E G +FE NA+IK+   AK
Sbjct: 251 NEVVIATNNAHKLEEIGEILKDFEYKVYSLKDVDLAGIEIVEDGKTFEHNALIKARAIAK 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPA 123
              + A+SDDSGL +D L  KPG++SAR+A E  T E +    ++ ++N   SK      
Sbjct: 311 KTKLIAISDDSGLEVDALGKKPGVYSARYAGEHATDEENRKKLLKAMQNVPMSK------ 364

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+S +++ +PDG      G   G+I +  +G+ GFGYD +F   GYD+TFGE+  
Sbjct: 365 -RNARFVSAIAVVFPDGKEFVVRGICEGMIGFEEKGKNGFGYDSLFIVKGYDKTFGEIPS 423

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
             KN                +SHRA A K
Sbjct: 424 VIKNS---------------ISHRANALK 437


>gi|313891750|ref|ZP_07825355.1| non-canonical purine NTP pyrophosphatase RdgB [Dialister
           microaerophilus UPII 345-E]
 gi|313119744|gb|EFR42931.1| non-canonical purine NTP pyrophosphatase RdgB [Dialister
           microaerophilus UPII 345-E]
          Length = 195

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 113/215 (52%), Gaps = 22/215 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAKNA 66
            IV+A+ N  KI E   +   LG    +  ++  +  PEETG +FEENA+ K+   +K  
Sbjct: 2   KIVLATKNKGKIKEFKKVFSKLGWEAVAISDIAYVKEPEETGKTFEENAINKAKYYSKAV 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            MP L+DDSG++ DVL  +PGI+SAR+A  +  ++  +    K+ + LR    +    RS
Sbjct: 62  SMPVLADDSGIIADVLKDRPGIYSARYAGVHGDDKANN---SKLVDKLR---LYKENERS 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            +++ V++L WP+G V    GK  GII     G+ GFGYDP+F       T  ++T EEK
Sbjct: 116 GYYMCVVALVWPNGKVITAQGKCEGIIRDFEEGENGFGYDPLFYLPEKKCTMAQLTLEEK 175

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           N                +SHR +A K  ++   ++
Sbjct: 176 NK---------------ISHRGKAIKNLIEKLKKL 195


>gi|329121124|ref|ZP_08249755.1| ribonuclease PH/Ham1 protein [Dialister micraerophilus DSM 19965]
 gi|327471286|gb|EGF16740.1| ribonuclease PH/Ham1 protein [Dialister micraerophilus DSM 19965]
          Length = 195

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 113/215 (52%), Gaps = 22/215 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAKNA 66
            IV+A+ N  KI E   +   LG    +  ++  +  PEETG +FEENA+ K+   +K  
Sbjct: 2   KIVLATKNKGKIKEFKKVFSELGWEAVAISDIAYVKEPEETGKTFEENAINKAKYYSKAV 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            MP L+DDSG++ DVL  +PGI+SAR+A  +  ++  +    K+ + LR    +    RS
Sbjct: 62  SMPVLADDSGIIADVLKDRPGIYSARYAGVHGDDKANN---SKLVDKLR---LYKENERS 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            +++ V++L WP+G V    GK  GII     G+ GFGYDP+F       T  ++T EEK
Sbjct: 116 GYYMCVIALVWPNGKVITAQGKCEGIIRDFEEGENGFGYDPLFYLPEKKCTMAQLTLEEK 175

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           N                +SHR +A K  ++   ++
Sbjct: 176 NK---------------ISHRGKAIKNLIEKLKKL 195


>gi|269128061|ref|YP_003301431.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermomonospora curvata DSM 43183]
 gi|268313019|gb|ACY99393.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermomonospora curvata DSM 43183]
          Length = 205

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 109/212 (51%), Gaps = 21/212 (9%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP--EETGNSFEENAMIKSLTAAK 64
             IV+A+ N  K+ E+  +   LG +    LE     P  +ET  +F  NA++K+   A 
Sbjct: 2   TKIVLATRNFGKVAELRRI---LGGIEVVGLEEFPDAPDVQETEPTFAGNALLKARAIAA 58

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           + G+PA++DDSGL +D L+G PG+ SARW+    G+   D     +E  L       P  
Sbjct: 59  HTGLPAIADDSGLCVDALNGMPGVLSARWS-GRFGQAAGDKDRANLELVLDQLADVPPER 117

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R AHF   ++L  P G      G+++G I+  PRG+ GFGYDPIF P+G  RT  E++ +
Sbjct: 118 RGAHFACAVALVTPGGIERIVEGRMTGRIIDRPRGEGGFGYDPIFVPDGGTRTSAELSPQ 177

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           EK               D +SHR +A +   +
Sbjct: 178 EK---------------DAVSHRGKALRALAE 194


>gi|313894022|ref|ZP_07827588.1| non-canonical purine NTP pyrophosphatase RdgB [Veillonella sp. oral
           taxon 158 str. F0412]
 gi|313441586|gb|EFR60012.1| non-canonical purine NTP pyrophosphatase RdgB [Veillonella sp. oral
           taxon 158 str. F0412]
          Length = 191

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 106/207 (51%), Gaps = 26/207 (12%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAKNA 66
            IV+A+ N  KI E       L I      E+  I  PEETG +F ENA++K+   AK  
Sbjct: 3   QIVLATGNKGKIREFSEAFSHLSIDCVPVKEVVTIEEPEETGTTFMENALLKAHYYAKAT 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAFR 125
             P L+DDSG+ +D L+G PG++SAR+A    G    D A  +K+   L+ K     + R
Sbjct: 63  NRPCLADDSGITVDALNGAPGVYSARYA----GHHGDDQANNEKLIRELQGK-----SDR 113

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           + H++  L+L +PDG      G   G++   P+G  GFGYDP F    +++T  E+T EE
Sbjct: 114 TGHYVCALALVYPDGREVTAEGYCDGLVQDEPKGDNGFGYDPYFYVPQFEKTMAELTIEE 173

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFK 212
           K               + +SHR RA +
Sbjct: 174 K---------------ETISHRGRALR 185


>gi|239941571|ref|ZP_04693508.1| hypothetical protein SrosN15_11284 [Streptomyces roseosporus NRRL
           15998]
 gi|239988036|ref|ZP_04708700.1| hypothetical protein SrosN1_12068 [Streptomyces roseosporus NRRL
           11379]
 gi|291445014|ref|ZP_06584404.1| ribonuclease ham1 family protein [Streptomyces roseosporus NRRL
           15998]
 gi|291347961|gb|EFE74865.1| ribonuclease ham1 family protein [Streptomyces roseosporus NRRL
           15998]
          Length = 200

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 119/217 (54%), Gaps = 38/217 (17%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMIKS 59
           +++A+ N  KI E+ +      I+  + L+L+L+        P+  ETG +F ENA++K+
Sbjct: 4   LILATRNAGKITELHA------ILADAGLDLDLVGADAYPDFPDVKETGVTFAENALLKA 57

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKF 118
              A+  G+PA++DDSGL +DVL G PGI SARW+ ++  ++ + D+ + ++ +      
Sbjct: 58  HALARATGLPAVADDSGLCVDVLGGAPGIFSARWSGTHGDDKANLDLLLAQLGDI----- 112

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
             D   R A+F    +LA PDG      G+++GI+   P G  GFGYDPI QP+G  RT 
Sbjct: 113 --DTPHRGAYFACAAALALPDGTERVVEGRLNGILRDTPSGTNGFGYDPILQPDGETRTC 170

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            E+T  EKN                +SHR +AF+  V
Sbjct: 171 AELTPAEKNA---------------ISHRGKAFRALV 192


>gi|194017103|ref|ZP_03055715.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacillus pumilus ATCC 7061]
 gi|194010971|gb|EDW20541.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacillus pumilus ATCC 7061]
          Length = 197

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 103/204 (50%), Gaps = 22/204 (10%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAGM 68
           +IA+HN  K  E  +++ P G    +  ++      EETG +FEENA+IK+      AG 
Sbjct: 5   IIATHNAGKAKEFKAILEPKGFTVKTLADIGFTEEIEETGQTFEENAIIKAEAIQAKAGE 64

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
             ++DDSGL ID L GKPG++SAR+A    GE   D   + +E  L      +   R+A 
Sbjct: 65  MVIADDSGLSIDFLGGKPGVYSARYA----GEHKND--AENVEKVLSELQGIEKEDRTAR 118

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F   L+++ P    +   G V G I   P G+ GFGYDPIF     D+T  E++ EEKN 
Sbjct: 119 FRCALAVSIPGKETKTVEGSVEGFIAEEPIGENGFGYDPIFIVKDKDQTMAELSPEEKNK 178

Query: 189 GIDSATLFSILSTDLLSHRARAFK 212
                          +SHRA A +
Sbjct: 179 ---------------ISHRAVALQ 187


>gi|167628595|ref|YP_001679094.1| non-canonical purine ntp pyrophosphatase, rdgb, putative
           [Heliobacterium modesticaldum Ice1]
 gi|167591335|gb|ABZ83083.1| non-canonical purine ntp pyrophosphatase, rdgb, putative
           [Heliobacterium modesticaldum Ice1]
          Length = 213

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 106/189 (56%), Gaps = 19/189 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI----IPE-----ETGNSFEENAMIK 58
           NI++A+ N+ K+ E +++        T AL +  +     P+     ETG++F +NA++K
Sbjct: 3   NIILATQNMGKVREFEAMTR----AQTPALPIRWLSLRDFPQITELKETGDTFRDNALMK 58

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
           +   A+  G+PA++DDSGLV+D L+G PG++SAR+A     +R  +  + K+   +   F
Sbjct: 59  AEQVARACGVPAMADDSGLVVDALNGAPGVYSARFAGEPKDDRRNNEKLLKLLQEV--PF 116

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
                 R A F+ VL+LA PDG      G   G+I    RG  GFGYDP+F    Y++TF
Sbjct: 117 EQ----RKARFVCVLALAMPDGQKFFAEGVCDGVIATEGRGDGGFGYDPLFYLPAYEKTF 172

Query: 179 GEMTEEEKN 187
            E+  E KN
Sbjct: 173 AELPAELKN 181


>gi|320010559|gb|ADW05409.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Streptomyces flavogriseus ATCC 33331]
          Length = 200

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 116/213 (54%), Gaps = 26/213 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGI---MTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
             +++A+ N  KI E+ +++   G+   +  +    ++   +ETG +F ENA++K+   A
Sbjct: 2   TRLILATRNAGKITELHAILADAGLTHDLVGADAYPDVPDVKETGVTFAENALLKAHALA 61

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAHDP 122
           +  G PA++DDSGL +DVL G PGI SARWA ++  +R + ++ + ++ +        D 
Sbjct: 62  RATGHPAVADDSGLCVDVLGGAPGIFSARWAGAHGNDRANLELLLAQLGDI-------DI 114

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A+F    +LA PDG      G+++G +   P G  GFGYDPI QP+G  RT  E+T
Sbjct: 115 PHRGAYFACAAALALPDGTERVVEGRLTGTLRTAPAGAYGFGYDPILQPDGETRTCAELT 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            EEKN                +SHR +AF+  V
Sbjct: 175 PEEKNA---------------ISHRGKAFRALV 192


>gi|162419754|ref|YP_001604772.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis Angola]
 gi|162352569|gb|ABX86517.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           Angola]
          Length = 219

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 24  QKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQTT 83

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD-FDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR+A ++  +++  +  +  ++N    K       R
Sbjct: 84  GLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQENLEKLLVALQNVPDEK-------R 136

Query: 126 SAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+     F G+  G+I   P G  GFGYDPIF      +T  E
Sbjct: 137 GAQFHCVLVYMR---HAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPALGKTAAE 193

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 194 LTREEKHA---------------VSHRGQALKLMLD 214


>gi|300769996|ref|ZP_07079875.1| nucleoside-triphosphatase [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300762472|gb|EFK59289.1| nucleoside-triphosphatase [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 191

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 114/209 (54%), Gaps = 29/209 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLTAAKNA 66
           ++ A++N  K+ E+ +++     M  S  ++N    IPE TG++FEENA  K+       
Sbjct: 4   LIFATNNAHKLDEVRAIVGD-AFMIKSLDDINCQDDIPE-TGDTFEENAKQKTDYLVNKY 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+    DDSGL I+ ++ +PG++SAR++ S   ER+ D+ ++K+          D   R 
Sbjct: 62  GLYCFGDDSGLEIEAINNEPGVYSARYSGSRDMERNIDLVLEKLA---------DSENRK 112

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F +V+SL + +     F G ++G I+   RG  GFGYDPIF P+GYD+TF EM+ +EK
Sbjct: 113 ARFRTVISL-FLNEQQHFFEGAITGTIISERRGAEGFGYDPIFIPDGYDKTFAEMSVDEK 171

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFV 215
           NG               +SHR+ A K   
Sbjct: 172 NG---------------ISHRSIAVKALT 185


>gi|108806317|ref|YP_650233.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis Antiqua]
 gi|108813302|ref|YP_649069.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis Nepal516]
 gi|145597877|ref|YP_001161953.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis Pestoides F]
 gi|149367046|ref|ZP_01889079.1| hypothetical protein YPE_2324 [Yersinia pestis CA88-4125]
 gi|161484757|ref|NP_670630.2| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis KIM 10]
 gi|161511311|ref|NP_994774.2| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis biovar Microtus str. 91001]
 gi|165925126|ref|ZP_02220958.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|167399887|ref|ZP_02305405.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167468164|ref|ZP_02332868.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           FV-1]
 gi|218928117|ref|YP_002345992.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis CO92]
 gi|229837638|ref|ZP_04457800.1| dITP/XTP pyrophosphatase [Yersinia pestis Pestoides A]
 gi|229840864|ref|ZP_04461023.1| dITP/XTP pyrophosphatase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229842575|ref|ZP_04462730.1| dITP/XTP pyrophosphatase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229903765|ref|ZP_04518878.1| dITP/XTP pyrophosphatase [Yersinia pestis Nepal516]
 gi|22653761|sp|Q8ZHF4|NTPA_YERPE RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|108776950|gb|ABG19469.1| hypothetical protein YPN_3142 [Yersinia pestis Nepal516]
 gi|108778230|gb|ABG12288.1| hypothetical protein YPA_0320 [Yersinia pestis Antiqua]
 gi|115346728|emb|CAL19611.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145209573|gb|ABP38980.1| hypothetical protein YPDSF_0570 [Yersinia pestis Pestoides F]
 gi|149290660|gb|EDM40736.1| hypothetical protein YPE_2324 [Yersinia pestis CA88-4125]
 gi|165923326|gb|EDR40477.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|167050595|gb|EDR62003.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|229679535|gb|EEO75638.1| dITP/XTP pyrophosphatase [Yersinia pestis Nepal516]
 gi|229690885|gb|EEO82939.1| dITP/XTP pyrophosphatase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229697230|gb|EEO87277.1| dITP/XTP pyrophosphatase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229704326|gb|EEO91337.1| dITP/XTP pyrophosphatase [Yersinia pestis Pestoides A]
 gi|262364868|gb|ACY61425.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis D182038]
 gi|320013973|gb|ADV97544.1| dITP/XTP pyrophosphatase [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 197

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 2   QKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQTT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD-FDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR+A ++  +++  +  +  ++N    K       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQENLEKLLVALQNVPDEK-------R 114

Query: 126 SAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+     F G+  G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 GAQFHCVLVYMR---HAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPALGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKHA---------------VSHRGQALKLMLD 192


>gi|331086330|ref|ZP_08335410.1| Ham1 family protein [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330406096|gb|EGG85619.1| Ham1 family protein [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 202

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 112/210 (53%), Gaps = 24/210 (11%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAA 63
           +E  I+ A+ N DK+ E+  ++  LGI+ +S  E  + +   E G +FEENAMIK+   A
Sbjct: 1   MERKIIFATGNQDKMKEIQMILEDLGIVVSSMKEAGIDVDIVEDGTTFEENAMIKAEAIA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTG-ERDFDMAMQKIENALRSKFAHDP 122
           K      L+DDSGL ID L+ +PGI+SAR+A ++T  E   ++ +Q++E     K     
Sbjct: 61  KLTDAIVLADDSGLEIDYLNKEPGIYSARYAGTDTSYEIKNNLLLQRLEGVPDEK----- 115

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F+  ++  +PDG  E   G + G I +   G+ GFGYDPIF    Y  T  E+ 
Sbjct: 116 --RTARFVCAIAAVFPDGSKETVRGTIEGRIGYEIAGEHGFGYDPIFYLPEYGCTTAELD 173

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            E+KN                LSHR +A +
Sbjct: 174 PEKKNE---------------LSHRGKALR 188


>gi|157273476|gb|ABV27375.1| non-canonical purine NTP pyrophosphatase RdgB/HAM1 family protein
           [Candidatus Chloracidobacterium thermophilum]
          Length = 203

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 109/213 (51%), Gaps = 25/213 (11%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAA 63
           +  ++++A+ N  K+ E   L+  L +          ++P  ET  +FE NA +K+ T  
Sbjct: 3   LPTSLILATRNAGKLVEFRHLLADLNLEVIGLDAFPTVLPVRETETTFEANARLKARTVQ 62

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDP 122
              G   ++DDSGL++D LDG PG+ SAR+A    GE+  D   + K+  ALR+     P
Sbjct: 63  AQTGGWVIADDSGLLVDALDGAPGVFSARYA----GEQASDAENIAKLLAALRNV---PP 115

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F+ VL+L         F+G  +G +   PRGQ GFGYDP+F P G  RTF EMT
Sbjct: 116 DQRTAQFVCVLALVTETDEA-CFTGICTGRLTDAPRGQYGFGYDPLFIPAGDTRTFAEMT 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            EEK                  SHRARA +  V
Sbjct: 175 LEEKAA---------------YSHRARAARALV 192


>gi|269955861|ref|YP_003325650.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Xylanimonas cellulosilytica DSM 15894]
 gi|269304542|gb|ACZ30092.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Xylanimonas cellulosilytica DSM 15894]
          Length = 229

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 116/225 (51%), Gaps = 40/225 (17%)

Query: 8   NIVIASHNVDKIHEMDSLI--------MPLGIMTTSALELNLIIPEETGNSFEENAMIKS 59
            +V+A+HN  K+ E+ +++        +P   + T+A EL +  P E G +FEENA+IK+
Sbjct: 16  RLVLATHNRKKLVELIAILRSQPGLAELPDDAVVTAA-ELGVPEPVEDGVTFEENALIKA 74

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKF 118
              A+  G+ A++DDSGL +DVL G PGI SARWA  +  ++ + D+ + ++        
Sbjct: 75  RALARATGLAAVADDSGLAVDVLGGAPGIFSARWAGRHGDDQANLDLLLAQL------GA 128

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGY---- 174
              P  R A F+   +L  PDG  E   G++ G +V  PRG  GFGYDPI  P+      
Sbjct: 129 ISKPIHRRAGFVCAAALVTPDGDEEVRRGEMRGTLVDVPRGTNGFGYDPILVPDAQHPAV 188

Query: 175 -----DRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
                +RT  E++ EEKN                +SHR  AF+  
Sbjct: 189 DGGPGNRTSAELSPEEKNA---------------ISHRGEAFRAL 218


>gi|126652648|ref|ZP_01724809.1| hypothetical protein BB14905_22818 [Bacillus sp. B14905]
 gi|126590497|gb|EAZ84615.1| hypothetical protein BB14905_22818 [Bacillus sp. B14905]
          Length = 197

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 100/180 (55%), Gaps = 8/180 (4%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNA 66
            +VIA+ N  K  + ++L  PLG    +  E+   +  EETG +FEENA++K+   AKN 
Sbjct: 3   QVVIATKNKGKAKDFEALFGPLGYEVVTMFEVAPDMEIEETGTTFEENAILKAEALAKNL 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G   ++DDSGL +D L+G+PG++SAR+A    G+ D +  M K+   L+     +   R+
Sbjct: 63  GTIVIADDSGLAVDALNGEPGVYSARYA----GDHDDEANMVKLLENLQGV---EDGKRT 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F   +++A PD       G   G+I    RG  GFGYDPIF     +R   E+T EEK
Sbjct: 116 ARFCCCIAIAGPDFETTTVFGTCEGVIAHEKRGTNGFGYDPIFFVPSLNRMMAELTPEEK 175


>gi|134097803|ref|YP_001103464.1| Ham1-like protein [Saccharopolyspora erythraea NRRL 2338]
 gi|291005561|ref|ZP_06563534.1| Ham1-like protein [Saccharopolyspora erythraea NRRL 2338]
 gi|133910426|emb|CAM00539.1| Ham1-like protein [Saccharopolyspora erythraea NRRL 2338]
          Length = 201

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 115/214 (53%), Gaps = 27/214 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPE--ETGNSFEENAMIKSLTA 62
           + +++A+ N  K+ E+  ++   G+     + L+ +   PE  ETG +FE+NA+ K++ A
Sbjct: 2   SRVLLATRNAKKLLELRRILEAEGVTGVEVVGLDEVPEFPEAPETGATFEDNALAKAVDA 61

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAHD 121
           A+  G+P+++DDSGL +D L+G PG+ SARW+  +  ++ + D+ + ++++    +    
Sbjct: 62  AEATGLPSVADDSGLAVDALNGMPGVLSARWSGRHGDDQANLDLVLGQLQDVPDER---- 117

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F+S  +L  P G      G+  G I+   RG  GFGYDPIF P G  RT  E+
Sbjct: 118 ---RGAAFVSAAALVLPGGEEVVVRGEWRGTIIREERGTNGFGYDPIFVPEGETRTSAEL 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           + EEK               D  SHR RA +  +
Sbjct: 175 SPEEK---------------DADSHRGRALRLLL 193


>gi|270308395|ref|YP_003330453.1| hypothetical protein DhcVS_1008 [Dehalococcoides sp. VS]
 gi|270154287|gb|ACZ62125.1| hypothetical protein DhcVS_1008 [Dehalococcoides sp. VS]
          Length = 199

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 102/182 (56%), Gaps = 9/182 (4%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAKNA 66
            +++AS+N  K+ E  SL+   G    +  ++ + I   ETG +FEENA +K+   A+ +
Sbjct: 3   KLLLASNNRGKLREYASLLSGSGFELVTPADMGIDITVAETGTTFEENARLKAAALAEAS 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFD-MAMQKIENALRSKFAHDPAFR 125
           G+  L+DDSGL +D L G+PG++SAR+A  N  + D +   + K+EN    K       R
Sbjct: 63  GLLTLADDSGLTVDALGGEPGVYSARYAGENALDTDRNKYILSKLENIPAEK-------R 115

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F  V+++A P   +  F G   G+I   PRG  GFGYDP+F    Y +T  E+  E 
Sbjct: 116 TARFRCVIAIAQPGHIIATFEGTCEGVISTEPRGTNGFGYDPVFYLPEYGKTMAELPSEI 175

Query: 186 KN 187
           KN
Sbjct: 176 KN 177


>gi|238763265|ref|ZP_04624230.1| Nucleoside-triphosphatase [Yersinia kristensenii ATCC 33638]
 gi|238698538|gb|EEP91290.1| Nucleoside-triphosphatase [Yersinia kristensenii ATCC 33638]
          Length = 197

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 112/219 (51%), Gaps = 37/219 (16%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 2   QKIVLATGNPGKVRELANLLADFGLDVIAQTELGVESAEETGLTFIENAILKARHAAQTT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD----FDMAMQKIENALRSKFAHDP 122
           G+PA++DDSGL +D LDG PGI+SAR+A     +++      +A++ I NA         
Sbjct: 62  GLPAIADDSGLAVDALDGAPGIYSARYAGIEASDQENLEKLLVALKDIPNAQ-------- 113

Query: 123 AFRSAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
             R A F  VL       H E+     F G+  G+I   P G  GFGYDPIF      +T
Sbjct: 114 --RGAQFHCVLVYMR---HAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPELGKT 168

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
             E+T EEK+                +SHR +A K  +D
Sbjct: 169 AAELTREEKHA---------------VSHRGQALKLMLD 192


>gi|332638683|ref|ZP_08417546.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Weissella cibaria KACC 11862]
          Length = 198

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 111/210 (52%), Gaps = 23/210 (10%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNAG 67
           ++ AS N  K+ E    + PLG+   S  EL N+    E GN+F+ENA IK+ T AK   
Sbjct: 4   LIFASKNEGKVREFREFLTPLGVEVVSLNELENVPTIIEDGNTFQENATIKAETIAKAFN 63

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +P +++D+GL +D LDG PG+HSAR+A    G+ D      K+   LR       A R+A
Sbjct: 64  VPVVAEDAGLTVDALDGAPGVHSARYA----GDHDDAANNAKL---LRELADVADADRTA 116

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F +V+    PDG     SGKV G I+   +G  GFGYDP+F    + ++FGE+T  EKN
Sbjct: 117 SFHAVIVAIKPDGKRLVASGKVDGRILRAAQGSDGFGYDPLFFYEPFGKSFGELTPAEKN 176

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDN 217
                           +SHR  A + F+ +
Sbjct: 177 E---------------ISHRGAALQQFMSD 191


>gi|22299340|ref|NP_682587.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Thermosynechococcus elongatus BP-1]
 gi|62900290|sp|Q8DHZ6|NTPA_THEEB RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|22295523|dbj|BAC09349.1| tll1797 [Thermosynechococcus elongatus BP-1]
          Length = 194

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 104/187 (55%), Gaps = 20/187 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMP-LG--IMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           I    V+ASHN  K+ E    + P +G  +   +A+E+      ET +SF  NA +K+ T
Sbjct: 3   ILAQAVLASHNAGKVKEFQGWLQPWIGELVALPAAIEIA-----ETADSFVANACLKAAT 57

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G  A++DDSGL +  L G PGI+SAR+  ++          ++IE  LR     D
Sbjct: 58  AAKVMGEWAIADDSGLAVHALQGAPGIYSARYGATDA---------ERIERLLREM--AD 106

Query: 122 PAFRSAHFISVLSLAWPDGHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            + R+A FI V++LA PDG +     G+ +G I+  PRGQ GFGYDP+F      RTF E
Sbjct: 107 VSDRAAEFICVIALARPDGTIAVTTEGRCAGEILTAPRGQGGFGYDPVFWVPSQQRTFAE 166

Query: 181 MTEEEKN 187
           M+  EK 
Sbjct: 167 MSPVEKQ 173


>gi|229822945|ref|ZP_04449015.1| hypothetical protein GCWU000282_00237 [Catonella morbi ATCC 51271]
 gi|229787758|gb|EEP23872.1| hypothetical protein GCWU000282_00237 [Catonella morbi ATCC 51271]
          Length = 203

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 107/209 (51%), Gaps = 22/209 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNA 66
            +VIA+ N  K+ E + L+ P GI   S L+  +L   EETG+SFE NA +K+ + AK  
Sbjct: 5   KLVIATQNKGKVAEFERLLGPKGIEVVSLLDYPDLPEVEETGDSFEANARLKAESIAKLL 64

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +P L+DDSGLV+  L+G PGI+SAR+A    G+   D A   I+  LR         R 
Sbjct: 65  NLPVLADDSGLVVPYLNGAPGIYSARYA----GQPKSDKA--NIDKLLREMSQARGDQRQ 118

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A+F++ L LA PD       G+  G I   P G  GFGYDP+F  +    TF ++    K
Sbjct: 119 AYFVTCLVLASPDHDSYVVEGRAYGTIALEPSGDSGFGYDPVFYVDQEGATFAQIPLSRK 178

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFV 215
           N                +SHRA A K  +
Sbjct: 179 NQ---------------ISHRANAIKALL 192


>gi|116075583|ref|ZP_01472842.1| Ham1-like protein [Synechococcus sp. RS9916]
 gi|116066898|gb|EAU72653.1| Ham1-like protein [Synechococcus sp. RS9916]
          Length = 195

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 101/198 (51%), Gaps = 14/198 (7%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +VIAS N  KI E   L+  L +      E   +  EETG +F ENA IK+   A   
Sbjct: 4   RTLVIASGNAGKIREFAGLLEHLPLTMKPQPEGMEV--EETGLTFAENARIKARAVAAAT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G  AL+DDSGL +D LDG PG+ SAR+AES+           +I   L+     D   RS
Sbjct: 62  GHWALADDSGLSVDALDGAPGVFSARYAESDPA---------RIARLLQE--LGDTDNRS 110

Query: 127 AHFISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           A+F + L +A PDG V     G+  G+I   PRG  GFGYDPIF+  G  +TF EM  E 
Sbjct: 111 AYFSAALCIAAPDGSVLVEVEGRCDGVITTTPRGAEGFGYDPIFEVLGTGQTFAEMDRER 170

Query: 186 KNGGIDSATLFSILSTDL 203
           K         F++L   L
Sbjct: 171 KKSHGHRGRAFTLLEPQL 188


>gi|218960846|ref|YP_001740621.1| Xanthosine triphosphate pyrophosphatase [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729503|emb|CAO80414.1| Xanthosine triphosphate pyrophosphatase [Candidatus Cloacamonas
           acidaminovorans]
          Length = 196

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 112/213 (52%), Gaps = 34/213 (15%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNA 66
           +I+IA+HN DK+ E++ L+ PL +      EL    P EE   + ++NAM K+L AAK +
Sbjct: 4   DILIATHNPDKLKELEELVNPLKLRLYFLRELPGFYPTEEDQETLQKNAMKKALEAAKYS 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA----MQKIENALRSKFAHDP 122
           G+  L+DD+GL I+ L+  PGI SAR+A ++    D        +Q I+N          
Sbjct: 64  GLITLADDTGLFIEALNEAPGIMSARFAGNSCSYSDNRQKVLRLLQNIQN---------- 113

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A+F + ++L+ PDG +    G++ G I    RG  GFGYD IF  NG  +T+ EM 
Sbjct: 114 --RKAYFKTAVALSAPDGIIAVTEGRLEGEITTEERGNNGFGYDSIFAVNG--KTYAEMN 169

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            +EKN                LSHRA A K  +
Sbjct: 170 ADEKNR---------------LSHRALAIKSLI 187


>gi|317131325|ref|YP_004090639.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ethanoligenens harbinense YUAN-3]
 gi|315469304|gb|ADU25908.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ethanoligenens harbinense YUAN-3]
          Length = 196

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 96/181 (53%), Gaps = 7/181 (3%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAKNA 66
             V A+ N  K+ E+  ++ PLG    S  E  +   PEETG +F ENA IK+    K A
Sbjct: 2   TFVAATGNAHKLTEIRRILAPLGHDVISQREAGVACDPEETGATFAENARIKAEAVCKAA 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G PA++DDSGL +D LDG PG++SAR+A ++  + D      +I   L +        R+
Sbjct: 62  GRPAVADDSGLCVDALDGAPGVYSARYAGAHATDDD------RIAKLLAALSGVPEEKRT 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+S +   +PDG      G   G + +   G  GFGYDP+F      +TF  ++ EEK
Sbjct: 116 ARFVSAICCLFPDGREIAVEGVCEGRVAFAKDGTDGFGYDPVFIEAESGKTFAALSGEEK 175

Query: 187 N 187
           +
Sbjct: 176 D 176


>gi|165937309|ref|ZP_02225873.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166010358|ref|ZP_02231256.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166212659|ref|ZP_02238694.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167421956|ref|ZP_02313709.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167426705|ref|ZP_02318458.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|270487543|ref|ZP_06204617.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Yersinia pestis KIM D27]
 gi|294502892|ref|YP_003566954.1| deoxyribonucleotide triphosphate pyrophosphatase [Yersinia pestis
           Z176003]
 gi|21960274|gb|AAM86881.1|AE013934_4 putative ribosomal protein [Yersinia pestis KIM 10]
 gi|45438103|gb|AAS63651.1| Xanthosine triphosphate pyrophosphatase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|165914783|gb|EDR33396.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165990844|gb|EDR43145.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166205951|gb|EDR50431.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166960093|gb|EDR56114.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167054308|gb|EDR64127.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|270336047|gb|EFA46824.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Yersinia pestis KIM D27]
 gi|294353351|gb|ADE63692.1| deoxyribonucleotide triphosphate pyrophosphatase [Yersinia pestis
           Z176003]
          Length = 223

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 28  QKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQTT 87

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD-FDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR+A ++  +++  +  +  ++N    K       R
Sbjct: 88  GLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQENLEKLLVALQNVPDEK-------R 140

Query: 126 SAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+     F G+  G+I   P G  GFGYDPIF      +T  E
Sbjct: 141 GAQFHCVLVYMR---HAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPALGKTAAE 197

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 198 LTREEKHA---------------VSHRGQALKLMLD 218


>gi|327402746|ref|YP_004343584.1| dITPase [Fluviicola taffensis DSM 16823]
 gi|327318254|gb|AEA42746.1| dITPase [Fluviicola taffensis DSM 16823]
          Length = 200

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 116/216 (53%), Gaps = 30/216 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLTAAKNA 66
           ++ AS N  K+ E+++ I+P G    S  E++    IPE T ++ E NA+ K+   A   
Sbjct: 11  LLFASSNEHKLTEINA-ILPHGFQLISLKEIHFHDEIPE-TADTIEGNAIQKATFLADKM 68

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD-FDMAMQKIENALRSKFAHDPAFR 125
            +P  +DDSGL++  L+G+PG++SAR+A       D  D+ M+K++           + R
Sbjct: 69  NIPCFADDSGLIVPSLNGEPGVYSARYAGPQRDANDNMDLVMEKLDQQ---------SDR 119

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           SA+F ++++L +    V  F G++ G I+   RG  GFGYDPIF PNG D+TF EMT EE
Sbjct: 120 SAYFTTIIAL-YIHHKVHLFEGRIDGTIIHEKRGNNGFGYDPIFVPNGSDKTFAEMTTEE 178

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           K+                +SHR +A     +   RI
Sbjct: 179 KSA---------------MSHRGKALAKMTEYLKRI 199


>gi|303236745|ref|ZP_07323324.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella disiens FB035-09AN]
 gi|302482913|gb|EFL45929.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella disiens FB035-09AN]
          Length = 192

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 112/205 (54%), Gaps = 25/205 (12%)

Query: 9   IVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           IV A++N  K+ E+ +++     I++   +  N+ IPE T  + E NA IKS     N  
Sbjct: 3   IVFATNNEHKLSEIKNILGSCFEIVSLKDIGCNVDIPE-TAQTLEGNASIKSHFIYDNYH 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +   +DD+GL +D L+G+PG+HSAR+ E    + D +  M+K    L +K   D A R+A
Sbjct: 62  LNCFADDTGLEVDALNGEPGVHSARYDEHT--DHDSEANMRK----LLAKLG-DNANRNA 114

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           HF +V+SL   DG    F G+V G I     G  GFGYDPIF P GYD++F E+ E+ KN
Sbjct: 115 HFRTVISLII-DGEEHQFEGRVDGKIATEKSGTEGFGYDPIFIPEGYDKSFAELGEQIKN 173

Query: 188 GGIDSATLFSILSTDLLSHRARAFK 212
                           +SHRARA +
Sbjct: 174 ---------------QISHRARAVQ 183


>gi|312139209|ref|YP_004006545.1| ham1 family protein [Rhodococcus equi 103S]
 gi|325673485|ref|ZP_08153176.1| ribonuclease PH/Ham1 protein [Rhodococcus equi ATCC 33707]
 gi|311888548|emb|CBH47860.1| Ham1 family protein [Rhodococcus equi 103S]
 gi|325555506|gb|EGD25177.1| ribonuclease PH/Ham1 protein [Rhodococcus equi ATCC 33707]
          Length = 203

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 105/188 (55%), Gaps = 12/188 (6%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPE--ETGNSFEENAMIKSL 60
           +   I++AS N  K+ E+  ++   GI     + L+ +   PE  ETG +FE NA++K++
Sbjct: 1   MSGKILVASRNAKKLGELRRVLAAAGIEGLEVIGLDEVPEFPETPETGATFEANAIVKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             A   G+P ++DDSGL +D L+G PG+ SARW+    G+ D + A+      L  + A 
Sbjct: 61  DGAAATGLPCVADDSGLEVDALNGMPGVLSARWS-GRHGDDDANTAL------LLGQLAD 113

Query: 121 DP-AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
            P   R A F+S  +LA P        G+  G IV  PRG  GFGYDP+F+P G  RT  
Sbjct: 114 VPDERRGAAFVSACALAIPGQDTVVVRGEWRGRIVREPRGDNGFGYDPVFEPEGDRRTSA 173

Query: 180 EMTEEEKN 187
           E++ +EK+
Sbjct: 174 ELSPQEKD 181


>gi|288801798|ref|ZP_06407240.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella melaninogenica D18]
 gi|288335840|gb|EFC74273.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella melaninogenica D18]
          Length = 194

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 111/205 (54%), Gaps = 25/205 (12%)

Query: 9   IVIASHNVDKIHEM-DSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           IV A++N  K+ E+ D L     I++ + +  +  IPE TG + EENA  KS    ++ G
Sbjct: 3   IVFATNNKHKLEEIKDILGKDFEIVSLAEIGCHEDIPE-TGATLEENARQKSSYVVEHYG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
               +DD+GL ++ L G+PG+HSAR+A+    + D +  M+K+   L  K     A R A
Sbjct: 62  QNCFADDTGLEVEALGGEPGVHSARYAKGT--DHDSEANMRKLLANLEGK-----ANRKA 114

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           +F +++SL   DG    F GKV G I     G  GFGYDPIF P GYD++F E+ EE KN
Sbjct: 115 YFRTIISLII-DGVEHQFEGKVEGRIATENHGTEGFGYDPIFIPEGYDKSFAELGEEIKN 173

Query: 188 GGIDSATLFSILSTDLLSHRARAFK 212
                           +SHRARA K
Sbjct: 174 ---------------QISHRARAVK 183


>gi|169829486|ref|YP_001699644.1| HAM1-like protein [Lysinibacillus sphaericus C3-41]
 gi|168993974|gb|ACA41514.1| HAM1-like protein [Lysinibacillus sphaericus C3-41]
          Length = 197

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 99/180 (55%), Gaps = 8/180 (4%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNA 66
            +VIA+ N  K  + ++L  PLG    +  E+   +  EETG +FEENA++K+   AKN 
Sbjct: 3   QVVIATKNKGKAKDFEALFGPLGYEVVTMFEVAPDMEIEETGTTFEENAILKAEALAKNL 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G   ++DDSGL +D L+G+PG++SAR+A  +  E +    ++ ++     K       R+
Sbjct: 63  GTIVIADDSGLAVDALNGEPGVYSARYAGDHDDEANMVKLLENLQGVEDDK-------RT 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F   +++A PD +     G   G+I    RG  GFGYDPIF     +R   E+T EEK
Sbjct: 116 ARFCCCIAIAGPDFNTTTVFGTCEGVIAHEKRGTNGFGYDPIFFVPSLNRMMAELTPEEK 175


>gi|251788393|ref|YP_003003114.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Dickeya
           zeae Ech1591]
 gi|247537014|gb|ACT05635.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Dickeya
           zeae Ech1591]
          Length = 197

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
            N+V+A+ N  K+ E+  L+   G+   +   L +   EETG +F ENA++K+  AA+  
Sbjct: 2   QNVVLATGNAGKVRELAGLLADFGLDVVAQTTLGVDSAEETGLTFIENAILKARHAARET 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTG-ERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR+A  N G +++ D  +  ++N    +       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYAGENAGDQQNLDKLLAALDNVPDEQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G+ GFGYDP+F      +T  E
Sbjct: 115 QASFHCVLVYLR---HAEDPTPLVCHGSWQGVIARTPAGEGGFGYDPVFFVPSIGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           ++ EEKN                LSHR +A +  +D
Sbjct: 172 LSREEKNA---------------LSHRGQALRQLLD 192


>gi|120553466|ref|YP_957817.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Marinobacter aquaeolei VT8]
 gi|120323315|gb|ABM17630.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Marinobacter aquaeolei VT8]
          Length = 199

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 78/218 (35%), Positives = 111/218 (50%), Gaps = 29/218 (13%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +VIAS+N  KI E+  L+ PLG+   +  EL +   EE   +F ENA+IK+  AA+
Sbjct: 1   MARKLVIASNNKGKIAELTDLLAPLGLQPVAQGELGVSEAEEPAVTFVENAIIKARHAAR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PAL+DDSGL +D LDG+PG+ SAR+A     + D       +E  L +      A 
Sbjct: 61  VTGLPALADDSGLAVDALDGRPGVRSARFAGEEATDND------NVEALLAALKDTPEAE 114

Query: 125 RSAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
           RSA F  VL       H ++ +     G+  G I+  PRGQ GFGYDP+F    +  +  
Sbjct: 115 RSAQFHCVLVYLR---HADDPTPIICHGRWPGRILAEPRGQGGFGYDPVFLVPEHGCSAA 171

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           E+T E+K                 +SHR RA    +D 
Sbjct: 172 ELTREQKG---------------RISHRGRALASLLDQ 194


>gi|300780584|ref|ZP_07090439.1| nucleoside-triphosphatase [Corynebacterium genitalium ATCC 33030]
 gi|300533570|gb|EFK54630.1| nucleoside-triphosphatase [Corynebacterium genitalium ATCC 33030]
          Length = 200

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 111/205 (54%), Gaps = 13/205 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII----PEETGNSFEENAMIKSLTAAK 64
           +++AS N  K+ E+++++  LGI     + L  +     P ETG +F ENA+IK+   A 
Sbjct: 3   VLVASGNAKKLGELETVLSELGIDGIELVSLRDVQAYPEPAETGLTFAENALIKARAGAA 62

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-A 123
             G+P ++DDSG+ +D L+G PG+ SARW    +G    D+A  ++   L ++ +  P  
Sbjct: 63  ATGLPCVADDSGIAVDALNGMPGVLSARW----SGGHGDDLANNEL---LLAQLSDIPDE 115

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYD-RTFGEMT 182
            R A F+S  +L  P G      G+  G ++  PRG  GFGYDP+FQP   D R+  E++
Sbjct: 116 HRGAAFVSCCALVVPGGSEVTAEGRWEGALLRAPRGSNGFGYDPLFQPADADGRSSAELS 175

Query: 183 EEEKNGGIDSATLFSILSTDLLSHR 207
            EEKN           L+T + + R
Sbjct: 176 AEEKNARSHRGKALRELATHIAALR 200


>gi|325662572|ref|ZP_08151172.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471069|gb|EGC74295.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 202

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 112/210 (53%), Gaps = 24/210 (11%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAA 63
           +E  I+ A+ N DK+ E+  ++  LGI+ +S  E  + +   E G +FEENAMIK+   A
Sbjct: 1   MERKIIFATGNQDKMKEIRMILEDLGIVVSSMKEAGIDVDIVEDGTTFEENAMIKAEAIA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTG-ERDFDMAMQKIENALRSKFAHDP 122
           K      L+DDSGL ID L+ +PGI+SAR+A ++T  E   ++ +Q++E     K     
Sbjct: 61  KLTDAIVLADDSGLEIDYLNKEPGIYSARYAGTDTSYEIKNNLLLQRLEGVPDEK----- 115

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F+  ++  +PDG  E   G + G I +   G+ GFGYDPIF    Y  T  E+ 
Sbjct: 116 --RTARFVCAIAAVFPDGSKETVRGTIEGRIGYEIAGEHGFGYDPIFYLPEYGCTTAELD 173

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            E+KN                LSHR +A +
Sbjct: 174 PEKKNE---------------LSHRGKALR 188


>gi|323489952|ref|ZP_08095173.1| HAM1-like protein [Planococcus donghaensis MPA1U2]
 gi|323396248|gb|EGA89073.1| HAM1-like protein [Planococcus donghaensis MPA1U2]
          Length = 201

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 104/180 (57%), Gaps = 7/180 (3%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNA 66
            IVIA+ N  K  + ++L+ PLG    + L++   +  EETG +FEENA++K+   +K  
Sbjct: 3   QIVIATQNKGKAKDFEALLSPLGYEVLTLLDVAQDMDVEETGTTFEENAILKAEAVSKAL 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +P +SDDSGL ID L+G+PG++SAR+A    GE+  +  + K+   L     ++   R+
Sbjct: 63  NIPVISDDSGLEIDALNGEPGVYSARYA---GGEKSDNANIDKVLEKLAGVAENE---RT 116

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F  VL++A P    + FSG   G I+   RG+ GFGYDPIF     ++   E+   EK
Sbjct: 117 ARFRCVLAVAAPGQQTQTFSGSCEGKILDVRRGENGFGYDPIFYVPSLEKAMAELLPPEK 176


>gi|227502999|ref|ZP_03933048.1| nucleoside-triphosphatase [Corynebacterium accolens ATCC 49725]
 gi|227076060|gb|EEI14023.1| nucleoside-triphosphatase [Corynebacterium accolens ATCC 49725]
          Length = 200

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 108/210 (51%), Gaps = 31/210 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-------PEETGNSFEENAMIKSLT 61
           I++AS N  K+ E+D ++   GI     +EL L+        P E G +F +NA+IK+  
Sbjct: 3   ILVASGNPKKLAELDRILSEAGI---EGVELRLLSEVEPYPEPVENGRTFADNALIKARA 59

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            A   G+  ++DDSGL I+ L+G PG+ SARW    +GE   D A   +  A  +    D
Sbjct: 60  GAAATGLVTIADDSGLAIEELNGMPGVLSARW----SGEHGNDQANNDLVLAQMADVPDD 115

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F+SV +L  P+G      G+  G ++  PRG  GFGYDP+FQP G  R+  EM
Sbjct: 116 --RRAAAFVSVCALVTPEGTERVAEGRWEGKLLREPRGANGFGYDPLFQPEGEPRSAAEM 173

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAF 211
           +  EKN                +SHR RA 
Sbjct: 174 SPAEKNA---------------VSHRGRAL 188


>gi|317050734|ref|YP_004111850.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfurispirillum indicum S5]
 gi|316945818|gb|ADU65294.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfurispirillum indicum S5]
          Length = 197

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 107/186 (57%), Gaps = 19/186 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP--EETGNSFEENAMIKSLTAAKN 65
            I++AS N  K+ E+  ++  +G+   S  EL + IP  EE G++F ENA+ K+ +A   
Sbjct: 2   KIILASKNRKKLIELREILRDIGVEVYSPEELEINIPDVEEDGSTFVENALKKARSAHLY 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDM----AMQKIENALRSKFAHD 121
           +G+PA++DDSG+ +D L G PG++SAR+A  +  + D +     A+ ++E+  R +FA  
Sbjct: 62  SGLPAIADDSGICVDALGGAPGVYSARYAGDHCDDDDNNRKLLDALSEVEDR-RGRFACA 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            A+              D       G   G+++  PRG+ GFGYDP+FQP G++ +FG +
Sbjct: 121 IAY------------VDDQQSHTVEGFCEGVVLRAPRGEGGFGYDPLFQPTGFEESFGSL 168

Query: 182 TEEEKN 187
            +E KN
Sbjct: 169 PKEVKN 174


>gi|333029556|ref|ZP_08457617.1| Nucleoside-triphosphatase rdgB [Bacteroides coprosuis DSM 18011]
 gi|332740153|gb|EGJ70635.1| Nucleoside-triphosphatase rdgB [Bacteroides coprosuis DSM 18011]
          Length = 195

 Score =  118 bits (295), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 115/213 (53%), Gaps = 28/213 (13%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPL-GIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           +E+ IV A+HN +K+ E+ +L+ PL  ++  + +  +  IPE T N+ E NA +KS    
Sbjct: 1   MEHKIVFATHNENKLKEVAALLSPLYHVVGLNDIGCHEDIPE-TENTLEGNAYLKSKYVY 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFAHDP 122
            + G+   SDD+GL +  L G+PG+ SAR+A    GE R+ D  M K+   L     HD 
Sbjct: 60  DHYGLDCFSDDTGLEVTALHGEPGVFSARYA----GEGRNSDDNMAKLLREL-----HDK 110

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             RSA F +V+SL    G   +F G V G I+   RG+ GFGYDPIFQP GY  TF E+ 
Sbjct: 111 TDRSAQFRTVISLILK-GEEHHFDGIVRGNIIEEKRGRAGFGYDPIFQPIGYAETFAELG 169

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            + KN                +SHRA A K  +
Sbjct: 170 SDVKNE---------------ISHRAIAVKKLI 187


>gi|328882701|emb|CCA55940.1| Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP,XTP-specific)
           [Streptomyces venezuelae ATCC 10712]
          Length = 200

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 117/219 (53%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ +      I+  + L+L L+       IP+  ETG +F ENA++
Sbjct: 2   TRLILATRNPGKITELHA------ILADAGLDLELVGADAYPEIPDVKETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRS 116
           K+   A+  G+PA++DDSGL +DVL+G PGI SARWA  +  +R + D+ + ++     S
Sbjct: 56  KAHALARATGLPAVADDSGLCVDVLNGAPGIFSARWAGRHGDDRANLDLLLAQL-----S 110

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
             A +   R AHF    +LA PDG      G++ G +   P G  GFGYDPI QP G+D 
Sbjct: 111 DIADE--HRGAHFACAAALALPDGTERVVEGRMEGTLRHTPTGTNGFGYDPILQPEGHDL 168

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T  EKN                +SHR +AF+   
Sbjct: 169 TCAELTPSEKNA---------------ISHRGKAFRALA 192


>gi|311278129|ref|YP_003940360.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Enterobacter cloacae SCF1]
 gi|308747324|gb|ADO47076.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Enterobacter cloacae SCF1]
          Length = 197

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 113/219 (51%), Gaps = 30/219 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  ELN+   EETG +F ENA++K+  AA+  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDVVAQTELNVESAEETGLTFLENAILKARHAAQIT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSGL +D L G PGI+SAR++  +  +R      Q +E  L +      A R 
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYSGVDATDR------QNLEKLLVALKDVPDAQRQ 115

Query: 127 AHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F   L       H E+ +     G+  G+I   P G  GFGYDPIF   G  +T  E+
Sbjct: 116 AQFHCALVYLR---HAEDPTPIVCLGRWPGVITHAPSGNGGFGYDPIFYVPGEGKTAAEL 172

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           T EEK+                +SHR +A K  + N LR
Sbjct: 173 TREEKSA---------------ISHRGQALKQLL-NALR 195


>gi|302344804|ref|YP_003813157.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella melaninogenica ATCC 25845]
 gi|302150228|gb|ADK96490.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella melaninogenica ATCC 25845]
          Length = 194

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 113/215 (52%), Gaps = 25/215 (11%)

Query: 8   NIVIASHNVDKIHEM-DSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
            IV A++N  K+ E+ D L     I++ + +  +  IPE TG + EENA  KS    ++ 
Sbjct: 2   KIVFATNNKHKLEEIKDILGKDFEIVSLAEIGCHEDIPE-TGATLEENARQKSSYVVEHY 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G    +DD+GL ++ L G+PG+HSAR+AE    + D +  M+K+   L  K       R 
Sbjct: 61  GQNCFADDTGLEVEALGGEPGVHSARYAEGT--DHDSEANMRKLLANLEGK-----DNRK 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F +++SL   DG    F GKV G I     G+ GFGYDPIF P GYD++F E+ EE K
Sbjct: 114 ACFRTIISLII-DGVEHQFEGKVKGRIATEKHGKEGFGYDPIFIPEGYDKSFAELGEEIK 172

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           N                +SHRARA K   +   R+
Sbjct: 173 N---------------QISHRARAVKKLAEYLGRL 192


>gi|291544316|emb|CBL17425.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ruminococcus sp. 18P13]
          Length = 199

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 107/207 (51%), Gaps = 24/207 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             I++A++N +K+ E+  ++ PLGI   S  +  + +  EETG +F ENA +K+    + 
Sbjct: 2   KQIILATNNQNKLREISQMLRPLGIEVLSQSQAGVQLDVEETGTTFAENAELKARAFYEK 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G P L+DDSGL +D L+G PG++S R+A  +  + D      +    L+         R
Sbjct: 62  TGKPVLADDSGLAVDALNGAPGVYSHRYAGEHATDAD------RCAKLLQELSGVPEQQR 115

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F+  +      G   +F GKV GII   P G+ GFGYDP+F+  G  ++F  +T EE
Sbjct: 116 TARFLCAMCYIDATGDAHSFLGKVEGIIGMVPEGENGFGYDPVFRYQG--KSFAVLTAEE 173

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFK 212
           KN                +SHRA A +
Sbjct: 174 KNA---------------VSHRADALR 185


>gi|294629579|ref|ZP_06708139.1| Ham1 family protein [Streptomyces sp. e14]
 gi|292832912|gb|EFF91261.1| Ham1 family protein [Streptomyces sp. e14]
          Length = 200

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 119/219 (54%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ +      I+T + L   L+       +P+  ETG +F ENA++
Sbjct: 2   TRLILATRNAGKITELRA------ILTDAGLPHELVGTDAYPEVPDVKETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRS 116
           K+   A+  G+PA++DDSGL +DVL G PGI SARW+  +  +R + D+ + ++     S
Sbjct: 56  KAHALAQATGLPAVADDSGLCVDVLGGAPGIFSARWSGRHGDDRANLDLLLAQL-----S 110

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
             A +   R+AHF    +LA PDG      G+++G +   P G  GFGYDPI QP+G  R
Sbjct: 111 DIAEE--HRAAHFACAAALALPDGTERVVEGRLTGTLRHAPAGANGFGYDPILQPDGETR 168

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T +EKN                +SHR +AF+  V
Sbjct: 169 TCAELTPQEKNA---------------ISHRGKAFRALV 192


>gi|227529709|ref|ZP_03959758.1| nucleoside-triphosphatase [Lactobacillus vaginalis ATCC 49540]
 gi|227350375|gb|EEJ40666.1| nucleoside-triphosphatase [Lactobacillus vaginalis ATCC 49540]
          Length = 198

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 113/213 (53%), Gaps = 25/213 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
           +++VIA+ N  K  E   +  P  I   +  + +  I   E G++F ENA IK+ T    
Sbjct: 2   DSLVIATKNQGKAREYREMFAPYNIDIKTLADFSTPIKINENGSTFLENATIKAQTVMAK 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF- 124
            G+P ++DDSGLV+D L+G PG+HSAR+A    G+ D D A  K    L  + A  P   
Sbjct: 62  LGVPVMADDSGLVVDALNGAPGVHSARYA----GDHD-DQANNK---KLLRELAGVPTMK 113

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+AHF + +    PDG     +G+V G I+  PRG+ GFGYDP+F    +D +  E+T E
Sbjct: 114 RTAHFHTTIVALKPDGAKLVANGRVDGRILTSPRGKNGFGYDPLFYVEKFDCSMAELTAE 173

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           +KN                +SHR +A + F+ +
Sbjct: 174 QKNS---------------ISHRGQALEEFLQH 191


>gi|154482816|ref|ZP_02025264.1| hypothetical protein EUBVEN_00500 [Eubacterium ventriosum ATCC
           27560]
 gi|149736411|gb|EDM52297.1| hypothetical protein EUBVEN_00500 [Eubacterium ventriosum ATCC
           27560]
          Length = 200

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 113/210 (53%), Gaps = 28/210 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGI----MTTSALELNLIIPEETGNSFEENAMIKSLTA 62
             I+ A+ N  K+ E+  ++   G+    M  + ++++++   E G +FEENA+IK+ T 
Sbjct: 2   KKIIFATTNQGKVREVKMMMEDFGVDFVTMKDAGIDIDIV---EDGKTFEENAIIKAKTI 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            +  G  AL+DDSGL +D LDG PGI+SAR+   +T    +D   + I   L+     + 
Sbjct: 59  MEATGEIALADDSGLEVDYLDGAPGIYSARFLGEDT---PYDEKNKYIIEKLKDAKGKE- 114

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             RSA F+  +++A+P+G +E   G + G+I +  +G+ GFGYDPI     Y+ T GEM 
Sbjct: 115 --RSARFVCSMAVAFPNGEIETCRGTIEGLIGYEQKGKNGFGYDPIVYVPEYEMTTGEMA 172

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            E KN                +SHR +A +
Sbjct: 173 PELKNS---------------ISHRGKALE 187


>gi|323359607|ref|YP_004226003.1| xanthosine triphosphate pyrophosphatase [Microbacterium testaceum
           StLB037]
 gi|323275978|dbj|BAJ76123.1| xanthosine triphosphate pyrophosphatase [Microbacterium testaceum
           StLB037]
          Length = 198

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 114/220 (51%), Gaps = 42/220 (19%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-------PEETGNSFEENAMIKSL 60
            +V+A+HN  K+ E  +++        +A+  +L +       P E G +F  NA+IK+ 
Sbjct: 3   RVVLATHNAHKVEEFQAIV--------AAVRPDLEVVGYDGPEPVEDGVTFAANALIKAR 54

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFA 119
            AA + G+PAL+DDSG+ +DVL G PG+ SA WA        + ++ + ++ +       
Sbjct: 55  AAAAHTGLPALADDSGIAVDVLGGSPGVFSAYWAGHKKDSTANLELLLDQLSDVA----- 109

Query: 120 HDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGY----D 175
            DP  R+A F+SV++L  PDG  +   G+  G +   P G  GFGYDPIF P G     +
Sbjct: 110 -DP-HRTAQFVSVIALVTPDGREDTVEGRWPGRLATAPGGTGGFGYDPIFVPEGQTPGEE 167

Query: 176 RTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           RT G+ + EEKN                 SHRARAF+  V
Sbjct: 168 RTVGQWSAEEKNA---------------ESHRARAFRHLV 192


>gi|33864139|ref|NP_895699.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Prochlorococcus marinus str. MIT 9313]
 gi|62900262|sp|Q7V4S3|NTPA_PROMM RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|33635723|emb|CAE22047.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9313]
          Length = 203

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 107/200 (53%), Gaps = 18/200 (9%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           +L E  +VIAS N  KI E   L+  +PL +    A   +L + EETG +F ENA IK+L
Sbjct: 5   ELTERVLVIASGNAGKIREFRQLLAHLPLSVQ---AQPKDLAV-EETGQTFAENARIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           T A+  G  AL+DDSGL ++ L G PG++SAR+A S+           +IE  L+     
Sbjct: 61  TVAQATGQWALADDSGLSVEALAGAPGVYSARYAASDA---------LRIERLLQELKGI 111

Query: 121 DPAFRSAHFISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
           D   R AHF + L +A     V     G+  G+I    RG+ GFGYDPIF+ +    TF 
Sbjct: 112 DD--RRAHFSAALCIASETNEVLLEVEGRCEGLITHAARGEKGFGYDPIFEVDATGTTFA 169

Query: 180 EMTEEEKNGGIDSATLFSIL 199
           EMT E+K         F++L
Sbjct: 170 EMTIEQKRQWSHRGCAFALL 189


>gi|49483314|ref|YP_040538.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257425202|ref|ZP_05601628.1| Ham1 family protein [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257427865|ref|ZP_05604263.1| Ham1 family protein [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257430500|ref|ZP_05606882.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433262|ref|ZP_05609620.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257436101|ref|ZP_05612148.1| Ham1 family protein [Staphylococcus aureus subsp. aureus M876]
 gi|282903700|ref|ZP_06311588.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus aureus subsp. aureus C160]
 gi|282905468|ref|ZP_06313323.1| Ham1 family protein [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282908442|ref|ZP_06316273.1| Ham1 protein [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282910726|ref|ZP_06318529.1| Ham1 protein [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282913926|ref|ZP_06321713.1| ribonuclease PH/Ham1 protein [Staphylococcus aureus subsp. aureus
           M899]
 gi|282918849|ref|ZP_06326584.1| Ham1 family protein [Staphylococcus aureus subsp. aureus C427]
 gi|282923971|ref|ZP_06331647.1| Ham1 family protein [Staphylococcus aureus subsp. aureus C101]
 gi|283957894|ref|ZP_06375345.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus aureus subsp. aureus A017934/97]
 gi|293500961|ref|ZP_06666812.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293509918|ref|ZP_06668627.1| Ham1 family protein [Staphylococcus aureus subsp. aureus M809]
 gi|293526505|ref|ZP_06671190.1| ribonuclease PH/Ham1 protein [Staphylococcus aureus subsp. aureus
           M1015]
 gi|295427638|ref|ZP_06820270.1| Ham1 family protein [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297591407|ref|ZP_06950045.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus MN8]
 gi|62900222|sp|Q6GHT4|NTPA_STAAR RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|49241443|emb|CAG40127.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257272178|gb|EEV04310.1| Ham1 family protein [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257274706|gb|EEV06193.1| Ham1 family protein [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257278628|gb|EEV09247.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281355|gb|EEV11492.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257284383|gb|EEV14503.1| Ham1 family protein [Staphylococcus aureus subsp. aureus M876]
 gi|282313943|gb|EFB44335.1| Ham1 family protein [Staphylococcus aureus subsp. aureus C101]
 gi|282316659|gb|EFB47033.1| Ham1 family protein [Staphylococcus aureus subsp. aureus C427]
 gi|282321994|gb|EFB52318.1| ribonuclease PH/Ham1 protein [Staphylococcus aureus subsp. aureus
           M899]
 gi|282325331|gb|EFB55640.1| Ham1 protein [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282328107|gb|EFB58389.1| Ham1 protein [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282330760|gb|EFB60274.1| Ham1 family protein [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282595318|gb|EFC00282.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus aureus subsp. aureus C160]
 gi|283790043|gb|EFC28860.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus aureus subsp. aureus A017934/97]
 gi|290920577|gb|EFD97640.1| ribonuclease PH/Ham1 protein [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095966|gb|EFE26227.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291467368|gb|EFF09885.1| Ham1 family protein [Staphylococcus aureus subsp. aureus M809]
 gi|295127996|gb|EFG57630.1| Ham1 family protein [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297576293|gb|EFH95009.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus MN8]
 gi|312438473|gb|ADQ77544.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|315193822|gb|EFU24217.1| hypothetical protein CGSSa00_10469 [Staphylococcus aureus subsp.
           aureus CGS00]
          Length = 195

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 106/179 (59%), Gaps = 11/179 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIAS+N  KI++   +     ++  S L L+  + EETG++FEENA++KS  AAK    
Sbjct: 4   IVIASNNQGKINDFKVIFPDYHVIGISELILDFDV-EETGSTFEENAILKSEAAAKALNK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             ++DDSGL +  L+G+PGI+SAR+A E+ + E + +  + K+ N            R A
Sbjct: 63  TVIADDSGLEVFALNGEPGIYSARYAGENKSDEANIEKLLNKLGNTTD---------RRA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ PD   + F G VSG I     G+ GFGYDPIF     DRT  ++++E+K
Sbjct: 114 QFVCVISMSGPDMETKVFKGTVSGEIADGKYGENGFGYDPIFYVPKLDRTMAQLSKEQK 172


>gi|313899425|ref|ZP_07832935.1| non-canonical purine NTP pyrophosphatase RdgB [Clostridium sp.
           HGF2]
 gi|312955713|gb|EFR37371.1| non-canonical purine NTP pyrophosphatase RdgB [Clostridium sp.
           HGF2]
          Length = 195

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 106/210 (50%), Gaps = 24/210 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             I++AS N  K  E + ++ PLG    + L+L   I  EETG +FEENA+IK+    + 
Sbjct: 2   KEIMLASANAHKAQEFEEMLRPLGYTVKTLLDLKEDIEIEETGTTFEENALIKAKAIHER 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+  ++DDSGL ++ LDG PGI+SAR+   +T    +D+  Q + +  R   A D   +
Sbjct: 62  LGIEVIADDSGLAVNALDGAPGIYSARFMGRDT---SYDVKNQYLIDQCRH--AED---K 113

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
              FI  ++    DG    F+G V GI+     G  GFGYDPIF    Y  T   ++EE+
Sbjct: 114 GCQFICAIAYVQADGSEHVFTGVVEGIVADHMEGAKGFGYDPIFYYPPYGTTLANVSEEQ 173

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           KN                +SHR RA    V
Sbjct: 174 KN---------------RVSHRGRALAKLV 188


>gi|224540930|ref|ZP_03681469.1| hypothetical protein CATMIT_00081 [Catenibacterium mitsuokai DSM
           15897]
 gi|224526163|gb|EEF95268.1| hypothetical protein CATMIT_00081 [Catenibacterium mitsuokai DSM
           15897]
          Length = 197

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 111/210 (52%), Gaps = 25/210 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP--EETGNSFEENAMIKSLTAAKNA 66
           IV+A+ N  K+ E+ +++  LGI   S  ++    P  EETG +F ENA+IK+ T     
Sbjct: 4   IVVATTNKGKLKEISAMLEKLGIEVKSIKDVLGYNPDIEETGTTFTENAVIKAETVMNMI 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            MP L+DDSGL +D LD +PGI+S+R+   +T    +D+  Q I +A++     D   ++
Sbjct: 64  HMPTLADDSGLEVDALDKQPGIYSSRFMGEDTS---YDIKNQWIIDAVK-----DKEDKT 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+  ++LA PD   + F G   G I     G+ GFGYDPIF      +T   MT EEK
Sbjct: 116 ARFVCAMALAIPDEETKTFLGTFEGKINDCIDGENGFGYDPIFYYPPLKKTSAVMTMEEK 175

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           N                +SHRA+A K   D
Sbjct: 176 NK---------------VSHRAKALKALYD 190


>gi|306819763|ref|ZP_07453420.1| ribonuclease PH/Ham1 protein [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
 gi|304552198|gb|EFM40132.1| ribonuclease PH/Ham1 protein [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
          Length = 459

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 111/213 (52%), Gaps = 26/213 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTAAKNA 66
           ++IA+ N  K+ E+  ++   G    S  + NL  +  EETG +FEENA+IK+    K  
Sbjct: 264 VLIATTNEHKLDEIGKILTKYGTKYKSLSDFNLQDVDVEETGTTFEENALIKAREYCKLT 323

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
               LSDDSGL++D L G PG++S R+  SN   RD    ++  E  L+S        R 
Sbjct: 324 NTVVLSDDSGLMVDALKGAPGVYSKRF--SNEEPRD----IKNNEKLLKSLMGLTSDERG 377

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPN---GYDRTFGEMTE 183
           A F+SV++L +P+G    F G+  G I + P G+ GFGYDP+F PN      +TF ++ +
Sbjct: 378 AKFVSVVALVFPNGEEYVFRGECHGKIGFAPMGENGFGYDPLFLPNDKAAGGKTFAQIKQ 437

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           E KN                +SHR+R+     D
Sbjct: 438 ELKNQ---------------ISHRSRSLAKLED 455


>gi|124024189|ref|YP_001018496.1| deoxyribonucleotide triphosphate pyrophosphatase [Prochlorococcus
           marinus str. MIT 9303]
 gi|123964475|gb|ABM79231.1| Xanthosine triphosphate pyrophosphatase [Prochlorococcus marinus
           str. MIT 9303]
          Length = 203

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 107/200 (53%), Gaps = 18/200 (9%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           +L E  +VIAS N  KI E   L+  +PL +    A   +L + EETG +F ENA IK+L
Sbjct: 5   ELTERVLVIASGNAGKIREFRQLLAHLPLSVQ---AQPKDLAV-EETGQTFAENARIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           T A+  G  AL+DDSGL ++ L G PG++SAR+A S+           +IE  L+     
Sbjct: 61  TVAQATGQWALADDSGLSVEALAGAPGVYSARYAASDA---------LRIERLLQELKEI 111

Query: 121 DPAFRSAHFISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
           D   R AHF + L +A     V     G+  G+I    RG+ GFGYDPIF+ +    TF 
Sbjct: 112 DD--RRAHFSAALCIASETNEVLLEVEGRCEGLITHAARGEKGFGYDPIFEVDATGTTFA 169

Query: 180 EMTEEEKNGGIDSATLFSIL 199
           EMT E+K         F++L
Sbjct: 170 EMTIEQKRQWSHRGCAFALL 189


>gi|331091804|ref|ZP_08340636.1| Ham1 family protein [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330402703|gb|EGG82270.1| Ham1 family protein [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 199

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 117/218 (53%), Gaps = 36/218 (16%)

Query: 5   IENNIVIASHNVDKIHEMDSLI----MPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           + N I+ A+ N +K+ E+  ++    MP+  M  + ++++++   E G++FEENA+IK+ 
Sbjct: 1   MSNKILFATGNENKMKEIRMILSDLGMPIQSMKEAGIDVDIV---EDGSTFEENAIIKAT 57

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFD----MAMQKIENALRS 116
             AK  G   L+DDSGL ID L+ +PGI+SAR+A  +T    +D    M + ++E     
Sbjct: 58  AIAKMTGDIVLADDSGLEIDYLNKEPGIYSARYAGVDT---SYDIKNRMLLDRLEGVPDE 114

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
           K       R+A F+ V++ A+PDG VE   G + GII     G+ GFGYDPIF    Y  
Sbjct: 115 K-------RTARFVCVIACAFPDGTVETARGTIEGIIGHEIAGENGFGYDPIFYLPEYQC 167

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
           T  E+  E+KN                LSHR +A +  
Sbjct: 168 TTAELEPEKKNE---------------LSHRGKALRAM 190


>gi|238759332|ref|ZP_04620498.1| Nucleoside-triphosphatase [Yersinia aldovae ATCC 35236]
 gi|238702493|gb|EEP95044.1| Nucleoside-triphosphatase [Yersinia aldovae ATCC 35236]
          Length = 197

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 116/216 (53%), Gaps = 29/216 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ +L+   G+   +  EL++   EETG +F ENA++K+  AA+  
Sbjct: 2   QKIVLATGNPGKVRELANLLADFGLDVVAQTELSVESAEETGLTFIENAILKARHAAQIT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSGL +D L G PGI+SAR+A ++  +++    ++K+  AL+       A R+
Sbjct: 62  GLPAMADDSGLAVDALGGAPGIYSARYAGTDASDQE---NLEKLLVALKDV---PEAQRA 115

Query: 127 AHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  VL       H ++     F G+  G+I   P G  GFGYDPIF      +T  E+
Sbjct: 116 AQFHCVLVYMR---HAQDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPELGKTAAEL 172

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           T EEK+                +SHR +A K  +D 
Sbjct: 173 TREEKHA---------------VSHRGQALKLMLDT 193


>gi|51244559|ref|YP_064443.1| hypothetical protein DP0707 [Desulfotalea psychrophila LSv54]
 gi|62900200|sp|Q6AQD7|NTPA_DESPS RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|50875596|emb|CAG35436.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 223

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 103/182 (56%), Gaps = 13/182 (7%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           IV+A+ N +K+ E   ++    I   S  E    IPE  E G  F+ENA  K++  AK  
Sbjct: 5   IVLATTNQNKVKEFQEILKDFAIEIRSLAEFG-PIPEAIEDGKDFDENAYKKAIHTAKIL 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +  L+G PG++SAR++ E  T   + D  ++++              R
Sbjct: 64  GIPAIADDSGLEVHALNGAPGVYSARYSGEGATDASNCDKLLEELAGKED---------R 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           SA+F  V+S+A P G    + G+  G I+   RG+ GFGYDP+F    YD+TF E++ EE
Sbjct: 115 SANFTCVISIATPGGPALTYEGRCDGKILTEKRGKSGFGYDPLFYFAEYDKTFAELSMEE 174

Query: 186 KN 187
           KN
Sbjct: 175 KN 176


>gi|169335159|ref|ZP_02862352.1| hypothetical protein ANASTE_01566 [Anaerofustis stercorihominis DSM
           17244]
 gi|169257897|gb|EDS71863.1| hypothetical protein ANASTE_01566 [Anaerofustis stercorihominis DSM
           17244]
          Length = 196

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 109/205 (53%), Gaps = 22/205 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             ++IAS N  K+ E+ S++    +++ +       I E+ G +FEENA+IK+    +  
Sbjct: 2   KEVIIASANKHKLDEIKSILKDYKVISMAEAGFFDDIVED-GATFEENALIKAKAIHEKT 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G   L DDSGL+++ L+G+PGI+SAR+A     +R  +   +K+  AL      D   RS
Sbjct: 61  GKLVLGDDSGLMVEYLNGEPGIYSARYAGEEKSDRKNN---EKLLKALEGTERQD---RS 114

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+  + + + DG  E   G+V GII     G  GFGYDP+F     D+T+ E+T +EK
Sbjct: 115 AKFVCTVGICYEDGTTETVRGEVKGIIGTEETGSGGFGYDPLFYIEELDKTYAELTFDEK 174

Query: 187 NGGIDSATLFSILSTDLLSHRARAF 211
           N               ++SHR +AF
Sbjct: 175 N---------------MVSHRRKAF 184


>gi|309812233|ref|ZP_07705991.1| non-canonical purine NTP pyrophosphatase RdgB [Dermacoccus sp.
           Ellin185]
 gi|308433920|gb|EFP57794.1| non-canonical purine NTP pyrophosphatase RdgB [Dermacoccus sp.
           Ellin185]
          Length = 207

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 115/216 (53%), Gaps = 31/216 (14%)

Query: 6   ENNIVIASHNVDKI----HEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
              +V+A+ N  KI    H +D+  +P+ +++      +L    ETG +FEENA +K+  
Sbjct: 10  RTRVVLATRNAGKIADFQHLLDAAQLPIDVVSVGEFA-DLADTVETGVTFEENARLKADD 68

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAH 120
            A+  G+PAL+DDSGL +DVL G PG+ SARW+ ++  ++ + D+ + +  +    K   
Sbjct: 69  VARATGLPALADDSGLAVDVLGGCPGVFSARWSGTHGADQANIDLLLAQTGDVPADKL-- 126

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQ-PNGYDRTFG 179
                +A F+  ++LA PD   +   G V G +    RG  GFGYDPIF+ P+G  RT  
Sbjct: 127 -----TARFMCCVALAVPDESTQVEFGHVEGRLTRHQRGTNGFGYDPIFELPDG--RTMA 179

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           E+T +EK                 +SHR RAF+  +
Sbjct: 180 ELTADEKAA---------------ISHRGRAFRAIL 200


>gi|302551721|ref|ZP_07304063.1| deoxyribonucleotide triphosphate pyrophosphatase [Streptomyces
           viridochromogenes DSM 40736]
 gi|302469339|gb|EFL32432.1| deoxyribonucleotide triphosphate pyrophosphatase [Streptomyces
           viridochromogenes DSM 40736]
          Length = 210

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 114/212 (53%), Gaps = 24/212 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGI---MTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           + +++A+ N  KI E+ +++   G+   +  +    ++   +ETG +F ENA++K+   A
Sbjct: 12  SRLILATRNAGKITELRAILAEAGLPHELVGADAYPDIPDVKETGVTFAENALLKAHALA 71

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G+PA++DDSGL +DVL+G PGI SARW    +G    D A   +  A  S  A D  
Sbjct: 72  QATGLPAVADDSGLCVDVLNGAPGIFSARW----SGRHGDDKANLDLLLAQLSDIADD-- 125

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R AHF    +LA PDG      G++ G++   P G  GFGYDPI QP G  RT  E+T 
Sbjct: 126 HRGAHFACAAALALPDGTERVVEGQLRGVLRHEPTGTGGFGYDPILQPEGETRTCAELTP 185

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           +EKN                +SHR +AF+  V
Sbjct: 186 DEKNA---------------ISHRGKAFRALV 202


>gi|57234033|ref|YP_181939.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Dehalococcoides ethenogenes 195]
 gi|57224481|gb|AAW39538.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Dehalococcoides ethenogenes 195]
          Length = 199

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 101/183 (55%), Gaps = 11/183 (6%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAKNA 66
            +++AS+N  K+ E  SL+   G    +  ++ + I   ETG +FEENA +K+   A+ +
Sbjct: 3   KLLLASNNRGKLREYASLLSGSGFELVTPADMGIDITVAETGTTFEENARLKAAALAEAS 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA-LRSKFAHDPA-F 124
           G+  L+DDSGL +D L G+PG++SAR+A  N  + D         NA L SK    PA  
Sbjct: 63  GILTLADDSGLAVDALGGEPGVYSARYAGENATDTD--------RNAYLLSKMHTIPAEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F  V+++A P   +  F G   G I   PRG  GFGYDP+F    Y +T  E+  E
Sbjct: 115 RTARFCCVIAIAQPGHIIATFEGTCEGFISTEPRGTNGFGYDPVFYLPEYGKTMAELPSE 174

Query: 185 EKN 187
            KN
Sbjct: 175 IKN 177


>gi|114566006|ref|YP_753160.1| HAM1 protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
 gi|114336941|gb|ABI67789.1| HAM1 protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 202

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 108/205 (52%), Gaps = 22/205 (10%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           +++A+ N  K  E+  ++  L +   +  EL  +   EE GNSF ENA+ K++  AK +G
Sbjct: 5   LLLATRNRKKKLELQEILRELNLNILTLEELPYLAEVEEDGNSFAENAIKKAVLTAKASG 64

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
              L+DDSGLV+D L G+PGI+SAR+A     + + +  + K    L      D   R+A
Sbjct: 65  KICLADDSGLVVDALGGQPGIYSARFAGELASDEENNQKLLK----LMEMIEEDK--RTA 118

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+ V++L+   G+VE   G   G I     G+ GFGYDP+F P GY ++F E+    KN
Sbjct: 119 RFVCVIALSDAQGNVETVEGICEGRIALATAGKGGFGYDPLFIPQGYTQSFAELPSATKN 178

Query: 188 GGIDSATLFSILSTDLLSHRARAFK 212
                          L+SHR +A +
Sbjct: 179 ---------------LISHRGKALE 188


>gi|154250201|ref|YP_001411026.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Fervidobacterium nodosum Rt17-B1]
 gi|154154137|gb|ABS61369.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Fervidobacterium nodosum Rt17-B1]
          Length = 194

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 113/214 (52%), Gaps = 25/214 (11%)

Query: 11  IASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPA 70
           +AS N  K+HE+  +I     + +   E++++   E G +F EN++IK++   K+   P 
Sbjct: 1   MASKNAHKLHEIKLIIPDFVELLSIDTEMDVV---EDGETFLENSVIKAIEYGKHIDQPV 57

Query: 71  LSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFI 130
           ++DDSGL ID LDG PG+ SAR+ E+ +     +  +Q ++N  R+     P  R A F+
Sbjct: 58  IADDSGLSIDSLDGFPGVMSARYMENASYVEKMESILQLMKN-FRT-----PEERKARFV 111

Query: 131 SVLSLAWP-DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGG 189
              +   P +  + +  G V G I    RG  GFGYDPIF P GYD+TFGE+ EE K   
Sbjct: 112 CSATYFNPLNKFLISVEGFVEGTIATEIRGSHGFGYDPIFIPAGYDKTFGELGEEVKKK- 170

Query: 190 IDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
                         +SHR+ AFK   D  ++I E
Sbjct: 171 --------------ISHRSVAFKKLFDMLIKIGE 190


>gi|94266578|ref|ZP_01290262.1| Ham1-like protein [delta proteobacterium MLMS-1]
 gi|94266670|ref|ZP_01290346.1| Ham1-like protein [delta proteobacterium MLMS-1]
 gi|93452687|gb|EAT03241.1| Ham1-like protein [delta proteobacterium MLMS-1]
 gi|93452796|gb|EAT03328.1| Ham1-like protein [delta proteobacterium MLMS-1]
          Length = 228

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 102/181 (56%), Gaps = 11/181 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           IV+A+ N  K+ E+  ++    +   S  +    +PE  E G +F++NA  K+L  AK  
Sbjct: 5   IVLATRNQGKVKELREMLAGFPVDIRSLADFG-PLPEVVEDGATFDDNAYKKALFTAKAL 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSGLV++ L+G PG+HSAR+A    GE+  D A   I   L      +   R 
Sbjct: 64  GLPAMADDSGLVVEALNGAPGVHSARYA----GEQADDAA--NIAKLLAEMAGQED--RR 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+ VLSLA P G    + G+  G IV  PRG  GFGYDP+       +TF EM+ EEK
Sbjct: 116 AAFVCVLSLAVPAGPALTYEGRCEGEIVDAPRGTGGFGYDPVMFYPPLQKTFAEMSPEEK 175

Query: 187 N 187
           N
Sbjct: 176 N 176


>gi|325294220|ref|YP_004280734.1| Nucleoside-triphosphatase rdgB [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064668|gb|ADY72675.1| Nucleoside-triphosphatase rdgB [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 198

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 110/208 (52%), Gaps = 22/208 (10%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKNAG 67
           IV AS N  K+ E    +   GI   S  ++  L  P ETGN+F ENA  K++  AK  G
Sbjct: 3   IVFASKNKGKLREFQEKLSHFGIKVISIDQVKRLKEPPETGNTFLENAYQKAVYYAKAIG 62

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
            P +S+DSGL ++ L G PG+ S+R+A  N  +   DM  QK+ + L+ +   +     A
Sbjct: 63  KPVISEDSGLEVEALGGLPGVRSSRFAGENATD---DMNNQKLIDELKKRGLFE---SPA 116

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            ++S + LA+P+G      G+V G ++  PRG  GFGYDP+F P  Y +T  E++ +EKN
Sbjct: 117 RYVSFIVLAFPEGMGLWSEGEVKGKVITEPRGNGGFGYDPLFVPEDYLKTMAELSLDEKN 176

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFV 215
                           +SHR +A +  V
Sbjct: 177 K---------------ISHRGKAIEKLV 189


>gi|309776933|ref|ZP_07671903.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Erysipelotrichaceae bacterium 3_1_53]
 gi|308915344|gb|EFP61114.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Erysipelotrichaceae bacterium 3_1_53]
          Length = 195

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 105/206 (50%), Gaps = 24/206 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             I++A+ N  K  E  +++ PLG    + L+L   I  EETG SFEENA+IK+    + 
Sbjct: 2   KQIMLATANAHKAEEFAAMLKPLGYTVKTLLDLEEAIEIEETGTSFEENALIKARVIHER 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+  ++DDSGL ++ LDG PGI+SAR+   +T    +D+  Q I +  +     D   R
Sbjct: 62  LGIEVIADDSGLAVNALDGAPGIYSARFMGRDT---SYDVKNQYIIDQCK-----DVNDR 113

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
              F+  ++    DG    F+G V G++     G+ GFGYDP+F    Y  T   ++EE+
Sbjct: 114 GCQFVCAIAYVTADGREYVFTGVVEGLVAEHIEGEGGFGYDPMFYYPPYKTTLANVSEEQ 173

Query: 186 KNGGIDSATLFSILSTDLLSHRARAF 211
           KN                +SHR RA 
Sbjct: 174 KNK---------------VSHRGRAL 184


>gi|326385027|ref|ZP_08206699.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Gordonia neofelifaecis NRRL B-59395]
 gi|326196241|gb|EGD53443.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Gordonia neofelifaecis NRRL B-59395]
          Length = 207

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 108/219 (49%), Gaps = 31/219 (14%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII----PEETGNSFEENAMIKSL 60
           +   +++AS+N  K+ E+  ++   GI     L L  +     P E G +FE+NA+IK+ 
Sbjct: 1   MTGKVLLASNNAKKLAELRRVVEAAGITGLEVLGLGDVAAYPEPVEDGATFEDNALIKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A    G+P+L+DDSGL +D L+G PG+ SARW+       + D+        L ++ A 
Sbjct: 61  AAVAQTGLPSLADDSGLAVDALNGMPGVLSARWSGGKGDAANNDL--------LLAQLAD 112

Query: 121 DPA-FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPN---GYDR 176
            PA  R A F+SV +L  P G      G+  G I+   RG  GFGYDP+F P+      R
Sbjct: 113 VPAERRGAAFVSVCALVRPGGEEAVVRGEWRGTILRDERGANGFGYDPLFIPDDEIAAGR 172

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+  EEK               D LSHR +A    V
Sbjct: 173 TSAELAPEEK---------------DALSHRGKALAQLV 196


>gi|282849099|ref|ZP_06258484.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Veillonella parvula ATCC 17745]
 gi|282580803|gb|EFB86201.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Veillonella parvula ATCC 17745]
          Length = 191

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 112/211 (53%), Gaps = 26/211 (12%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGI--MTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            IV+A+ N  KI E       L I  +   A+ +++  PEETG +F ENA++K+   AK 
Sbjct: 3   QIVLATGNKGKIREFSEAFSHLSIDCVPVKAV-ISIEEPEETGTTFMENALLKARYYAKA 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
              P L+DDSG+ +DVL+G PG++SAR+A  +    D +   +K+   L+ K     + R
Sbjct: 62  TNRPCLADDSGITVDVLNGAPGVYSARYAGRHG---DDNANNEKLIRELQGK-----SNR 113

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           + H++  L+L +PDG      G   G++   P+G+ GFGYDP F    + +T  E++ EE
Sbjct: 114 TGHYVCALALVYPDGREVTAEGYCDGLVQDEPKGENGFGYDPYFYVPEFKKTMAELSIEE 173

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           K               + +SHR RA +  ++
Sbjct: 174 K---------------ETISHRGRALRELIN 189


>gi|158319609|ref|YP_001512116.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Alkaliphilus oremlandii OhILAs]
 gi|158139808|gb|ABW18120.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Alkaliphilus oremlandii OhILAs]
          Length = 210

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 114/206 (55%), Gaps = 25/206 (12%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNAG 67
           VI++ N  K+ E+ +++    +   S  ++NL   E  E GN+FEENA+IK+    +  G
Sbjct: 14  VISTGNKHKLEEIGAILEDFNLEVLSMKDVNLEGLEIIEDGNTFEENALIKAKAVMERTG 73

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
              L+DDSGL +DVLD +PGI+SAR++ E+ T E++    ++ +E     K       R+
Sbjct: 74  KLTLADDSGLEVDVLDNQPGIYSARFSGENATDEKNNAKLLKMLEEVPFEK-------RT 126

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+  ++  +P+G      G+  G+I +  +G+ GFGYDP+F    Y++TF E+ EE K
Sbjct: 127 ARFVCAMAAVFPNGDTIVLRGECPGVIGFEAKGKSGFGYDPLFIVEEYNQTFAELGEEIK 186

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                +SHRARA +
Sbjct: 187 NK---------------ISHRARALE 197


>gi|237736794|ref|ZP_04567275.1| ribonuclease PH [Fusobacterium mortiferum ATCC 9817]
 gi|229420656|gb|EEO35703.1| ribonuclease PH [Fusobacterium mortiferum ATCC 9817]
          Length = 196

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 107/206 (51%), Gaps = 26/206 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           I +A+ N  KI E+ ++   +  +   +++  + IPE  E G++FE N+  K+L  AK  
Sbjct: 3   IFLATGNKHKIDEIKAIFANVKDVEILSIKDGIEIPEVVEDGDTFEANSAKKALEIAKFT 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           GM  ++DDSGL +D L G PG++SAR++  N        A  +  NA   +   D   R 
Sbjct: 63  GMITIADDSGLCVDALGGAPGVYSARYSGEN--------ATDESNNAKLMEVMKDEKNRK 114

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            HF+SV++L  PDG   +F G++ G ++  P+G+ GFGYDP F    Y ++  EM E   
Sbjct: 115 CHFVSVITLGKPDGRAYSFRGEIEGELLCEPKGKDGFGYDPYFYVAEYGKSLAEMPE--- 171

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
                          + +SHRA A K
Sbjct: 172 -------------IKNRISHRANALK 184


>gi|297622725|ref|YP_003704159.1| non-canonical purine NTP pyrophosphatase [Truepera radiovictrix DSM
           17093]
 gi|297163905|gb|ADI13616.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Truepera radiovictrix DSM 17093]
          Length = 193

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 100/205 (48%), Gaps = 24/205 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAKNA 66
            + +A+ N DK+ E    +    +   SA EL +   P ETG S+  NA+ K+   A   
Sbjct: 2   KLALATANEDKVREFRRALAQSPLTLVSARELGVTDFPAETGASYAANALTKAAFLAGRT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+ +L+DDSGL +D L G PG++SAR+A  +  ER   +  Q     LR     +   R 
Sbjct: 62  GLLSLADDSGLEVDALGGAPGLYSARFASGSDLERTAHLLAQ-----LRGVPEGE---RR 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+ VL L  P G    F G+  G+I+  PRG  GFGYDP+F      +TF E T EEK
Sbjct: 114 ARFVCVLGLVTPAGDAHTFEGRCDGVILEAPRGAGGFGYDPVFWSPELGKTFAEATPEEK 173

Query: 187 NGGIDSATLFSILSTDLLSHRARAF 211
                            +SHR RA 
Sbjct: 174 AA---------------VSHRGRAL 183


>gi|312794042|ref|YP_004026965.1| non-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312877643|ref|ZP_07737600.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795590|gb|EFR11962.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|312181182|gb|ADQ41352.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 204

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 112/215 (52%), Gaps = 31/215 (14%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPL--GIMTTSALELNLIIPEETGNSFEENAMIK 58
           MRKL+     +A+ N  K  E+  LI      ++T +  + N+ I E+ G++FEENA+ K
Sbjct: 1   MRKLL-----VATKNEGKAREIKQLIENYFDDVVTLNHFDGNINIIED-GSTFEENALKK 54

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSK 117
           + T       P L+DDSGL +D L G+PG+ SAR+A E  T E      + ++++    K
Sbjct: 55  AKTVYSLYRQPTLADDSGLEVDALGGRPGVMSARYAGERATDEDRIKKLLDELKDVPEDK 114

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                  R A F+ VL      G +    G   G I + PRG+ GFGYDP+F P+G+D+T
Sbjct: 115 -------RGAQFVCVLVFIDQQGRIYQTKGICRGRIAFEPRGENGFGYDPVFVPDGFDKT 167

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           F E+  + KN                +SHRA+AF+
Sbjct: 168 FAELDSQIKN---------------QISHRAKAFE 187


>gi|194468342|ref|ZP_03074328.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Lactobacillus reuteri 100-23]
 gi|194453195|gb|EDX42093.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Lactobacillus reuteri 100-23]
          Length = 195

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 108/207 (52%), Gaps = 22/207 (10%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIA+ N  K  E   ++ PLGI   +  +   I  +E G +FEENA IK+ TA     +
Sbjct: 4   IVIATKNAGKAREYQEMLAPLGIEVKTLADFAPIAIDENGETFEENATIKATTATNQLHL 63

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
           P ++DDSGL++D L G PGI+SAR+A    G+ D      K+ +AL          R+AH
Sbjct: 64  PVMADDSGLMVDALGGAPGIYSARYA----GDHDDAANNAKLLSALNGVPDEK---RTAH 116

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F + +    PDG     +G+V G I+    G+ GFGYDP+F  +   ++  ++T ++KN 
Sbjct: 117 FRTTIVGIKPDGTKLVANGRVDGHILHQLTGENGFGYDPLFYVDELGKSMAQLTADQKN- 175

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFV 215
                          +SHR RA + F+
Sbjct: 176 --------------QISHRGRALRSFM 188


>gi|260435274|ref|ZP_05789244.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Synechococcus sp. WH 8109]
 gi|260413148|gb|EEX06444.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Synechococcus sp. WH 8109]
          Length = 193

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 101/198 (51%), Gaps = 14/198 (7%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +VIAS N  KI E   L+  L +      E  L + EETG +F  NA +K+   A   
Sbjct: 2   KTLVIASGNAGKIREFQGLLRALPVSVQPQPE-GLEV-EETGTTFAANARLKAQAVAAAI 59

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G  AL+DDSGL +D L+G PG+HSAR+A ++          ++I   L++    D   R 
Sbjct: 60  GEWALADDSGLSVDALNGAPGVHSARYAPTDP---------ERIARLLKALNGSDQ--RQ 108

Query: 127 AHFISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           A+F + L +A  DG +     G+  G+I   PRG  GFGYDPIF+  G  RTF EM   E
Sbjct: 109 AYFCAALCIAAADGTILLEVEGRCDGLITASPRGDQGFGYDPIFEVAGTGRTFAEMPLAE 168

Query: 186 KNGGIDSATLFSILSTDL 203
           K         FS+L   L
Sbjct: 169 KKQHGHRGKAFSLLEPKL 186


>gi|116494343|ref|YP_806077.1| bifunctional glutamate racemase/xanthosine/inosine pyrophosphatase
           [Lactobacillus casei ATCC 334]
 gi|116104493|gb|ABJ69635.1| Glutamate racemase with xanthosine/inosine pyrophosphatase of HAM1
           family [Lactobacillus casei ATCC 334]
          Length = 484

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 108/214 (50%), Gaps = 26/214 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAKN 65
             IV+AS N  KI E  ++  P GI   S  + + +   +ETG +FEENA  K+   AK+
Sbjct: 283 KTIVVASKNQGKIKEFKTMFEPAGITVKSLADFSSVPTVDETGTTFEENARQKADQYAKD 342

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +P ++DDSGL++D LDG+PGI SAR+A    G+   D A      A  +    D   R
Sbjct: 343 LQLPVIADDSGLMVDALDGQPGIRSARYA----GDGHNDAANNAKLLAALADVPEDD--R 396

Query: 126 SAHFISVLSLAWPDGHVEN---FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           +A F + L LA PD H E      G VSG+I   PRG  GFGYDP F      +T  EMT
Sbjct: 397 TATFHTTLVLAKPD-HPEADLVVHGDVSGLITAIPRGTDGFGYDPFFFVPALGKTMAEMT 455

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
            EEKN                +SHR  A +   D
Sbjct: 456 AEEKNQ---------------ISHRGNAMRALED 474


>gi|302391287|ref|YP_003827107.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Acetohalobium arabaticum DSM 5501]
 gi|302203364|gb|ADL12042.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Acetohalobium arabaticum DSM 5501]
          Length = 200

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 113/213 (53%), Gaps = 29/213 (13%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIK 58
           MRK     I +A+ N  K+ EM  L+  L +   +  +L+ + PE  E G++ EENA+ K
Sbjct: 1   MRK-----IFLATGNEGKVKEMKDLLAELEVELVTTFDLSEV-PEVVEDGSTLEENAIKK 54

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
           +   A   G+  ++DD+GL++D L G+PG++SAR+A  +     +D   +K+ + L    
Sbjct: 55  AKELADYTGLLTIADDTGLLVDALAGRPGVYSARYAGEDA---TYDDNNRKLLSELDGIS 111

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
             D   R+A F +V++L   +G V+   G   G I + P G  GFGYDP+F P GY+ TF
Sbjct: 112 LED---RTARFKTVMALVKSEGEVKTVEGICKGKIGFKPEGNHGFGYDPLFIPQGYNVTF 168

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
            EM  E KN                +SHRA+A 
Sbjct: 169 AEMKSEVKNK---------------ISHRAKAL 186


>gi|123443631|ref|YP_001007603.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122090592|emb|CAL13461.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 197

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 110/215 (51%), Gaps = 29/215 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 2   QKVVLATGNPGKVRELATLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQTT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSGL +D L G PGI+SAR+A ++  ++      Q +E  L +        R 
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYAGADASDQ------QNLEKLLVALKDIPDEQRG 115

Query: 127 AHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  VL       H E+     F G+  G+I   P G  GFGYDPIF      +T  E+
Sbjct: 116 AQFHCVLVYMR---HAEDPTPLVFHGQWPGVIARQPSGTAGFGYDPIFYVPELGKTAAEL 172

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           T EEK+                +SHR +A K  +D
Sbjct: 173 TREEKHA---------------VSHRGQALKLMLD 192


>gi|239636353|ref|ZP_04677355.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus warneri L37603]
 gi|239597708|gb|EEQ80203.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus warneri L37603]
          Length = 195

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 107/180 (59%), Gaps = 11/180 (6%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +IVIAS+N  KI++  ++     ++  S L  +  + EETG +FEENA +KS+ AAK   
Sbjct: 3   DIVIASNNKGKINDFKAIFPNHNVIGISELIKDFDV-EETGTTFEENAKLKSVAAAKALN 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD-FDMAMQKIENALRSKFAHDPAFRS 126
              ++DDSGL +  L+G+PG++SAR+A  +  ++D  +  ++ +EN          + R+
Sbjct: 62  KQVIADDSGLEVQALNGEPGVYSARYAGLDKNDQDNINKLLKNMENI---------SDRN 112

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+ V+S++ P+G    F G V+G I   P G  GFGYDPIF     ++T  ++++ EK
Sbjct: 113 AQFVCVISMSAPNGETTQFKGTVTGEITTEPIGDNGFGYDPIFYVPSLNKTMAQLSDSEK 172


>gi|297199993|ref|ZP_06917390.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Streptomyces sviceus ATCC 29083]
 gi|197710465|gb|EDY54499.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Streptomyces sviceus ATCC 29083]
          Length = 200

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 115/218 (52%), Gaps = 36/218 (16%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ +      I+  + L  +L+       IP+  ETG +F ENA++
Sbjct: 2   TRLILATRNAGKITELHA------ILADAGLPFDLVGADAYPEIPDVKETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSK 117
           K+   A+  G+PA++DDSGL +DVL+G PGI SARW    +G    D A  ++  A  S 
Sbjct: 56  KAHALAQATGLPAVADDSGLCVDVLNGAPGIFSARW----SGRHGDDKANLELLLAQLSD 111

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
            A +   R AHF    +LA PDG      G++ G++   P G  GFGYDPI QP G  RT
Sbjct: 112 IADE--HRGAHFACAAALALPDGTERVVEGRLRGVLRHTPVGTNGFGYDPILQPEGETRT 169

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
             E++ EEKN                +SHR +AF+  V
Sbjct: 170 CAELSAEEKNA---------------ISHRGQAFRALV 192


>gi|73748914|ref|YP_308153.1| non-canonical purine NTP pyrophosphatase, RdgB [Dehalococcoides sp.
           CBDB1]
 gi|73660630|emb|CAI83237.1| non-canonical purine NTP pyrophosphatase, RdgB [Dehalococcoides sp.
           CBDB1]
          Length = 199

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 109/212 (51%), Gaps = 26/212 (12%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAKNA 66
            +++AS+N  K+ E  SL+   G    +  EL + I   ETG +FEENA +K+   A+ +
Sbjct: 3   KLLLASNNAGKLKEYQSLLSGCGFEVVTPAELGIKITVAETGTTFEENARLKAAALAEAS 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDF-DMAMQKIENALRSKFAHDPAFR 125
           G+  L+DDSGL +D L G+PG++SAR+A  N  + D  D  + K+E+   +K       R
Sbjct: 63  GLLTLADDSGLEVDALGGEPGVYSARYAGENATDTDRNDYLLSKMEDIPANK-------R 115

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F  V+++  P   +    G   G+I   P G  GFGYDPIF    Y +T  E+  E 
Sbjct: 116 TARFRCVIAIVQPGHTLPAIEGSCEGLIATEPHGVNGFGYDPIFYLPEYRKTMAELPLEI 175

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFK--CFV 215
           KN                LSHRA A +  C V
Sbjct: 176 KNS---------------LSHRAIAAQKACLV 192


>gi|21221349|ref|NP_627128.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Streptomyces coelicolor A3(2)]
 gi|22653784|sp|Q9S2H9|NTPA_STRCO RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|5531351|emb|CAB50983.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)]
          Length = 200

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 115/219 (52%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ +      I+  + L  +L+       IP+  ETG +F ENA++
Sbjct: 2   TRLILATRNAGKITELRA------ILADAGLPHDLVGADAYPHIPDVKETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRS 116
           K+   A+  G+PA++DDSGL +DVL+G PGI SARWA  +  ++ + D+ + +I +    
Sbjct: 56  KAHALAEATGLPAVADDSGLCVDVLNGAPGIFSARWAGRHGDDQANLDLLLAQIADIADE 115

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
                   R AHF    +LA PDG      G++ G +   P G  GFGYDPI QP G  R
Sbjct: 116 -------HRGAHFACAAALALPDGTERVVEGQLKGTLRHAPAGTGGFGYDPILQPEGETR 168

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T EEKN                +SHR +AF+  V
Sbjct: 169 TCAELTAEEKNA---------------ISHRGKAFRALV 192


>gi|318057175|ref|ZP_07975898.1| dITP/XTP pyrophosphatase [Streptomyces sp. SA3_actG]
 gi|318078064|ref|ZP_07985396.1| dITP/XTP pyrophosphatase [Streptomyces sp. SA3_actF]
          Length = 200

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 76/219 (34%), Positives = 112/219 (51%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  K+ E+ +      I++ + L   L+       IP+  ETG +F ENA++
Sbjct: 2   TRLILATRNAGKVTELHA------ILSEAGLGHELVGADAYPEIPDVKETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRS 116
           K+   A+  G+PA++DDSGL +DVL G PGI SARW+      E + D+ + ++ +    
Sbjct: 56  KAHALARATGLPAVADDSGLCVDVLGGAPGIFSARWSGRHGDDEANLDLLLAQLSDIA-- 113

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
                P  R+A F    +LA PDG      G + G +   P G  GFGYDPI QP G DR
Sbjct: 114 -----PEHRAAGFACAAALALPDGTERVVEGHLRGTLRLAPAGGNGFGYDPILQPEGLDR 168

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T  EKN                +SHR +AF+  V
Sbjct: 169 TCAELTPAEKNA---------------ISHRGKAFRALV 192


>gi|39996893|ref|NP_952844.1| nucleoside-triphosphatase [Geobacter sulfurreducens PCA]
 gi|62900242|sp|Q74C80|NTPA_GEOSL RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|39983781|gb|AAR35171.1| HAM1 protein [Geobacter sulfurreducens PCA]
 gi|298505906|gb|ADI84629.1| xanthosine/inosine triphosphate pyrophosphohydrolase, HAM1
           domain-containing [Geobacter sulfurreducens KN400]
          Length = 199

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 115/217 (52%), Gaps = 32/217 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTA 62
             +V+A+ N  K+ E+ +++  +P  +++   LE     PE  E G +FEENA+ K+  A
Sbjct: 2   TRLVVATRNKGKLREIAAILDGLPFTLLS---LEDFPDFPEVEEDGKTFEENALKKASVA 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA-LRSKFAHD 121
           A   G+PAL+DDSGLV+D LDGKPG++SAR++  N        A  +  NA L S+    
Sbjct: 59  ANITGLPALADDSGLVVDALDGKPGVYSARYSGEN--------ASDEANNAKLLSELESV 110

Query: 122 P-AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           P   R+A F   ++L  P G    FSG++ G+I+  PRG  GFGYDP+F  +    T  E
Sbjct: 111 PYEERTAAFRCTIALCSPGGKRYTFSGELHGVILDSPRGTGGFGYDPLFFVSEKGATMAE 170

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           +  E KN                +SHR RA     D+
Sbjct: 171 LPLEAKNA---------------VSHRGRALALLKDH 192


>gi|302865662|ref|YP_003834299.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Micromonospora aurantiaca ATCC 27029]
 gi|302568521|gb|ADL44723.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Micromonospora aurantiaca ATCC 27029]
          Length = 205

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 112/212 (52%), Gaps = 28/212 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLI--IPE--ETGNSFEENAMIKSLT 61
           N +++A+ N  K+ E+  ++   LG    + L L+ +   PE  ETG +F ENA+IK+  
Sbjct: 2   NKVLLATRNRKKLVELQRILDGALGAHRIALLGLDDVEEYPELPETGLTFGENALIKARE 61

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAH 120
             +  G+P ++DDSGL +D L+G PG+ SARW+  +  +R +  + + ++ +        
Sbjct: 62  GCRRTGLPTIADDSGLAVDALNGMPGVFSARWSGGHGDDRANLQLVLDQVADV------- 114

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R A F+  ++L  P G      G+ SG ++  PRG  GFGYDPIF  +G +RT  E
Sbjct: 115 PDEHRGAAFVCTVALVLPGGKEHLVDGRQSGRLLRAPRGDGGFGYDPIFLGDGQERTNAE 174

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           +T EEK               D +SHR +A +
Sbjct: 175 LTPEEK---------------DAVSHRGKALR 191


>gi|297194144|ref|ZP_06911542.1| ribonuclease Ph [Streptomyces pristinaespiralis ATCC 25486]
 gi|197721969|gb|EDY65877.1| ribonuclease Ph [Streptomyces pristinaespiralis ATCC 25486]
          Length = 200

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/214 (37%), Positives = 110/214 (51%), Gaps = 28/214 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE-----ETGNSFEENAMIKSLT 61
             +++A+ N  KI E+ +++   G+  T  L      PE     ETG +F ENA++K+  
Sbjct: 2   TRLILATRNAGKITELRAILADAGV--THELVGADAYPEIPDVKETGVTFAENALLKAHA 59

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            AK  G+PA++DDSGL +DVL G PGI SARW    +G    D A  ++  A       D
Sbjct: 60  LAKATGLPAVADDSGLCVDVLGGAPGIFSARW----SGRHGDDQANLELLLAQLLDI--D 113

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+AHF    +LA PDG      G++ G +   P G  GFGYDPI QP G  RT  E+
Sbjct: 114 TPHRAAHFACAAALALPDGTERVVEGRLRGTLRRSPHGTNGFGYDPILQPEGESRTCAEL 173

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T EEKN                +SHR +AF+  V
Sbjct: 174 TPEEKNA---------------ISHRGKAFRALV 192


>gi|327439326|dbj|BAK15691.1| xanthosine triphosphate pyrophosphatase [Solibacillus silvestris
           StLB046]
          Length = 197

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 101/181 (55%), Gaps = 8/181 (4%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +VIA+ N  K  + ++L  P G    +  E+   +  EETG +FEENA++K+ T AK 
Sbjct: 2   KQVVIATKNKGKAKDFEALFGPFGYEVVTMFEVAPDVEIEETGTTFEENAILKAETLAKM 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G   ++DDSGL ID L+G+PG++SAR+A    G+ D +  M K+   ++     D   R
Sbjct: 62  LGQIVIADDSGLAIDALNGEPGVYSARYA----GDHDDEANMVKVLENMKD-VPEDQ--R 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F   L++A P+   +   G   GII +  +G  GFGYDPIF     ++   E++ EE
Sbjct: 115 TARFCCALAIAGPNMETKTVFGTCEGIIAYEKKGTNGFGYDPIFYVPALEKHMAELSAEE 174

Query: 186 K 186
           K
Sbjct: 175 K 175


>gi|29653406|ref|NP_819098.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Coxiella burnetii RSA 493]
 gi|153207125|ref|ZP_01945904.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Coxiella burnetii 'MSU Goat Q177']
 gi|154706051|ref|YP_001425365.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Coxiella
           burnetii Dugway 5J108-111]
 gi|161831286|ref|YP_001596039.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Coxiella
           burnetii RSA 331]
 gi|165923905|ref|ZP_02219737.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Coxiella burnetii RSA 334]
 gi|212219451|ref|YP_002306238.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Coxiella
           burnetii CbuK_Q154]
 gi|62900273|sp|Q83FA3|NTPA_COXBU RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|29540668|gb|AAO89612.1| xanthosine triphosphate pyrophosphatase [Coxiella burnetii RSA 493]
 gi|120576786|gb|EAX33410.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Coxiella burnetii 'MSU Goat Q177']
 gi|154355337|gb|ABS76799.1| xanthosine triphosphate pyrophosphatase [Coxiella burnetii Dugway
           5J108-111]
 gi|161763153|gb|ABX78795.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Coxiella burnetii RSA 331]
 gi|165916659|gb|EDR35263.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Coxiella burnetii RSA 334]
 gi|212013713|gb|ACJ21093.1| xanthosine triphosphate pyrophosphatase [Coxiella burnetii
           CbuK_Q154]
          Length = 200

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 104/197 (52%), Gaps = 8/197 (4%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IV+AS N  K+ EM  L+  L I      E ++   EETG++F ENA+IK+  AAK  G+
Sbjct: 4   IVLASQNSSKLAEMQELLRDLEIKFIPQTEFSVPDIEETGSTFVENAIIKARHAAKQTGL 63

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
           PAL+DDSGL I  L+  PG+ S+R+A  N  +       ++I+  L +  A D + RSA 
Sbjct: 64  PALADDSGLTIAALNSAPGVFSSRYAGKNATD------AERIQKVLEALEAADDSDRSAS 117

Query: 129 FISVLSLAWPDGHVENF--SGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           F  V++L   +         G   G I   PRG+ GFGYDPIF    + RT  E+  +EK
Sbjct: 118 FHCVIALMENENDPAPLICHGVWEGEIAREPRGKNGFGYDPIFYVPSHQRTAAELDPQEK 177

Query: 187 NGGIDSATLFSILSTDL 203
           N           LST L
Sbjct: 178 NAISHRGQALEQLSTVL 194


>gi|332162815|ref|YP_004299392.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318604344|emb|CBY25842.1| nucleoside 5-triphosphatase RdgB (dHAPTP, dITP,XTP-specific)
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325667045|gb|ADZ43689.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330859005|emb|CBX69363.1| nucleoside-triphosphatase [Yersinia enterocolitica W22703]
          Length = 197

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 112/215 (52%), Gaps = 29/215 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 2   QKVVLATGNPGKVRELATLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQTT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSGL +D L G PGI+SAR+A ++  ++      Q +E  L +        R 
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYAGADASDQ------QNLEKLLVALKDIPDEQRG 115

Query: 127 AHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  VL +  P  H E+     F G+  G+I   P G  GFGYDP+F      +T  E+
Sbjct: 116 AQFHCVL-VYMP--HAEDPTPLVFHGQWPGVIARQPSGTAGFGYDPVFYVPELGKTAAEL 172

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           T EEK+                +SHR +A K  +D
Sbjct: 173 TREEKHA---------------VSHRGQALKLMLD 192


>gi|315502226|ref|YP_004081113.1| non-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Micromonospora sp. L5]
 gi|315408845|gb|ADU06962.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Micromonospora sp. L5]
          Length = 205

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 112/212 (52%), Gaps = 28/212 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLI--IPE--ETGNSFEENAMIKSLT 61
           N +++A+ N  K+ E+  ++   LG    + L L+ +   PE  ETG +F ENA+IK+  
Sbjct: 2   NKVLLATRNRKKLVELQRILDGALGAHRIALLGLDDVEEYPELPETGLTFGENALIKARE 61

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAH 120
             +  G+P ++DDSGL +D L+G PG+ SARW+  +  +R +  + + ++ +        
Sbjct: 62  GCRRTGLPTIADDSGLAVDALNGMPGVFSARWSGGHGDDRANLQLVLDQVADV------- 114

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R A F+  ++L  P G      G+ SG ++  PRG  GFGYDPIF  +G +RT  E
Sbjct: 115 PDEHRGAAFVCTVALVLPGGKEHLVDGRQSGRLLRAPRGDGGFGYDPIFLGDGQERTNAE 174

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           +T EEK               D +SHR +A +
Sbjct: 175 LTPEEK---------------DAVSHRGKALR 191


>gi|227534493|ref|ZP_03964542.1| glutamate racemase [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|227187892|gb|EEI67959.1| glutamate racemase [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
          Length = 484

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 108/214 (50%), Gaps = 26/214 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             IV+AS N  KI E  ++  P GI   S  +  ++   +ETG +FEENA  K+   AK+
Sbjct: 283 KTIVVASKNQGKIKEFKTMFEPAGITVKSLADFPSVPTVDETGTTFEENARQKADQYAKD 342

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +P ++DDSGL++D LDG+PGI SAR+A    G+   D A      A  +    D   R
Sbjct: 343 LQLPVIADDSGLMVDALDGQPGIRSARYA----GDGHNDAANNAKLLAALADVPEDD--R 396

Query: 126 SAHFISVLSLAWPDGHVEN---FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           +A F + L LA PD H E      G VSG+I   PRG  GFGYDP F      +T  EMT
Sbjct: 397 TATFHTTLVLAKPD-HPEADLVVHGDVSGLITAIPRGTDGFGYDPFFFVPALGKTMAEMT 455

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
            EEKN                +SHR  A +   D
Sbjct: 456 AEEKNQ---------------ISHRGNAMRALED 474


>gi|191637675|ref|YP_001986841.1| Glutamate racemase [Lactobacillus casei BL23]
 gi|190711977|emb|CAQ65983.1| Glutamate racemase [Lactobacillus casei BL23]
 gi|327381734|gb|AEA53210.1| Ribonuclease PH/Ham1 protein [Lactobacillus casei LC2W]
 gi|327384898|gb|AEA56372.1| Ribonuclease PH/Ham1 protein [Lactobacillus casei BD-II]
          Length = 484

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 108/214 (50%), Gaps = 26/214 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             IV+AS N  KI E  ++  P GI   S  +  ++   +ETG +FEENA  K+   AK+
Sbjct: 283 KTIVVASKNQGKIKEFKTMFEPAGITVKSLADFPSVPTVDETGTTFEENARQKADQYAKD 342

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +P ++DDSGL++D LDG+PGI SAR+A    G+   D A      A  +    D   R
Sbjct: 343 LQLPVIADDSGLMVDALDGQPGIRSARYA----GDGHNDAANNAKLLAALADVPEDD--R 396

Query: 126 SAHFISVLSLAWPDGHVEN---FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           +A F + L LA PD H E      G VSG+I   PRG  GFGYDP F      +T  EMT
Sbjct: 397 TATFHTTLVLAKPD-HPEADLVVHGDVSGLITAIPRGTDGFGYDPFFFVPALGKTMAEMT 455

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
            EEKN                +SHR  A +   D
Sbjct: 456 AEEKNQ---------------ISHRGNAMRALED 474


>gi|301065854|ref|YP_003787877.1| glutamate racemase with xanthosine/inosine pyrophosphatase of HAM1
           family [Lactobacillus casei str. Zhang]
 gi|300438261|gb|ADK18027.1| Glutamate racemase with xanthosine/inosine pyrophosphatase of HAM1
           family [Lactobacillus casei str. Zhang]
          Length = 484

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 108/214 (50%), Gaps = 26/214 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             IV+AS N  KI E  ++  P GI   S  +  ++   +ETG +FEENA  K+   AK+
Sbjct: 283 KTIVVASKNQGKIKEFKTMFEPAGITVKSLADFPSVPTVDETGTTFEENARQKADQYAKD 342

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +P ++DDSGL++D LDG+PGI SAR+A    G+   D A      A  +    D   R
Sbjct: 343 LQLPVIADDSGLMVDALDGQPGIRSARYA----GDGHNDAANNAKLLAALADVPEDD--R 396

Query: 126 SAHFISVLSLAWPDGHVEN---FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           +A F + L LA PD H E      G VSG+I   PRG  GFGYDP F      +T  EMT
Sbjct: 397 TATFHTTLVLAKPD-HPEADLVVHGDVSGLITAIPRGTDGFGYDPFFFVPALGKTMAEMT 455

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
            EEKN                +SHR  A +   D
Sbjct: 456 AEEKNQ---------------ISHRGNAMRALED 474


>gi|238798801|ref|ZP_04642271.1| Nucleoside-triphosphatase [Yersinia mollaretii ATCC 43969]
 gi|238717372|gb|EEQ09218.1| Nucleoside-triphosphatase [Yersinia mollaretii ATCC 43969]
          Length = 197

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 113/216 (52%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 2   QKIVLATGNPGKVRELASLLADFGLDVVAQTELGVESAEETGLTFIENALLKARHAAQMT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD-FDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR+A ++  +++  D  +  +++    +       R
Sbjct: 62  GLPAIADDSGLAVDALAGAPGIYSARFAGTDASDQENLDKLLVTLKDVPDGQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           SA F  VL       H ++     F G+  G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 SAQFHCVLVYMR---HADDPTPLVFHGQWPGVIAHQPAGTAGFGYDPIFYVPELGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKHA---------------VSHRGQALKLMLD 192


>gi|117928890|ref|YP_873441.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Acidothermus cellulolyticus 11B]
 gi|117649353|gb|ABK53455.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Acidothermus cellulolyticus 11B]
          Length = 211

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 113/216 (52%), Gaps = 26/216 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPE--ETGNSFEENAMIKSLTA 62
             +V+A+ N  K+ E+  ++   G+ +   +  +    +PE  ETG+SFE NA +K+   
Sbjct: 8   RRVVLATRNPHKLVELRRILSAAGLDSIELVGADAYPGLPEVAETGDSFEANARLKARAV 67

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
               G  A++DDSGLV+D L G PGI SARW+ S  G +D D A  ++   +  + A  P
Sbjct: 68  CAFTGELAIADDSGLVVDALGGMPGIFSARWSGSLAGNQDRDRANLQL---VLDQLADVP 124

Query: 123 -AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQ-PNGYDRTFGE 180
              R+A F+     A PDG      G+V G+I   PRG  GFGYDPIF+ P+G  RT  E
Sbjct: 125 DDRRTAKFVCAAVAALPDGREFVAHGEVHGVITRAPRGTNGFGYDPIFELPSG--RTTAE 182

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +   EK               D +SHR RAF+  V+
Sbjct: 183 LEPAEK---------------DAVSHRGRAFRALVE 203


>gi|333024797|ref|ZP_08452861.1| hypothetical protein STTU_2301 [Streptomyces sp. Tu6071]
 gi|332744649|gb|EGJ75090.1| hypothetical protein STTU_2301 [Streptomyces sp. Tu6071]
          Length = 200

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 112/219 (51%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  K+ E+ +      I++ + L   L+       IP+  ETG +F ENA++
Sbjct: 2   TRLILATRNAGKVTELHA------ILSEAGLGHELVGADAYPEIPDVKETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRS 116
           K+   A+  G+PA++DDSGL +DVL G PGI SARW+      E + D+ + ++ +    
Sbjct: 56  KAHALARATGLPAVADDSGLCVDVLGGAPGIFSARWSGRHGDDEANLDLLLAQLSDIA-- 113

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
                P  R+A F    +LA PDG      G + G +   P G  GFGYDP+ QP G DR
Sbjct: 114 -----PEHRAAGFACAAALALPDGTERVVEGHLRGTLRLAPAGGNGFGYDPVLQPEGLDR 168

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T  EKN                +SHR +AF+  V
Sbjct: 169 TCAELTPAEKNA---------------ISHRGKAFRALV 192


>gi|212638434|ref|YP_002314954.1| nucleoside-triphosphatase [Anoxybacillus flavithermus WK1]
 gi|212559914|gb|ACJ32969.1| Inosine triphosphate pyrophosphatase [Anoxybacillus flavithermus
           WK1]
          Length = 211

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 107/206 (51%), Gaps = 24/206 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP--EETGNSFEENAMIKSLTAAKNA 66
           I++A+ N  K+ E   L    GI   S L  +  IP  EETG +F ENA++K+ T A   
Sbjct: 12  IIVATKNKGKVAEFQQLFSKKGIDVLSLLAYD-DIPDVEETGTTFSENAILKATTIANML 70

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
               ++DDSGL++D L+G+PG++SAR+A    GE   D A   IE  L+         R+
Sbjct: 71  HETVIADDSGLIVDALNGEPGVYSARYA----GEGKNDQA--NIEKVLKKLQGVPFEQRT 124

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F   L++A P+G V    G   G I   P G+ GFGYDPIF      RT  ++T+EEK
Sbjct: 125 ARFHCTLAVAKPNGDVTTVDGVCEGYITEEPVGENGFGYDPIFFVPEKQRTMAQLTKEEK 184

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                +SHRA+A +
Sbjct: 185 NE---------------ISHRAKALQ 195


>gi|169831660|ref|YP_001717642.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Candidatus Desulforudis audaxviator MP104C]
 gi|169638504|gb|ACA60010.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Candidatus Desulforudis audaxviator MP104C]
          Length = 213

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 104/206 (50%), Gaps = 24/206 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTS-ALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
            +V+A+ N  K+ EM +L+ PLG+   S +    +    E G++FE NA+ K+   A   
Sbjct: 3   RLVLATRNEGKVREMAALLAPLGVEVVSLSSYPEIEEIPEEGDTFEANALTKARMVAART 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G  AL+DDSGL +DVLDG PG+HSAR+A E     R+ +  ++ +E     K       R
Sbjct: 63  GQLALADDSGLEVDVLDGAPGVHSARFAGEPRDDGRNNEKLLRLLEGVPWDK-------R 115

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F  V++L   +G      G   G I + PRG  GFGYDP+F    YD TFGE+    
Sbjct: 116 RARFRCVIALVTAEGTERLTEGTCEGFIGYEPRGTKGFGYDPLFYVPEYDMTFGELDLAT 175

Query: 186 KNGGIDSATLFSILSTDLLSHRARAF 211
           KN                +SHR RA 
Sbjct: 176 KN---------------RISHRGRAL 186


>gi|239618303|ref|YP_002941625.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Kosmotoga olearia TBF 19.5.1]
 gi|239507134|gb|ACR80621.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Kosmotoga olearia TBF 19.5.1]
          Length = 197

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 113/211 (53%), Gaps = 38/211 (18%)

Query: 9   IVIASHNVDKIHEMDSLIMPLG--IMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + + S N  K+ E+   I P G  I + ++L+++L I +E G++F +N+ IK + A +N 
Sbjct: 3   VYLVSGNTHKLLEIQK-IAPEGVEIESITSLDVSLNI-DENGDTFIQNS-IKKVEAFRNL 59

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+P ++DDSGL ID LDG PG+HSAR+ E ++ E      ++K+ N            R+
Sbjct: 60  GVPLIADDSGLEIDALDGFPGVHSARFMEEHSYEEKMQAILEKLANVEN---------RT 110

Query: 127 AHFISVLSLAWPDGHVENF-----SGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F    +   P    +NF      G V G I    RG  GFGYDPIF P GY +TFGE+
Sbjct: 111 ARFRCAATFFDP----KNFILLAAEGTVEGTIALEIRGNKGFGYDPIFIPEGYKKTFGEL 166

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            EE KN                +SHR+RAFK
Sbjct: 167 GEEIKNR---------------ISHRSRAFK 182


>gi|306836768|ref|ZP_07469729.1| nucleoside-triphosphatase [Corynebacterium accolens ATCC 49726]
 gi|304567355|gb|EFM42959.1| nucleoside-triphosphatase [Corynebacterium accolens ATCC 49726]
          Length = 200

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 110/211 (52%), Gaps = 33/211 (15%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-------PEETGNSFEENAMIKSLT 61
           I++AS N  K+ E+D ++   GI     +EL L+        P E G +F +NA+IK+  
Sbjct: 3   ILVASGNPKKLAELDRILSEAGI---EGVELRLLSEVEAYPEPIEDGRTFADNALIKARA 59

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            A   G+  ++DDSGL I+ L+G PG+ SARW    +G+   D A   +   + ++ A  
Sbjct: 60  GAAATGLVTIADDSGLAIEELNGMPGVLSARW----SGQHGNDQANNDL---VLAQMADV 112

Query: 122 P-AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           P   R+A F+SV +L  P+G      G+  G ++  PRG  GFGYDP+FQP G  R+  E
Sbjct: 113 PDERRAAAFVSVCALVTPEGTERVAEGRWEGKLLREPRGANGFGYDPLFQPEGESRSAAE 172

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
           M+  EKN                +SHR RA 
Sbjct: 173 MSPAEKNA---------------VSHRGRAL 188


>gi|238020107|ref|ZP_04600533.1| hypothetical protein VEIDISOL_01988 [Veillonella dispar ATCC 17748]
 gi|237863631|gb|EEP64921.1| hypothetical protein VEIDISOL_01988 [Veillonella dispar ATCC 17748]
          Length = 191

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 109/211 (51%), Gaps = 26/211 (12%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALE-LNLIIPEETGNSFEENAMIKSLTAAKNA 66
            IV+A+ N  KI E       L I      + +++  PEETG +F ENA++K+   AK  
Sbjct: 3   QIVLATGNKGKIREFSEAFSHLSIDCVPVKDVISIDEPEETGTTFMENALLKARYYAKAT 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAFR 125
             P L+DDSG+ +D L+G PG++SAR+A    G    D A  +K+   L+ K     + R
Sbjct: 63  NRPCLADDSGITVDALNGAPGVYSARYA----GHHGDDQANNEKLIRELQGK-----SDR 113

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           + H++  L+L +PDG      G   G++   P+G  GFGYDP F    +++T  E++ EE
Sbjct: 114 TGHYVCALALVYPDGREVTAEGYCDGLVQDEPKGDNGFGYDPYFYVPEFEKTMAELSIEE 173

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           K               + +SHR RA +  ++
Sbjct: 174 K---------------ETISHRGRALRKLIN 189


>gi|269926915|ref|YP_003323538.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269790575|gb|ACZ42716.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 202

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 115/213 (53%), Gaps = 26/213 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAKN 65
           + ++IAS N  K+ E   L+  LGI   S  +  +   PEETG++FEENA+IK+      
Sbjct: 4   SKLLIASDNPGKLAEYQELLSGLGIEIVSMRDAGIERAPEETGSTFEENALIKARYCWNM 63

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA--ESNTGERDFDMAMQKIENALRSKFAHDPA 123
            G+ +++DDSGL +  L G+PG+ S RWA  + +  ER+  + ++++  A  S       
Sbjct: 64  TGISSIADDSGLEVAALGGEPGVRSKRWAGEQISDAERN-KLLIERLNKASSSN------ 116

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            +SA F+ V++L    G+   F G+V G+I+  PRG  GFGYDPIF      +TF E+  
Sbjct: 117 -KSARFVCVIALIDRYGNEHLFRGEVEGVIIDHPRGSHGFGYDPIFYLPELGKTFAELDM 175

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
            EKN                +SHRARA +  VD
Sbjct: 176 LEKN---------------RVSHRARAAQLAVD 193


>gi|293189254|ref|ZP_06607977.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Actinomyces odontolyticus F0309]
 gi|292821717|gb|EFF80653.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Actinomyces odontolyticus F0309]
          Length = 204

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 112/215 (52%), Gaps = 30/215 (13%)

Query: 8   NIVIASHNVDKIHEMDSLIMPL------GIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            +V A+ N  K+ E+++++ P       G +   + + ++  P E G +FEEN++IK+  
Sbjct: 4   RLVFATSNAHKVSELEAILAPAWEGFEAGCVARMS-DFDVASPVEDGVTFEENSLIKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            A+  G+ A++DDSG+ +DVL G PGI SARWA    G    D A  ++   L  +    
Sbjct: 63  LARATGLAAIADDSGITVDVLGGAPGIFSARWA----GSHGDDAANLRL---LIDQLCDV 115

Query: 122 P-AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           P A R A F+S   L  PDG      G+V G +   P G+ GFGYDPIF P G++ T  +
Sbjct: 116 PDAHRGAAFVSAAVLVTPDGREFVERGEVRGTLTRSPCGEGGFGYDPIFVPEGFEVTTAQ 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           M+ ++KN                +SHR  AF+  +
Sbjct: 176 MSADQKNA---------------ISHRGIAFRALM 195


>gi|281426058|ref|ZP_06256971.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella oris F0302]
 gi|281399951|gb|EFB30782.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella oris F0302]
          Length = 206

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 109/209 (52%), Gaps = 30/209 (14%)

Query: 9   IVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           IV A++N  K+ E+  ++     I++   +  +  IPE TG + EENA +K+L   ++ G
Sbjct: 3   IVFATNNTHKLTEIREILGSAFEIVSLKDIGCDADIPE-TGQTLEENAHLKALYVYEHYG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +   +DD+GL ++ LDG+PG++SAR+AE       +D   +     L  K   D   R+A
Sbjct: 62  LDCFADDTGLEVEALDGEPGVYSARYAEQ------YDHNSEANTVKLLRKMT-DITHRNA 114

Query: 128 HFISVLSLAWPDG------HVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            F +V+SL   D       H   F G V G I    RG  GFGYDP+F P GYD++F E+
Sbjct: 115 RFRTVISLIQHDADNPGSYHETLFEGIVEGKIATEKRGTAGFGYDPVFIPEGYDKSFAEL 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARA 210
            EE KN                +SHRARA
Sbjct: 175 GEEVKN---------------RISHRARA 188


>gi|330685728|gb|EGG97364.1| non-canonical purine NTP pyrophosphatase RdgB [Staphylococcus
           epidermidis VCU121]
          Length = 195

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 106/180 (58%), Gaps = 11/180 (6%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +IVIAS+N  KI++  ++     ++  S L  +  + EETG +FEENA +KS+ AAK   
Sbjct: 3   DIVIASNNKGKINDFKAIFPNHNVIGISELIKDFDV-EETGTTFEENAKLKSVAAAKALN 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD-FDMAMQKIENALRSKFAHDPAFRS 126
              ++DDSGL +  L+G+PG++SAR+A  +  ++D  +  ++ +EN          + R+
Sbjct: 62  KQVIADDSGLEVQALNGEPGVYSARYAGLDKNDQDNINKLLKNMENI---------SDRN 112

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+ V+S++ P+G    F G V G I   P G  GFGYDPIF     ++T  ++++ EK
Sbjct: 113 AQFVCVISMSAPNGETTQFKGTVKGEITTEPIGDHGFGYDPIFYVPSLNKTMAQLSDAEK 172


>gi|269797500|ref|YP_003311400.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Veillonella parvula DSM 2008]
 gi|269094129|gb|ACZ24120.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Veillonella parvula DSM 2008]
          Length = 191

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 106/206 (51%), Gaps = 24/206 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALE-LNLIIPEETGNSFEENAMIKSLTAAKNA 66
            IV+A+ N  KI E       L I      + +++  PEETG +F ENA++K+   AK  
Sbjct: 3   QIVLATGNKGKIREFSEAFSHLSIDCVPVKDVISVEEPEETGTTFMENALLKARYYAKAT 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
             P L+DDSGL +D+LDG PG++SAR+A  +    D +   +K+   L+ K       R+
Sbjct: 63  NRPCLADDSGLTVDILDGAPGVYSARYAGHHG---DDNANNEKLIRELQGKRD-----RT 114

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            H++  L+L +PDG      G   G++   P+G+ GFGYDP F    +++T  E+     
Sbjct: 115 GHYVCALALVYPDGREVTAEGYCDGLVQDEPKGENGFGYDPYFYVPEFEKTMAEL----- 169

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
                     SI   + +SHR RA +
Sbjct: 170 ----------SIDVKETISHRGRALR 185


>gi|253990757|ref|YP_003042113.1| deoxyribonucleotide triphosphate pyrophosphatase [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|211639088|emb|CAR67700.1| yggV HAM1-like protein [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253782207|emb|CAQ85371.1| yggV HAM1-like protein [Photorhabdus asymbiotica]
          Length = 198

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 109/216 (50%), Gaps = 29/216 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+  L+   G+   +  ELN+   EETG +F ENA++K+  AA+  
Sbjct: 3   QKVVLATGNPGKVRELAQLLADFGLDIVAQTELNVDSAEETGLTFIENAILKARHAAQVT 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSGL +D+L G PGI+SAR+A  N  ++      Q +E  L +        R 
Sbjct: 63  GLPAIADDSGLSVDILGGAPGIYSARYAGENASDQ------QNLEKLLDTMKDVPDDQRQ 116

Query: 127 AHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  VL       H ++     F G+  GII   P G  GFGYDPIF       T  E+
Sbjct: 117 AQFNCVLVYIR---HAQDPTPLVFHGRWPGIIARKPTGNGGFGYDPIFYIPELGCTAAEL 173

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           T E+KN                +SHR +A K  +D 
Sbjct: 174 TGEQKNA---------------VSHRGQALKMMLDT 194


>gi|328955984|ref|YP_004373317.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Coriobacterium glomerans PW2]
 gi|328456308|gb|AEB07502.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Coriobacterium glomerans PW2]
          Length = 216

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 109/185 (58%), Gaps = 12/185 (6%)

Query: 8   NIVIASHNVDKIHEMDSL---IMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
            IV+A+ N  K+ E++S+   +MP  +    A   +   PEETG +F ENA+IK+  A  
Sbjct: 16  TIVVATGNAHKLVEIESILGRVMPDKVFVAIAQLGDFEEPEETGTTFLENALIKAEAAVA 75

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA- 123
             G+ A++DDSG+V+D L G+PG++SAR+A  + G+ + + A       L S+ A+ PA 
Sbjct: 76  ETGLAAIADDSGIVVDALGGEPGVYSARYAGVH-GDDEANNAK------LLSRLANTPAS 128

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGY-DRTFGEMT 182
            R+A F+SV++L    G V +  G   G I + P G+ GFGYDP+F P      T  E++
Sbjct: 129 ARTARFVSVVALIDAGGTVLSGEGSCEGSIGFAPHGENGFGYDPLFLPAARPGMTMAELS 188

Query: 183 EEEKN 187
            EEKN
Sbjct: 189 AEEKN 193


>gi|239629726|ref|ZP_04672757.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|239528412|gb|EEQ67413.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
          Length = 578

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 108/214 (50%), Gaps = 26/214 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             IV+AS N  KI E  ++  P GI   S  +  ++   +ETG +FEENA  K+   AK+
Sbjct: 377 KTIVVASKNQGKIKEFKTMFEPAGITVKSLADFPSVPTVDETGTTFEENARQKADQYAKD 436

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +P ++DDSGL++D LDG+PGI SAR+A    G+   D A      A  +    D   R
Sbjct: 437 LQLPVIADDSGLMVDALDGQPGIRSARYA----GDGHNDAANNAKLLAALADVPEDD--R 490

Query: 126 SAHFISVLSLAWPDGHVEN---FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           +A F + L LA PD H E      G VSG+I   PRG  GFGYDP F      +T  EMT
Sbjct: 491 TATFHTTLVLAKPD-HPEADLVVHGDVSGLITAIPRGTDGFGYDPFFFVPALGKTMAEMT 549

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
            EEKN                +SHR  A +   D
Sbjct: 550 AEEKNQ---------------ISHRGNAMRALED 568


>gi|257468118|ref|ZP_05632214.1| ribonuclease PH [Fusobacterium ulcerans ATCC 49185]
 gi|317062403|ref|ZP_07926888.1| ribonuclease PH [Fusobacterium ulcerans ATCC 49185]
 gi|313688079|gb|EFS24914.1| ribonuclease PH [Fusobacterium ulcerans ATCC 49185]
          Length = 196

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 110/206 (53%), Gaps = 26/206 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           I +A+ N  KI E+ ++   +  +   +++  + IPE  E G++FE N+  K+L  AK  
Sbjct: 3   IFLATGNKHKIEEITAIFKNVKNIEILSIKDGIDIPEVVEDGDTFEANSAKKALEIAKYT 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           GM  ++DDSGL +D L G PG++SAR++  +  +   D   +K+   L+ K       R 
Sbjct: 63  GMITIADDSGLCVDALGGAPGVYSARYSGEHATD---DSNNKKLIKELQGK-----ENRK 114

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           AHF+SV++L  PDG   +F G+V G I+  PRG  GFGYDP F    Y +T  EM +   
Sbjct: 115 AHFVSVVTLGKPDGRSYSFRGEVPGEIIDEPRGDKGFGYDPHFFVAEYGKTLAEMPD--- 171

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
                          +L+SHRA A K
Sbjct: 172 -------------VKNLISHRANALK 184


>gi|297618202|ref|YP_003703361.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Syntrophothermus lipocalidus DSM 12680]
 gi|297146039|gb|ADI02796.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Syntrophothermus lipocalidus DSM 12680]
          Length = 201

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 108/211 (51%), Gaps = 26/211 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTA 62
           +E  +V+A+ N  K+ E+  L+  +G+   S LE    +PE  E G +F ENA+ K+ T 
Sbjct: 1   MERKLVLATRNGKKLQELKQLLDGMGVEMLS-LEQFPEVPEVEEDGETFAENAIKKARTI 59

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQ-KIENALRSKFAHD 121
           A+  GM  L+DDSGL +D L G PG+HSAR+A    GE   D A   K+ + +R      
Sbjct: 60  AEVTGMVTLADDSGLEVDALGGSPGVHSARFA----GEHGDDAANNAKLMDLMRGVPEEK 115

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F  V+++A P G V    G   G I   PRG  GFGYDP+F   GY RT  E+
Sbjct: 116 ---RGARFRCVVAVAVPWGEVHLAEGTCEGKIAHEPRGDWGFGYDPLFVVEGYGRTMAEL 172

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
             E KN                +SHR RA +
Sbjct: 173 PPEVKNS---------------ISHRGRALE 188


>gi|260591960|ref|ZP_05857418.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella veroralis F0319]
 gi|260536244|gb|EEX18861.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella veroralis F0319]
          Length = 193

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 113/205 (55%), Gaps = 25/205 (12%)

Query: 9   IVIASHNVDKIHEM-DSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           IV A++N  K+ E+ D L     I++ + +  +  IPE TG + EENA  KS    ++  
Sbjct: 3   IVFATNNKHKLEEIKDILGKDFEIVSLAEIGCHEDIPE-TGLTLEENARQKSTYIVEHYN 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
               +DD+GL +D L+G+PG+HSAR+AE    + D +  M+K    L SK + +   R+A
Sbjct: 62  HDCFADDTGLEVDALNGEPGVHSARYAEGT--DHDSEANMRK----LLSKMS-NVKDRTA 114

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F +V+SL   +G    F G+V G I     G+ GFGYDPIF P GYD++F E+ EE KN
Sbjct: 115 RFRTVISLII-NGVEHQFEGRVEGRIATEKHGKEGFGYDPIFIPEGYDKSFAELGEEVKN 173

Query: 188 GGIDSATLFSILSTDLLSHRARAFK 212
                           +SHRARA K
Sbjct: 174 ---------------QISHRARAVK 183


>gi|170017583|ref|YP_001728502.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Leuconostoc citreum KM20]
 gi|169804440|gb|ACA83058.1| Non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Leuconostoc citreum KM20]
          Length = 200

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 105/184 (57%), Gaps = 14/184 (7%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGI-MTTSAL-ELNLIIPE--ETGNSFEENAMIKSLTAAK 64
           +++AS+N  KI E+ +++  L I +T   L EL+  IPE  E G +FEENA IK  T AK
Sbjct: 4   LILASNNAHKISELKAMLAMLHIELTVVPLNELDSNIPEIVENGKTFEENATIKVQTIAK 63

Query: 65  NA-GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
            A     L+DDSGL +D L G+PG++SAR+A  +  E + D  + K+             
Sbjct: 64  VAPNDYILADDSGLSVDALAGQPGVYSARYAGDHDDEANIDKVLTKLSGEKN-------- 115

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+AHF SVL L    G     +G+V G I    RG  GFGYDPIF    +D+TF E+T 
Sbjct: 116 -RTAHFNSVLVLIDNHGRRLVANGQVDGQITTACRGNNGFGYDPIFFVPQFDKTFAELTA 174

Query: 184 EEKN 187
           EEKN
Sbjct: 175 EEKN 178


>gi|189425093|ref|YP_001952270.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacter lovleyi SZ]
 gi|189421352|gb|ACD95750.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacter lovleyi SZ]
          Length = 196

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 109/210 (51%), Gaps = 24/210 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAK 64
             +++A+ N  KI E+ +L+  L      A +L   +PE  E G +F ENA+ K+  A+K
Sbjct: 2   TQLLVATRNRGKIKEIKALLDGLVEEIICAADLP-DLPETVEDGATFAENALKKAREASK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+  L+DDSGLV+D L G+PG++SAR+A     +   ++ +      L+         
Sbjct: 61  ATGLAVLADDSGLVVDGLGGRPGVYSARFAGVGANDAANNVKL------LQEVAGLSQVE 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F+  ++   PDG  + F G+V G I+  PRG  GFGYDP+F  NGY +T  E+  E
Sbjct: 115 RRAAFVCSMAYVSPDGVEQLFEGRVGGTIIDQPRGDHGFGYDPLFLVNGYQQTMAELPLE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCF 214
            KN                +SHR +A + F
Sbjct: 175 VKN---------------RISHRGQALRAF 189


>gi|326798879|ref|YP_004316698.1| nucleoside-triphosphatase rdgB [Sphingobacterium sp. 21]
 gi|326549643|gb|ADZ78028.1| Nucleoside-triphosphatase rdgB [Sphingobacterium sp. 21]
          Length = 191

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 73/210 (34%), Positives = 110/210 (52%), Gaps = 27/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPL-GIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             +V A++N  K+ E+ +++  L  I + S ++  + IPE T ++FE NA +KS     N
Sbjct: 2   QQLVFATNNKHKLEEVQAMVKGLFSIQSLSEIQCEVDIPE-TADTFEGNASLKSEYILSN 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                 +DDSGL ++ L+G+PG++SAR++ S   E++ D+ + K+          D   R
Sbjct: 61  YARDCFADDSGLEVEALNGEPGVYSARYSGSRDMEKNIDLLLSKLA---------DKTNR 111

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F +V+SL     H   F G V G I     G  GFGYDPIF P+GY +TF EM+ +E
Sbjct: 112 KAQFRTVISLRLGGEH-HFFEGIVKGSITQERIGLRGFGYDPIFIPDGYIKTFAEMSADE 170

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           KN                +SHRA A +  V
Sbjct: 171 KNQ---------------ISHRAVAIQKLV 185


>gi|297570034|ref|YP_003691378.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296925949|gb|ADH86759.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 228

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 102/182 (56%), Gaps = 13/182 (7%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           IV+A+ N  K+ E+  ++    +   S  +    +PE  E G +F++NA  K+L  AK  
Sbjct: 5   IVLATRNQGKVKELQQMLAGFPVDIRSLADFG-PLPEVVEDGATFDDNAYKKALFTAKAL 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +  LDG PG++SAR+A    GE+  D A + K+   +  K       R
Sbjct: 64  GLPAMADDSGLEVAALDGAPGVYSARYA----GEKADDAANIAKLLKEMEGK-----EDR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F+ VLSLA P G    + G+  G I   P+G  GFGYDP+   +   +TF EMT EE
Sbjct: 115 RAAFVCVLSLAVPSGPALTYEGRCEGEITHEPKGSGGFGYDPVMFYHPLGKTFAEMTPEE 174

Query: 186 KN 187
           KN
Sbjct: 175 KN 176


>gi|284048059|ref|YP_003398398.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Acidaminococcus fermentans DSM 20731]
 gi|283952280|gb|ADB47083.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Acidaminococcus fermentans DSM 20731]
          Length = 197

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 110/212 (51%), Gaps = 27/212 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAKNAG 67
           +VIA+HN+ K+ E  SL+  LGI  T   +   +  PEETG +F  NA +K+   AK  G
Sbjct: 4   VVIATHNLGKVEEFKSLMDELGITFTCLSDYAPVPEPEETGRTFAANARLKARYYAKVLG 63

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
              L+DDSGL +  L G PG+ SAR+A E  T E + ++ +  ++  +R         R+
Sbjct: 64  KICLADDSGLEVLSLKGAPGVRSARYAGEEATDEENNELLLANMKMQVR---------RN 114

Query: 127 AHFISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             F   L++A P+G +    +G   GI++  P G  GFGYDP+F      +  GE T EE
Sbjct: 115 CRFFCALAMANPEGKILVESAGICDGILLHEPHGTNGFGYDPLFWSTELHKPLGEATMEE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           KNG               +SHRA+A +  V+ 
Sbjct: 175 KNG---------------ISHRAKAIRKLVNQ 191


>gi|227548662|ref|ZP_03978711.1| nucleoside-triphosphatase [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227079276|gb|EEI17239.1| nucleoside-triphosphatase [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 205

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 104/212 (49%), Gaps = 26/212 (12%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI----IPEETGNSFEENAMIKSLTAA 63
            +++AS N  K+ E+++++  LGI     + +  +     P E G +FE+NA+IK+   A
Sbjct: 3   KVLVASGNQKKLAELEAVLAELGIAGVELVSMRDVDAYPEPVEDGLTFEDNALIKARAGA 62

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
              G+  ++DDSGL +  L G PG+ SARW    +G    D A     NAL      D A
Sbjct: 63  AATGLACVADDSGLAVTALKGMPGVLSARW----SGTHGDDAA----NNALLLGQMTDIA 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+S  +L  P G      G+  G ++  PRG+ GFGYDPIFQPN           
Sbjct: 115 LRDAAFVSCCALVGPAGDEFTAEGRWEGQLLREPRGENGFGYDPIFQPN----------- 163

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
              +GG  SA   S    +  SHRARA     
Sbjct: 164 ---DGGGRSAAQLSAAEKNERSHRARALTALA 192


>gi|88801069|ref|ZP_01116617.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Reinekea
           sp. MED297]
 gi|88776208|gb|EAR07435.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Reinekea
           sp. MED297]
          Length = 202

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 110/211 (52%), Gaps = 28/211 (13%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMP 69
           V+AS+N  K+ E   L+ P  I      E  +    E G SF ENA+IK+  A+K  G+P
Sbjct: 8   VLASNNAGKLKEFSELLAPKSITIKPQKEYGVDDAIEDGLSFIENAIIKARHASKATGLP 67

Query: 70  ALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHF 129
           AL+DDSGL +DVLDG PGI+SAR+A  + GE+     ++K+ + ++     D   R+A F
Sbjct: 68  ALADDSGLEVDVLDGAPGIYSARYASMDGGEKSDRANLEKVLSEMQ-----DAQNRTARF 122

Query: 130 ISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
             VL+      H  +       G   G ++  PRG+ GFGYDPIF    +  +  E+++ 
Sbjct: 123 HCVLAFV---RHALDPTPIIIQGTWEGSLLTEPRGEQGFGYDPIFWVEDHQCSAAELSKA 179

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           +KN                LSHR +A + FV
Sbjct: 180 QKNA---------------LSHRGQAVRQFV 195


>gi|289432910|ref|YP_003462783.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dehalococcoides sp. GT]
 gi|288946630|gb|ADC74327.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dehalococcoides sp. GT]
          Length = 199

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 106/205 (51%), Gaps = 24/205 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAKNA 66
            +++AS+N  K+ E  SL+   G    +  EL + I   ETG +FEENA +K+   A+ +
Sbjct: 3   KLLLASNNAGKLKEYQSLLSGCGFEVVTPAELGIKITVAETGTTFEENARLKAAALAEAS 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDF-DMAMQKIENALRSKFAHDPAFR 125
           G+  L+DDSGL +D L G+PG++SAR+A  N  + D  D  + K+E+   +K       R
Sbjct: 63  GLLTLADDSGLEVDALGGEPGLYSARYAGENATDTDRNDYLLSKMEDIPANK-------R 115

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F  V+++  P   +    G   G+I   P G  GFGYDPIF    Y +T  E+  E 
Sbjct: 116 TARFRCVIAIVQPGHTLPAIEGSCEGLIATEPHGVNGFGYDPIFYLPEYRKTMAELPLEI 175

Query: 186 KNGGIDSATLFSILSTDLLSHRARA 210
           KN                LSHRA A
Sbjct: 176 KNS---------------LSHRAIA 185


>gi|116617726|ref|YP_818097.1| xanthosine triphosphate pyrophosphatase [Leuconostoc mesenteroides
           subsp. mesenteroides ATCC 8293]
 gi|122272073|sp|Q03YJ8|NTPA_LEUMM RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|116096573|gb|ABJ61724.1| Xanthosine triphosphate pyrophosphatase [Leuconostoc mesenteroides
           subsp. mesenteroides ATCC 8293]
          Length = 201

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 108/183 (59%), Gaps = 11/183 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGI-MTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKN 65
           ++IAS+N  KI E+++L+  + I +   +L+    +PE  E G +FEENA+ K  T AK 
Sbjct: 3   LIIASNNAHKITEIEALLASISIDLPVVSLQEIGDVPEIVEDGTTFEENAVKKVETIAKV 62

Query: 66  AGMP-ALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           A     L+DDSG+ +D L+G+PG++SAR+A  +  + + D  +QK+      +       
Sbjct: 63  APNDYILADDSGMSVDALNGEPGVYSARYAGDHDDQANIDKVLQKLAKVPNEQ------- 115

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+AHF SV++L  P G     +G+V G I    RGQ GFGYDPIF     ++TF EM+  
Sbjct: 116 RTAHFNSVIALHSPKGSNLIVNGQVDGYITESERGQDGFGYDPIFFVPSMNKTFAEMSAS 175

Query: 185 EKN 187
           EKN
Sbjct: 176 EKN 178


>gi|227432401|ref|ZP_03914391.1| nucleoside-triphosphatase [Leuconostoc mesenteroides subsp.
           cremoris ATCC 19254]
 gi|227351840|gb|EEJ42076.1| nucleoside-triphosphatase [Leuconostoc mesenteroides subsp.
           cremoris ATCC 19254]
          Length = 201

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 108/183 (59%), Gaps = 11/183 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGI-MTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKN 65
           ++IAS+N  KI E+++L+  + I +   +L+    +PE  E G +FEENA+ K  T AK 
Sbjct: 3   LIIASNNAHKITEIEALLASISIDLPVVSLQEIGDVPEIVEDGTTFEENAVKKVETIAKV 62

Query: 66  AGMP-ALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           A     L+DDSG+ +D L+G+PG++SAR+A  +  + + D  +QK+      +       
Sbjct: 63  APNDYILADDSGMSVDALNGEPGVYSARYAGDHDDQANIDKVLQKLAKVPNEQ------- 115

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+AHF SV++L  P G     +G+V G I    RGQ GFGYDPIF     ++TF EM+  
Sbjct: 116 RTAHFNSVIALHSPKGSNLIVNGQVDGYITESERGQGGFGYDPIFFVPSMNKTFAEMSAS 175

Query: 185 EKN 187
           EKN
Sbjct: 176 EKN 178


>gi|324115031|gb|EGC08996.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           fergusonii B253]
          Length = 197

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 113/216 (52%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETLKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G  SG+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWSGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|299142475|ref|ZP_07035607.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella oris C735]
 gi|298576197|gb|EFI48071.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella oris C735]
          Length = 206

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 113/211 (53%), Gaps = 34/211 (16%)

Query: 9   IVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           IV A++N  K+ E+  ++     I++   +  +  IPE TG + EENA +K+L   ++ G
Sbjct: 3   IVFATNNTHKLTEIREILGSAFEIVSLKDIGCDADIPE-TGQTLEENAHLKALYVYEHYG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAES--NTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +   +DD+GL ++ L+G+PG++SAR+AE   +  E +    ++K+ +  R         R
Sbjct: 62  LDCFADDTGLEVEALNGEPGVYSARYAEQYDHNSEANTVKLLRKMTDITR---------R 112

Query: 126 SAHFISVLSLAWPDG------HVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
           +A F +V+SL   D       H   F G V G I    RG  GFGYDP+F PNGYD++F 
Sbjct: 113 NACFRTVISLIQHDADNPGSYHETLFEGIVEGKIATEKRGTAGFGYDPVFIPNGYDKSFA 172

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARA 210
           E+ EE KN                +SHRARA
Sbjct: 173 ELGEEIKNK---------------ISHRARA 188


>gi|29831715|ref|NP_826349.1| hypothetical protein SAV_5172 [Streptomyces avermitilis MA-4680]
 gi|62900271|sp|Q82D15|NTPA_STRAW RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|29608831|dbj|BAC72884.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 200

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 76/219 (34%), Positives = 115/219 (52%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ +      I+  + L  +L+       IP+  ETG +F ENA++
Sbjct: 2   TRLILATRNAGKITELRA------ILADAGLTHDLVGADAYPDIPDVKETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRS 116
           K+   A+  G+PA++DDSGL +DVL G PGI SARW+  +  +R + D+ + ++ +    
Sbjct: 56  KAHALARATGLPAVADDSGLCVDVLGGAPGIFSARWSGRHGDDRANLDLLLAQLSDI--- 112

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
                 A R AHF    +LA PDG      G++ G +   P G  GFGYDP+ QP G  R
Sbjct: 113 ----SEAHRGAHFACAAALALPDGTERVVEGQLRGTLRHTPTGTNGFGYDPVLQPEGETR 168

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E++ EEKN                +SHR +AF+  V
Sbjct: 169 TCAELSAEEKNA---------------ISHRGKAFRELV 192


>gi|284054080|ref|ZP_06384290.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Arthrospira platensis str. Paraca]
 gi|291569591|dbj|BAI91863.1| HAM1-like protein [Arthrospira platensis NIES-39]
          Length = 193

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 109/204 (53%), Gaps = 29/204 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +V+A+ N  K++EM + +   GI     L+ + +  EETGN+F ENA +K+   AK  G 
Sbjct: 5   LVVATGNPGKLNEMQAYLG--GIDVKLQLKPDNLDVEETGNTFLENACLKASEVAKATGE 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
            A++DDSGL +D L G PG++SAR+A +++        ++++E A         A RSA 
Sbjct: 63  WAIADDSGLAVDALGGMPGVYSARYASTDSDR--ISKLLKELETA---------ADRSAQ 111

Query: 129 FISVLSLAWPDGH-VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           FI  +++  PDG  V+   G   G+I   P+GQ GFGYDPIF       TF +M+ E K 
Sbjct: 112 FICAIAICRPDGSIVQQVQGICPGVIAQTPQGQGGFGYDPIFYVPEQQMTFAQMSPELKR 171

Query: 188 GGIDSATLFSILSTDLLSHRARAF 211
                           +SHR +AF
Sbjct: 172 K---------------ISHRGKAF 180


>gi|261868179|ref|YP_003256101.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413511|gb|ACX82882.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 226

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 111/205 (54%), Gaps = 10/205 (4%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R  ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  
Sbjct: 27  RTNMKQKIVLATANQGKVREMADVLADFGFDVIAQTDLGIDSPEETGLTFVENAILKARY 86

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+ +G+PA++DDSGLV+D L+G PG++SAR+A    GE   D    K    L ++ AH 
Sbjct: 87  AAEKSGLPAIADDSGLVVDALNGAPGLYSARYA----GEEGNDA---KNRAKLLAELAHV 139

Query: 122 PA-FRSAHFISVLSLAW--PDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
           PA  R A F+S + L     D       G+  G+I +  +G+ GFGYD +F       TF
Sbjct: 140 PAEQRKAKFVSTIVLLQHPTDPSPIIAQGECHGVIAFEEKGENGFGYDALFFSPQQGCTF 199

Query: 179 GEMTEEEKNGGIDSATLFSILSTDL 203
            E+   EK      A   ++L T L
Sbjct: 200 AELDTVEKKKISHRARALAVLKTKL 224


>gi|329936580|ref|ZP_08286316.1| ribonuclease PH/Ham1 protein [Streptomyces griseoaurantiacus M045]
 gi|329304095|gb|EGG47977.1| ribonuclease PH/Ham1 protein [Streptomyces griseoaurantiacus M045]
          Length = 200

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 114/219 (52%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ +      I+  + L   L+       IP+  ETG +F ENA++
Sbjct: 2   TRLILATRNAGKITELRA------ILAEAGLPHELVGADDFPEIPDVKETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRS 116
           K+   A+  G+PA++DDSGL +DVL G PGI SARWA  +  ++ + D+ + ++ +    
Sbjct: 56  KAHALARATGLPAVADDSGLCVDVLGGAPGIFSARWAGRHGDDKANLDLLLAQLGDI--- 112

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
               D   R AHF    +LA PDG      G+++G +   P G  GFGYDPI QP G  R
Sbjct: 113 ----DAPHRGAHFACAAALALPDGTERVVEGRLTGTLRHAPAGTNGFGYDPILQPEGDTR 168

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T  EKN                +SHR +AF+  V
Sbjct: 169 TCAELTPAEKNA---------------ISHRGQAFRALV 192


>gi|330466054|ref|YP_004403797.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase protein
           [Verrucosispora maris AB-18-032]
 gi|328809025|gb|AEB43197.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Verrucosispora maris AB-18-032]
          Length = 201

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 109/212 (51%), Gaps = 28/212 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLI--IPE--ETGNSFEENAMIKSLT 61
           N +++A+ N  K+ E+  ++   LG    + + L+ +   PE  ETG +F ENA+IK+  
Sbjct: 2   NKVLLATRNRKKLIELQRILDGALGAHRIALVGLDDVEAYPELPETGLTFGENALIKARE 61

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAH 120
             +  G+P ++DDSGL +D L+G PG+ SARWA      E +  + + +I +        
Sbjct: 62  GCRRTGLPTIADDSGLAVDALNGMPGVFSARWAGRHGDDEANLQLVLDQIGDV------- 114

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R A F+  ++L  P G      G+  G ++  PRG  GFGYDPIF  +G DRT  E
Sbjct: 115 PDEHRGASFVCTVALVLPGGKEHLVDGRQQGRLLRAPRGDGGFGYDPIFLGDGQDRTNAE 174

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           +T +EK               D +SHR +A +
Sbjct: 175 LTPQEK---------------DAISHRGKALR 191


>gi|320656643|gb|EFX24539.1| dITP/XTP pyrophosphatase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
          Length = 197

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 113/216 (52%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G+PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDVLGGEPGIYSARYSGEDATDQKNLQKLLETLKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|297559366|ref|YP_003678340.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296843814|gb|ADH65834.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
          Length = 201

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 106/201 (52%), Gaps = 10/201 (4%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPE--ETGNSFEENAMIKSLTAA 63
            IV+A+ N  K+ EM +++   G+     L L+     PE  ET  SF  NA++K+   A
Sbjct: 2   KIVLATRNAKKVPEMRAILADAGV-EAEVLSLDAFPDAPEVPETEASFLGNALLKARAIA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
            + G+PA++DDSG+ +D L G PG+ SARWA    G  D D A   +   +  + A  PA
Sbjct: 61  AHTGLPAVADDSGIAVDELRGMPGVLSARWA-GRFGAGDQDRANLDL---VLDQMADTPA 116

Query: 124 -FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F+    L  PDG      G + G +V   RG+ GFGYDP+F P G  RT  E++
Sbjct: 117 ERRGAAFVCAAVLVMPDGTEAVAEGVLRGRLVRERRGENGFGYDPVFVPEGESRTTAELS 176

Query: 183 EEEKNGGIDSATLFSILSTDL 203
            EEKN      T F  L+ +L
Sbjct: 177 PEEKNAISHRGTAFRKLAREL 197


>gi|302560439|ref|ZP_07312781.1| Ham1 family protein [Streptomyces griseoflavus Tu4000]
 gi|302478057|gb|EFL41150.1| Ham1 family protein [Streptomyces griseoflavus Tu4000]
          Length = 200

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 115/213 (53%), Gaps = 26/213 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGI---MTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
             +++A+ N  KI E+ +++   G+   +  +    ++   +ETG +F ENA++K+   A
Sbjct: 2   TRLILATRNAGKISELRAILADAGLPHDLVGADAYPDIPDVKETGVTFAENALLKAHALA 61

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAHDP 122
           +  G+PA++DDSGL +DVL+G PGI SARWA ++  ++ + D+ + ++     S  A + 
Sbjct: 62  RATGLPAVADDSGLCVDVLNGAPGIFSARWAGTHGDDKANLDLLLAQL-----SDIADE- 115

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R AHF    +LA PDG      G + G +   P G  GFGYDPI QP G  RT  E+T
Sbjct: 116 -HRGAHFACAAALALPDGTERVVEGDLMGTLRHTPAGTGGFGYDPILQPEGATRTCAELT 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
             EKN                +SHR +AF+  V
Sbjct: 175 AAEKNA---------------ISHRGKAFRALV 192


>gi|218550201|ref|YP_002383992.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia
           fergusonii ATCC 35469]
 gi|218357742|emb|CAQ90386.1| dITP/XTP pyrophosphatase [Escherichia fergusonii ATCC 35469]
 gi|325498511|gb|EGC96370.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia
           fergusonii ECD227]
          Length = 197

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 113/216 (52%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G  SG+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWSGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|300859073|ref|YP_003784056.1| hypothetical protein cpfrc_01656 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300686527|gb|ADK29449.1| hypothetical protein cpfrc_01656 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302206776|gb|ADL11118.1| Putative deoxyribonucleotide triphosphate pyrophosphatase
           [Corynebacterium pseudotuberculosis C231]
 gi|302331329|gb|ADL21523.1| Putative deoxyribonucleotide triphosphate pyrophosphatase
           [Corynebacterium pseudotuberculosis 1002]
 gi|308277021|gb|ADO26920.1| Xanthosine triphosphate pyrophosphatase [Corynebacterium
           pseudotuberculosis I19]
          Length = 207

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 113/223 (50%), Gaps = 32/223 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP----EETGNSFEENAMIKSLTAAK 64
           I+IAS+N  K+ E++ ++   G+     + L  + P    +E G SF +NA+IK+    K
Sbjct: 3   ILIASNNAKKLKELEVILEASGVSGAEIVPLRAVEPYPEPQEDGRSFADNALIKARAGVK 62

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-A 123
           N G+  ++DDSGL+++ L+G PG+ SARW    +G    D A     N L  + +  P  
Sbjct: 63  NTGLVTIADDSGLMVEELNGMPGVLSARW----SGSHGDDAANN---NLLLKQMSDVPEE 115

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPN-----GYDRTF 178
            R A F+SV +L  PDG      G+  G ++  P+G  GFGYDP+F P      G  R+ 
Sbjct: 116 RRQAAFVSVCALVTPDGTEHLVEGRWEGRLLTAPQGDNGFGYDPLFVPGEEDSAGTYRSS 175

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            E++ EEKN                +SHR +A K  V    RI
Sbjct: 176 AELSAEEKNA---------------ISHRGKALKQLVPIISRI 203


>gi|160915912|ref|ZP_02078120.1| hypothetical protein EUBDOL_01935 [Eubacterium dolichum DSM 3991]
 gi|158432388|gb|EDP10677.1| hypothetical protein EUBDOL_01935 [Eubacterium dolichum DSM 3991]
          Length = 191

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 102/207 (49%), Gaps = 24/207 (11%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAGM 68
           ++A+ N  K+ E   ++ PLG    S L+L   I  EE G SFEENA+IK+    +  G+
Sbjct: 1   MLATSNAHKVEEFSVMLAPLGYEVMSLLDLEEPIEIEENGTSFEENALIKARAIHQLLGI 60

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
             L+DDSGL ++ ++G+PGI+SAR+   +T           I+N     F  D   +   
Sbjct: 61  EVLADDSGLAVNAMNGEPGIYSARFMGKDTS--------YAIKNQYIIDFCKDKEDKGCQ 112

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F+  L+    DG    F G V G++     G+ GFGYDP+F    Y+ T   + EE+KN 
Sbjct: 113 FVCALAYVKADGSEAVFKGVVEGLVADHIEGEHGFGYDPLFYYPPYETTLANVDEEKKNA 172

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFV 215
                          +SHR RA K  +
Sbjct: 173 ---------------VSHRGRAIKALI 184


>gi|83648997|ref|YP_437432.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Hahella
           chejuensis KCTC 2396]
 gi|83637040|gb|ABC33007.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Hahella
           chejuensis KCTC 2396]
          Length = 199

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 110/218 (50%), Gaps = 25/218 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+ASHN  KI E++ L+  L I   S  ELN+   EETG +F ENA++K+  AA  +
Sbjct: 2   QKIVLASHNAGKIKELNRLLGSLDITVVSQKELNIPSIEETGQTFIENAILKARHAAAVS 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-AFR 125
           G+PAL+DDSGL +D L G PGI+SAR+A  +  ++D +  + ++        A+ P   R
Sbjct: 62  GLPALADDSGLEVDALQGAPGIYSARFAGESASDQDNNAKLLQL-------LANTPTGAR 114

Query: 126 SAHFISVLSLAWPDGHVENF--SGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL+    +         G   G I     G  GFGYDP+F  +    T  E+T 
Sbjct: 115 TARFHCVLAFMRHEADPVPVICHGAWEGSIAEQASGGGGFGYDPLFWLSDRQCTSAELTP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EEKN                LSHR +A    V    R+
Sbjct: 175 EEKNA---------------LSHRGQAMAQLVAELTRL 197


>gi|253701666|ref|YP_003022855.1| nucleoside-triphosphatase [Geobacter sp. M21]
 gi|251776516|gb|ACT19097.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacter sp. M21]
          Length = 201

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 109/208 (52%), Gaps = 24/208 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             +++AS N  K+ E + L+  +     S  +   L   EE G+SFE NA+ K+ +AA  
Sbjct: 2   KELLVASGNKGKLREFEKLLEGVVETILSPADFPGLPEVEEDGDSFEANALKKARSAALF 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFAHDPAF 124
            G P L+DDSGL +D L G+PG++SAR+A    G+  +  + +Q++  A R +       
Sbjct: 62  TGKPVLADDSGLCVDCLGGRPGVYSARFAGEGAGDAANNALLLQEMAGAPREE------- 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+  F  V++L   DG  + F G + G I+  PRG+ GFGYDP+F    Y +TF E+  E
Sbjct: 115 RTGAFHCVIALCLHDGSCQTFDGMLKGEILEAPRGEGGFGYDPLFLVPEYGQTFSELPME 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
            KN                +SHR RA +
Sbjct: 175 IKNA---------------ISHRGRAMQ 187


>gi|317968599|ref|ZP_07969989.1| dITP/XTP pyrophosphatase [Synechococcus sp. CB0205]
          Length = 200

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 103/209 (49%), Gaps = 24/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +VIAS N  K+ E   L+  LG+ T    E   I  EETG++F  NA +K+   A+  
Sbjct: 2   TTLVIASGNAGKVREFAQLLKDLGLDTQPQPEG--IEVEETGDTFAANARLKAEAVAQAT 59

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G  AL+DDSGL +D L G PG+HSAR+A ++         ++++   L    A DPA RS
Sbjct: 60  GQWALADDSGLSVDALGGVPGVHSARYAATDAAR------IERLLQELNDAGALDPAARS 113

Query: 127 AHFISVLSLAWPDGHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           A F + L+LA P G V     G   G I+   RG  GFGYDP+F       +F EM +  
Sbjct: 114 ARFTAALALADPSGRVVLEVEGHCPGQILMACRGDGGFGYDPVFYVPEVQLSFAEMPK-- 171

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCF 214
                        L  D + HR RAF   
Sbjct: 172 ------------ALKAD-VGHRGRAFSAL 187


>gi|289522119|ref|ZP_06438973.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289504649|gb|EFD25813.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 220

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 105/214 (49%), Gaps = 27/214 (12%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           L+ N +V AS N  K +EM  L     +    A +L  I  EE GNS+ ENA++K+   A
Sbjct: 24  LVNNKVVFASKNKGKYNEMVVLFGEAPVELVFAPDLMDIDVEEYGNSYSENALLKASVWA 83

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  GMPAL+DDSGL +D L   PG++S+R AE +           +I   L +    D  
Sbjct: 84  KALGMPALADDSGLEVDALGKSPGVYSSRVAEDDE---------SRIAWVLNNMV--DMK 132

Query: 124 FRSAHFISVLSLAWP-DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
            R A F++ L+L  P    V   SG   G I    RG  GFGYDPIF P GYD+TF E+ 
Sbjct: 133 ERKARFVASLALVLPRTNQVWLVSGFCYGQIALSGRGAEGFGYDPIFIPKGYDKTFAELG 192

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
              KN                +SHR+ A +   D
Sbjct: 193 HGIKN---------------RVSHRSVAVRALCD 211


>gi|283769366|ref|ZP_06342265.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bulleidia extructa W1219]
 gi|283104023|gb|EFC05407.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bulleidia extructa W1219]
          Length = 197

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 67/183 (36%), Positives = 100/183 (54%), Gaps = 9/183 (4%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAA 63
           ++N I+IA+ N +K++E   ++ P+G    S L+  +    EE G +FE+NA IK+ T +
Sbjct: 1   MKNEIIIATKNQNKVYEFKQMLEPMGYQVKSLLDYQDFPNIEEDGFTFEDNARIKAETTS 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G   +SDDSGL ID  DG+PG+HSARW    T    +    Q I + +R     D  
Sbjct: 61  KLLGCMVISDDSGLEIDAFDGQPGVHSARWLGELT---PYSYKNQVILDRMR-----DEP 112

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A ++ VL+LA P+     F G+    +    +G+ GFGYDPI       +T  EM++
Sbjct: 113 NRLARYVCVLALARPNKETIFFRGECEVEVALEAKGKHGFGYDPIMLDKNSGKTLAEMSD 172

Query: 184 EEK 186
            EK
Sbjct: 173 TEK 175


>gi|317124458|ref|YP_004098570.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Intrasporangium calvum DSM 43043]
 gi|315588546|gb|ADU47843.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Intrasporangium calvum DSM 43043]
          Length = 210

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 114/226 (50%), Gaps = 43/226 (19%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI----IPE-----ETGNSFEENAMI 57
             +V+A+ N  K+ EM  ++  +     + L+L ++     P+     E G +FE NA++
Sbjct: 2   TRLVLATRNHHKVEEMREILADV----CTQLDLEIVGLDEFPDAPDVVEDGVTFETNAVL 57

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD---FDMAMQKIENAL 114
           K+ +AA+  G+PAL+DDSGL +DVL G PGI SARW+       D    ++ + ++++  
Sbjct: 58  KAQSAAEATGLPALADDSGLAVDVLGGAPGIFSARWSGRKGAGADRANLELLLAQLDDV- 116

Query: 115 RSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNG- 173
             +  H    R A F+   +L  PDG      G+  G +   PRG  GFGYDPIF P+G 
Sbjct: 117 --RHEH----RGAAFVCAAALVLPDGRSAVEVGRFPGQVAREPRGTGGFGYDPIFVPDGQ 170

Query: 174 ----YDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
                +RT  E +  EKNG               +SHR  AF+  V
Sbjct: 171 PDASLERTLAEYSPAEKNG---------------VSHRHVAFRALV 201


>gi|238787375|ref|ZP_04631174.1| Nucleoside-triphosphatase [Yersinia frederiksenii ATCC 33641]
 gi|238724637|gb|EEQ16278.1| Nucleoside-triphosphatase [Yersinia frederiksenii ATCC 33641]
          Length = 210

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 112/215 (52%), Gaps = 29/215 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 15  QKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQTT 74

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSGL +D L G PGI+SAR+A  +  +++    ++K+  AL+         R 
Sbjct: 75  GLPAIADDSGLAVDALGGAPGIYSARYAGIDASDQE---NLEKLLVALKDIPDEQ---RG 128

Query: 127 AHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  VL       H E+     F G+  G+I   P G  GFGYDPIF      +T  E+
Sbjct: 129 AQFHCVLVYMR---HAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPELGKTAAEL 185

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           T EEK+                +SHR +A K  +D
Sbjct: 186 TREEKHA---------------VSHRGQALKLMLD 205


>gi|283470361|emb|CAQ49572.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus aureus subsp. aureus ST398]
          Length = 195

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 105/179 (58%), Gaps = 11/179 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIAS+N  KI++   +     ++  S L  +  + EETG++FEENA++KS  AAK    
Sbjct: 4   IVIASNNQGKINDFKVIFPDYHVIGISELIPDFDV-EETGSTFEENAILKSEAAAKALNK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             ++DDSGL +  L+G+PGI+SAR+A E+ + E + +  + K+ N            R A
Sbjct: 63  TVIADDSGLEVFALNGEPGIYSARYAGENKSDEANIEKLLNKLGNTTD---------RRA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ PD   + F G VSG I     G+ GFGYDPIF     DRT  ++++E+K
Sbjct: 114 QFVCVISMSGPDMETKVFKGTVSGEIADGKYGENGFGYDPIFYVPKLDRTMAQLSKEQK 172


>gi|89098916|ref|ZP_01171796.1| hypothetical protein B14911_06101 [Bacillus sp. NRRL B-14911]
 gi|89086320|gb|EAR65441.1| hypothetical protein B14911_06101 [Bacillus sp. NRRL B-14911]
          Length = 207

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 107/208 (51%), Gaps = 24/208 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             ++IA+ N  K  E   +  PLG    + L+       EETG++FEENA++K+   +K 
Sbjct: 5   QEVIIATKNTGKAKEFSRMFKPLGYEVKTLLDFPEFEDIEETGSTFEENAVLKAEAVSKA 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            G   ++DDSGL+ID L+G+PGI+SAR+A E+ + E +    + ++E     K       
Sbjct: 65  FGKIVIADDSGLMIDALEGRPGIYSARYAGEAKSDEANMQKVLAELEGVPEEK------- 117

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L+++ P       SG   G I+   RG  GFGYDPIF     +++  E+  E
Sbjct: 118 RTARFYCALAVSVPGKEAYTVSGACEGRILTDKRGSHGFGYDPIFFVTEKNKSMAELPPE 177

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
           EK+                +SHRA+A +
Sbjct: 178 EKS---------------QISHRAKALE 190


>gi|182438433|ref|YP_001826152.1| hypothetical protein SGR_4640 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326779083|ref|ZP_08238348.1| Nucleoside-triphosphatase rdgB [Streptomyces cf. griseus XylebKG-1]
 gi|178466949|dbj|BAG21469.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326659416|gb|EGE44262.1| Nucleoside-triphosphatase rdgB [Streptomyces cf. griseus XylebKG-1]
          Length = 200

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 114/218 (52%), Gaps = 36/218 (16%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ +      I+  + L+L+L+       IP+  ETG +F ENA++
Sbjct: 2   KRLILATRNAGKITELHA------ILADAGLDLDLVGADAYPDIPDVKETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSK 117
           K+   A+  G+PA++DDSGL +DVL G PGI SARW    +G    D A   +  A    
Sbjct: 56  KAHALARATGLPAVADDSGLCVDVLGGAPGIFSARW----SGTHGDDEANLNLLLAQLGD 111

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
            A +   R A+F    +LA PDG      G+++G++   P G  GFGYDPI QP G  RT
Sbjct: 112 IADE--HRGAYFACAAALALPDGTERVVEGRLNGVLRHTPSGTNGFGYDPILQPEGETRT 169

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
             E+T  EKN                +SHR +AF+  V
Sbjct: 170 CAELTPAEKNA---------------ISHRGQAFRALV 192


>gi|15803493|ref|NP_289526.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 EDL933]
 gi|15833084|ref|NP_311857.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia coli
           O157:H7 str. Sakai]
 gi|168760096|ref|ZP_02785103.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4501]
 gi|168785812|ref|ZP_02810819.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC869]
 gi|168797529|ref|ZP_02822536.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC508]
 gi|217326851|ref|ZP_03442934.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. TW14588]
 gi|261226266|ref|ZP_05940547.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256476|ref|ZP_05949009.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. FRIK966]
 gi|291284275|ref|YP_003501093.1| Nucleoside-triphosphatase rdgB [Escherichia coli O55:H7 str.
           CB9615]
 gi|22653754|sp|Q8XCU5|RDGB_ECO57 RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|12517500|gb|AAG58085.1|AE005525_11 putative ribosomal protein [Escherichia coli O157:H7 str. EDL933]
 gi|13363302|dbj|BAB37253.1| putative ribosomal protein [Escherichia coli O157:H7 str. Sakai]
 gi|189369422|gb|EDU87838.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4501]
 gi|189373992|gb|EDU92408.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC869]
 gi|189379716|gb|EDU98132.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC508]
 gi|209760018|gb|ACI78321.1| putative ribosomal protein [Escherichia coli]
 gi|209760020|gb|ACI78322.1| putative ribosomal protein [Escherichia coli]
 gi|209760022|gb|ACI78323.1| putative ribosomal protein [Escherichia coli]
 gi|209760024|gb|ACI78324.1| putative ribosomal protein [Escherichia coli]
 gi|217319218|gb|EEC27643.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. TW14588]
 gi|290764148|gb|ADD58109.1| Nucleoside-triphosphatase rdgB [Escherichia coli O55:H7 str.
           CB9615]
 gi|320189303|gb|EFW63962.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. EC1212]
 gi|320640600|gb|EFX10139.1| dITP/XTP pyrophosphatase [Escherichia coli O157:H7 str. G5101]
 gi|320645847|gb|EFX14832.1| dITP/XTP pyrophosphatase [Escherichia coli O157:H- str. 493-89]
 gi|320651147|gb|EFX19587.1| dITP/XTP pyrophosphatase [Escherichia coli O157:H- str. H 2687]
 gi|320662162|gb|EFX29563.1| dITP/XTP pyrophosphatase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320667237|gb|EFX34200.1| dITP/XTP pyrophosphatase [Escherichia coli O157:H7 str. LSU-61]
 gi|326338958|gb|EGD62773.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. 1044]
 gi|326343160|gb|EGD66928.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. 1125]
          Length = 197

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETLKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|239908956|ref|YP_002955698.1| HAM1 protein homolog [Desulfovibrio magneticus RS-1]
 gi|239798823|dbj|BAH77812.1| HAM1 protein homolog [Desulfovibrio magneticus RS-1]
          Length = 210

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 73/183 (39%), Positives = 100/183 (54%), Gaps = 11/183 (6%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLTAAKN 65
            +V+A+ N  KI E+++L+  LG+      E   I  IPE TG +F ENA IK+   AK 
Sbjct: 11  KVVLATRNAGKIKELNALLAGLGVTVVGLGEFPEIGEIPE-TGTTFLENARIKAWAVAKA 69

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-AF 124
            G+ +L+DDSGL +D L G PG++SAR+A    GE   D A     + L +  AH P   
Sbjct: 70  TGLVSLADDSGLCVDALSGAPGVYSARYA----GENASDAANN---DKLLTVMAHVPEGD 122

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+  F+SV+  A PDG      G   G + + P G  GFGYDP+F      +T  E+T  
Sbjct: 123 RTCRFVSVVVAADPDGRELTAEGAWEGRVAFAPAGDGGFGYDPLFFDALAGKTAAELTPT 182

Query: 185 EKN 187
           EKN
Sbjct: 183 EKN 185


>gi|87310724|ref|ZP_01092851.1| xanthosine triphosphate pyrophosphatase [Blastopirellula marina DSM
           3645]
 gi|87286481|gb|EAQ78388.1| xanthosine triphosphate pyrophosphatase [Blastopirellula marina DSM
           3645]
          Length = 222

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 110/210 (52%), Gaps = 25/210 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGI-MTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +  +V+ +HN  K  EM  L+ PLGI + T A     I  EE  +SF  NA  K+   A 
Sbjct: 15  KRELVLGTHNKKKGAEMAKLLAPLGIELRTLAQTPRAIEVEEDADSFAGNAEKKATEQAI 74

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAE-SNTGERDFDMAMQKIENALRSKFAHDPA 123
           + GM  L++DSGL +D L G+PGI+SAR++    T E +  + ++K+            A
Sbjct: 75  HLGMWVLAEDSGLCVDALAGEPGIYSARFSGLEATDESNNRLLLEKLAGV-------QDA 127

Query: 124 FRSAHFISVLSLAWPDGHVENFS-GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
            R+AH++  + LA P G +   S G   G IV   RG  GFGYDP+F+   Y RTFGEM 
Sbjct: 128 RRTAHYVCCMRLASPSGEIMAASEGVCCGRIVRQERGTGGFGYDPLFELIEYRRTFGEM- 186

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
                GG   A         +LSHRARA +
Sbjct: 187 -----GGAVKA---------MLSHRARASR 202


>gi|260893785|ref|YP_003239882.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ammonifex degensii KC4]
 gi|260865926|gb|ACX53032.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ammonifex degensii KC4]
          Length = 196

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 111/219 (50%), Gaps = 29/219 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLG---IMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
             IV+AS N  K+ E  +L+ PLG   I  TS  +L  I  EETG +F  NA+IK+ T A
Sbjct: 2   RKIVLASRNEGKLREFKALLSPLGWEVIPLTSYPDLPEI--EETGETFAANALIKARTVA 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDP 122
              G  AL+DDSGL +D L+G PG+ SAR+A        +  + ++ +E     K     
Sbjct: 60  FYTGEVALADDSGLEVDYLEGAPGVRSARFAGRQGDDAANIALLLKLMEGVPWEK----- 114

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F  V+++  P+G      G V G I+  PRG+ GFGYDP+F    Y +TF E+ 
Sbjct: 115 --RKACFRCVIAVVTPEGKEYLAEGTVEGYILEEPRGKGGFGYDPVFYLPEYGQTFAELP 172

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            E KN                +SHRARA    +   LR+
Sbjct: 173 LEVKNQ---------------ISHRARAL-AKIKEILRV 195


>gi|326773721|ref|ZP_08233004.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Actinomyces viscosus C505]
 gi|326636951|gb|EGE37854.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Actinomyces viscosus C505]
          Length = 235

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 111/224 (49%), Gaps = 37/224 (16%)

Query: 8   NIVIASHNVDKIHEMDSLIMPL--GIM---TTSALELNLIIPEETGNSFEENAMIKSLTA 62
            +V+A+HN  K+ E+  ++ PL  G++     SA  L    P E G SF +NA++K+   
Sbjct: 24  RLVLATHNAGKLAELRQILTPLVPGLVPESVISAASLQAPEPVEDGLSFADNALLKARAL 83

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A+  G+PA++DDSGL +DVL G PGI SARW    +G    D A  ++        A DP
Sbjct: 84  ARATGLPAVADDSGLCVDVLGGAPGIFSARW----SGRHGDDTANLQLLLDQLGDVA-DP 138

Query: 123 AFRSAHFISVLSLAWP--DGHVENFSG---KVSGIIVWPPRGQLGFGYDPIF------QP 171
             R A F     L  P   G  E  +     + G +V  P+G+ GFGYDPIF      +P
Sbjct: 139 -HRGARFTCAAVLVQPASGGQAEQVTTIERSMEGRLVHAPQGEGGFGYDPIFVPVQEDEP 197

Query: 172 NGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            G  RT  +MT EEK+                +SHR +AF+   
Sbjct: 198 GGRGRTTAQMTPEEKHA---------------ISHRGQAFRALA 226


>gi|292490866|ref|YP_003526305.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Nitrosococcus halophilus Nc4]
 gi|291579461|gb|ADE13918.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Nitrosococcus halophilus Nc4]
          Length = 200

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 116/211 (54%), Gaps = 27/211 (12%)

Query: 10  VIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKN 65
           V+AS+N  K+ EM  ++  + + +++ SA +    +PE  ETG SF ENA+IK+  AA++
Sbjct: 7   VLASNNPGKLREMGEILSELRMEVISQSAFK----VPEVAETGLSFVENALIKARNAARH 62

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D LDG+PGIHSAR+A  N  +++    ++K+   L++     P+ R
Sbjct: 63  TGLAAIADDSGLEVDALDGQPGIHSARYAGPNATDQE---NLEKLLENLKTVPEKPPSAR 119

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               I V    W D       G   G I++ P+G  GFGYDP+F    +  T  E++ EE
Sbjct: 120 YQCVI-VYMRHWQDPTPYICQGTWEGQIIFTPQGSGGFGYDPLFYLPEHHCTAAELSPEE 178

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           KN                LSHR +A +  +D
Sbjct: 179 KN---------------RLSHRGKALRVLLD 194


>gi|169628576|ref|YP_001702225.1| HAM1 protein homolog (NTPase) [Mycobacterium abscessus ATCC 19977]
 gi|226737267|sp|B1MLZ4|NTPA_MYCA9 RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|169240543|emb|CAM61571.1| HAM1 protein homolog (NTPase) [Mycobacterium abscessus]
          Length = 206

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 105/213 (49%), Gaps = 27/213 (12%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE-----ETGNSFEENAMIKSLTA 62
            I++AS N  K+ E+  ++   G+     + L   +PE     ETG SFE+NA+IK+   
Sbjct: 2   KILVASRNPKKLAELSRVLESSGVSGVELVSLT-DVPEYEEVPETGASFEDNALIKAREG 60

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            K+ G+  ++DDSGL +D L+  PG+ SARW    +G    D A   +  A  S    + 
Sbjct: 61  VKHTGLACVADDSGLAVDALNWMPGVLSARW----SGRHGDDAANTALLLAQLSDIPDE- 115

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F+S  +L  P+G      G+  G I   P GQ GFGYDPIF P G  RT  E+T
Sbjct: 116 -RRGAAFVSACALVTPEGEEVVVEGRWKGSIARIPAGQNGFGYDPIFVPRGGLRTAAELT 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            EEK               D +SHR RA    +
Sbjct: 175 PEEK---------------DAVSHRGRALAALL 192


>gi|331701299|ref|YP_004398258.1| nucleoside-triphosphatase rdgB [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128642|gb|AEB73195.1| Nucleoside-triphosphatase rdgB [Lactobacillus buchneri NRRL
           B-30929]
          Length = 199

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 106/213 (49%), Gaps = 25/213 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNA 66
           +IVIAS N  KI E +    P GI   S     N+    ETG +FEENA +K+       
Sbjct: 6   SIVIASQNAHKIIEFEDAFKPTGITIKSLKHFENVPTIAETGTTFEENATLKATGIMNFT 65

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
               ++DDSGLV+  L+G+PG+HSAR+A    G+ D D+   K+   +++K       R+
Sbjct: 66  HQAVIADDSGLVVKALNGQPGVHSARYA----GDHDDDVNNDKLLKEMQNK-----TDRT 116

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A+F SVL    P+G     SG++ G I+   RG   FGYDP+F      RT  EM+  +K
Sbjct: 117 AYFESVLVYLTPEGDKVVASGRIDGEILRERRGNNDFGYDPLFYVPSQQRTLAEMSTHDK 176

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           N               L+SHR  A +  +   L
Sbjct: 177 N---------------LISHRGNAIRNLIRKLL 194


>gi|259508021|ref|ZP_05750921.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Corynebacterium efficiens YS-314]
 gi|259164362|gb|EEW48916.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Corynebacterium efficiens YS-314]
          Length = 207

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 110/218 (50%), Gaps = 33/218 (15%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII----PEETGNSFEENAMIKSLTAAK 64
           +++AS+N  K+ E+  ++   GI     L L  +     P E G +F ENA+IK+   A 
Sbjct: 3   LLVASNNAKKLGELQRILDQAGIENVELLALADVPSYPEPVEDGRTFTENALIKARAGAS 62

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-A 123
           N G+  L+DDSGL +D L+G PG+ SARWA    G+   D A   +   L ++ A  P  
Sbjct: 63  NTGLITLADDSGLEVDALNGMPGVLSARWA----GKHGNDQANNDL---LLAQIADIPEE 115

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQP------NGYDRT 177
            R A F+SV ++  PDG      G+  G ++  P G  GFGYDP+F P       G DR+
Sbjct: 116 HRGAAFVSVCAIVTPDGREFVEEGRWHGTLLREPVGTNGFGYDPLFVPMEESLIEGRDRS 175

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
             ++T +EK               D LSHR +A +  V
Sbjct: 176 SAQLTAQEK---------------DALSHRGKALRALV 198


>gi|325577280|ref|ZP_08147764.1| non-canonical purine NTP pyrophosphatase RdgB [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325160862|gb|EGC72983.1| non-canonical purine NTP pyrophosphatase RdgB [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 207

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 114/209 (54%), Gaps = 14/209 (6%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           K+++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A
Sbjct: 7   KIMKQKIVLATGNKGKVKEMADVLADFGFEVIAQTDLGIESPEETGLTFVENAILKARYA 66

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           ++ +G+PA++DDSGLV+D L+G PG++SAR+A  +  E D      K    L ++ A  P
Sbjct: 67  SEKSGLPAIADDSGLVVDALNGAPGLYSARYAGVDGDEAD-----AKNREKLLAELADVP 121

Query: 123 A-FRSAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
              R A F+S + L     H  + S     G+  G I++  +G+ GFGYD +F     D 
Sbjct: 122 TERRQAKFVSTIVLLQ---HPSDPSPIIAQGECDGQIIYEEKGENGFGYDSLFFSPEKDC 178

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLS 205
           TF E+   EK      A   ++L + L +
Sbjct: 179 TFAELETVEKKKISHRAKALAVLKSKLTA 207


>gi|225011724|ref|ZP_03702162.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Flavobacteria bacterium MS024-2A]
 gi|225004227|gb|EEG42199.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Flavobacteria bacterium MS024-2A]
          Length = 194

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 117/216 (54%), Gaps = 26/216 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMP-LGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           ++ A+HN  K+ E+  L+ P + I++ + ++    I EETG + EENA IK+       G
Sbjct: 3   LIFATHNQHKVKELKKLVPPSISILSLTDIKCYQEI-EETGTTLEENAKIKATFIKYKYG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +   +DDSGL I+ L+G PG++SAR+A +     D    ++K+   L     +D     A
Sbjct: 62  LDCFADDSGLEIEALNGAPGVYSARYAGAAKNNED---NIKKVWEEL-----NDKTNTKA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F +V++ ++    +E F G V G I++  RG+ GFGYDPIF P GYD+TF ++ +  KN
Sbjct: 114 QFRTVIAASFGK-KIELFEGIVKGHIIFEKRGKGGFGYDPIFIPKGYDKTFAQLGDIVKN 172

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
                           +SHRA A + F++   ++ +
Sbjct: 173 N---------------ISHRAIATQYFLNKLNKLKK 193


>gi|238786242|ref|ZP_04630188.1| Nucleoside-triphosphatase [Yersinia bercovieri ATCC 43970]
 gi|238712857|gb|EEQ04923.1| Nucleoside-triphosphatase [Yersinia bercovieri ATCC 43970]
          Length = 197

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 112/213 (52%), Gaps = 25/213 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AA+  
Sbjct: 2   QKIVLATGNPGKVRELASLLADFGLDVVAQTDLGVESVEETGLTFIENAILKARHAAQTT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESN-TGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR+A ++ + +++ D  +  ++N    +       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARFAGADASDQQNLDKLLVTLKNIPDEQ-------R 114

Query: 126 SAHFISVLSLA--WPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 SAQFHCVLVYMRHGDDPTPLVFHGQWPGVIARQPAGSAGFGYDPIFYLPELGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           EEK+                +SHR +A K  +D
Sbjct: 175 EEKHA---------------VSHRGQALKMMLD 192


>gi|260906179|ref|ZP_05914501.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Brevibacterium linens BL2]
          Length = 201

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 101/184 (54%), Gaps = 9/184 (4%)

Query: 7   NNIVIASHNVDKIHEMDSLIMP-LGIMTT--SALELNLIIPEETGNSFEENAMIKSLTAA 63
              V+A+HN  K  E+ ++++P LG  T   +A E  L    ETG +F ENA+IK+  AA
Sbjct: 2   TTFVLATHNEGKRRELLAILLPTLGEDTNVLTAAEAGLGDIPETGLTFAENALIKARAAA 61

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G  A++DDSG+ +DVL G PGI SARWA    G    D A  ++  A  S  + +  
Sbjct: 62  QATGHTAIADDSGIAVDVLGGAPGIFSARWA----GRHGDDRANLELLLAQLSDISSE-- 115

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F    +   PDG   +  G + G +   P G  GFGYDPIF P+G D +  +MT 
Sbjct: 116 HRGAQFRCAAAAVTPDGREFSAEGVMPGRLATSPSGDHGFGYDPIFVPDGSDISAAQMTP 175

Query: 184 EEKN 187
           EEKN
Sbjct: 176 EEKN 179


>gi|220905154|ref|YP_002480466.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219869453|gb|ACL49788.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 209

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 95/181 (52%), Gaps = 1/181 (0%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           IV+A+HN  K+ E+   +   G+   S      I   EETG +FEENA IK+   A+  G
Sbjct: 8   IVLATHNAGKVRELADPLARFGVEVLSLEAFPHIGEIEETGVTFEENACIKAREVARLTG 67

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           + +++DDSGL +D LDGKPG++SAR+++      D     + I   L          R  
Sbjct: 68  LVSIADDSGLEVDALDGKPGVYSARYSDDWQSLPDESRDDRNIRKLLHELADVPENKRGC 127

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+S ++   PDG      G   G ++  PRGQ GFGYDP+F      +T  E+T +EKN
Sbjct: 128 RFVSCMACVRPDGAEMVVRGNWEGTLLHAPRGQNGFGYDPVFFDKDIQKTAAELTRDEKN 187

Query: 188 G 188
            
Sbjct: 188 A 188


>gi|163782631|ref|ZP_02177628.1| hypothetical protein HG1285_17145 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882204|gb|EDP75711.1| hypothetical protein HG1285_17145 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 200

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 112/211 (53%), Gaps = 21/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            ++ A+ N  K+ E+  ++ PLG       E   I  EE+G +F ENA IK+    ++  
Sbjct: 2   KLLAATTNPGKLREIRRILQPLGYEVIEPPEK--IHVEESGFTFLENAYIKAKAYYEHFS 59

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRS--KFAHDPAFR 125
           MPAL+DDSGLV+D L G PG++S+R+   + G R+ ++   K +  LR   +       R
Sbjct: 60  MPALADDSGLVVDALGGYPGVYSSRFYSIDFGGRE-ELKGSKDDANLRKLLRLMEGKENR 118

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           SA F++ + L +  G      G+  G+I   P+G+ GFGYDPIF P G+ RT  E++ EE
Sbjct: 119 SASFVAFVVL-YMGGKGFFSRGECKGVIAEQPKGEGGFGYDPIFIPEGFSRTMAELSPEE 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           K+G               +SHR +A +   +
Sbjct: 178 KDG---------------ISHRGKALRALSE 193


>gi|305667302|ref|YP_003863589.1| putative xanthosine triphosphate pyrophosphatase [Maribacter sp.
           HTCC2170]
 gi|88709349|gb|EAR01582.1| putative xanthosine triphosphate pyrophosphatase [Maribacter sp.
           HTCC2170]
          Length = 190

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/210 (33%), Positives = 112/210 (53%), Gaps = 30/210 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLTAAKNA 66
           IV A+HN +KI E+   I+P GI+  S  ++     IPE TGN+ EENA+IK+       
Sbjct: 3   IVFATHNENKIKEVQK-IVPEGIVLLSLKDIGCTEDIPE-TGNTLEENAIIKANYITNKY 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                +DD+GL++D L+G+PG++SAR+A E    E + D  + +++             R
Sbjct: 61  EYDCFADDTGLLVDALNGEPGVYSARYAGEQKNAEDNMDKLLSELKKHKN---------R 111

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F +V++L   +G  E F+G   G I+   +G  GFGYDP+F+P  Y++TF E+    
Sbjct: 112 TARFKTVIALNL-NGKQELFTGAAEGEIIKEKKGDGGFGYDPVFKPTDYNQTFAELQLAV 170

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           KN                +SHR +A +  +
Sbjct: 171 KNK---------------ISHRGKAIQLLI 185


>gi|298244073|ref|ZP_06967879.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ktedonobacter racemifer DSM 44963]
 gi|297551554|gb|EFH85419.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ktedonobacter racemifer DSM 44963]
          Length = 199

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 111/184 (60%), Gaps = 13/184 (7%)

Query: 9   IVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           +++A+ N  K+ E  ++   +P  +++   ++L+L + EETG +F  NA +K+L  A+ +
Sbjct: 4   LLVATTNRHKLDEYRAIFSDLPFQLLSLKDIQLDLDV-EETGTTFAANATLKALIYAQAS 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA--ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            M  L+DDSGL ID L+G+PG++SAR+A  +++  ER F + ++++ +          A 
Sbjct: 63  NMLVLADDSGLEIDALNGEPGVYSARFAGEQTSYAER-FRIILERLRDV-------PAAR 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F  V++LA P G +    G + G+I   PRG+ GFGYDPIF      +T  E++ E
Sbjct: 115 RTARFRCVIALAEPSGLLRLAEGTMEGLIADAPRGEHGFGYDPIFLVPDLHKTNAELSAE 174

Query: 185 EKNG 188
           +KN 
Sbjct: 175 QKNA 178


>gi|238752327|ref|ZP_04613806.1| Nucleoside-triphosphatase [Yersinia rohdei ATCC 43380]
 gi|238709488|gb|EEQ01727.1| Nucleoside-triphosphatase [Yersinia rohdei ATCC 43380]
          Length = 203

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 110/215 (51%), Gaps = 29/215 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 8   QKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQIT 67

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSGL +D L G PGI+SAR+A  +  ++      Q +E  L +        RS
Sbjct: 68  GLPAIADDSGLAVDALAGAPGIYSARYAGIDASDQ------QNLEKLLLALKDIPDEQRS 121

Query: 127 AHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  VL       H ++     F G+  G+I   P G  GFGYDPIF      +T  E+
Sbjct: 122 AQFHCVLVYMR---HAQDPTPLVFHGQWPGVIARQPSGSAGFGYDPIFYVPELGKTAAEL 178

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           T EEK+                +SHR +A K  +D
Sbjct: 179 TREEKHA---------------VSHRGQALKLMLD 198


>gi|315655636|ref|ZP_07908534.1| non-canonical purine NTP pyrophosphatase RdgB [Mobiluncus curtisii
           ATCC 51333]
 gi|315489700|gb|EFU79327.1| non-canonical purine NTP pyrophosphatase RdgB [Mobiluncus curtisii
           ATCC 51333]
          Length = 231

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 108/213 (50%), Gaps = 30/213 (14%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPL-------GIMTTSALELNLIIPEETGNSFEENAMIK 58
           E  +V+A+ N  K+ E++ ++ PL       GI+  +A  L    P E G SF  NA+IK
Sbjct: 23  EAQVVMATGNAHKVREVEEILRPLVPSLRPGGIV--AAGTLGAPEPREDGTSFSANALIK 80

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
           +   A    +P L+DDSGL +D+L G PGI SARW   +  +R     +      +    
Sbjct: 81  ARALASVVDVPILADDSGLSVDILGGSPGIFSARWCGHHGDDRANLELLLNQLQDI---- 136

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
             D  +R+A FI    L  P G     +G + G +V  P+GQ GFGYDPIF  +G + T 
Sbjct: 137 --DDGYRTAAFICAAVLLIPGGGTYLGNGVMGGRLVREPKGQNGFGYDPIFLADGQEVTN 194

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
           GE++++ KN                +SHRA+AF
Sbjct: 195 GELSKDAKNA---------------ISHRAKAF 212


>gi|158337787|ref|YP_001518963.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Acaryochloris marina MBIC11017]
 gi|158308028|gb|ABW29645.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Acaryochloris marina MBIC11017]
          Length = 191

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/219 (34%), Positives = 112/219 (51%), Gaps = 37/219 (16%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP----EETGNSFEENAMIKSLTAAK 64
           +++A+ N  K+ EM   +  L        EL L+ P    EETG +F ENA++K+   AK
Sbjct: 4   LIVATQNPGKLKEMQQHLADL------PWELQLMPPDLEIEETGTTFRENAILKATQVAK 57

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           + G  A++DDSGL +  LDG PG++SAR+     G+ D D  +Q++   L+ K       
Sbjct: 58  HLGQWAIADDSGLEVMALDGAPGLYSARY-----GKTDIDR-IQRLLTELQGK-----TD 106

Query: 125 RSAHFISVLSLAWPDGHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           RSA F+ V++LA PDG V     G   G I+  P+G+ GFGYDPIF      +TF E++ 
Sbjct: 107 RSAQFVCVIALARPDGSVACQAKGVCPGEILQAPQGEGGFGYDPIFYVPSQQQTFAELSA 166

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
             K                 +SHR  A K  +   L ++
Sbjct: 167 TAKRQ---------------ISHRGEAIKVLMPQLLALE 190


>gi|33239763|ref|NP_874705.1| xanthosine triphosphate pyrophosphatase [Prochlorococcus marinus
           subsp. marinus str. CCMP1375]
 gi|62900263|sp|Q7VDQ7|NTPA_PROMA RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|33237288|gb|AAP99357.1| Xanthosine triphosphate pyrophosphatase [Prochlorococcus marinus
           subsp. marinus str. CCMP1375]
          Length = 200

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 110/219 (50%), Gaps = 35/219 (15%)

Query: 7   NNIVIASHNVDKIHEMDSLI--MPLGIMTTSA-LELNLIIPEETGNSFEENAMIKSLTAA 63
             ++IAS+N  KI E   L+  +PL +M     LE+     EETG SF ENA IK++  A
Sbjct: 10  TKLIIASNNDGKIEEFIQLLSGIPLVVMGQPKHLEV-----EETGVSFAENARIKAIAVA 64

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G  AL+DDSGL +  L G PG+ SAR+A ++         ++++   L+     D  
Sbjct: 65  KATGEMALADDSGLSVGSLGGAPGVFSARYANTD---------LERVSRLLKELEMVDD- 114

Query: 124 FRSAHFISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
            RSA F + L LA   G V     G+  GII   PRG+ GFGYDPIF+  G   TF EM 
Sbjct: 115 -RSAFFSAALCLASSKGEVLLELDGRCDGIITTTPRGKFGFGYDPIFEVKGTGLTFSEMD 173

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            ++K                 LSHR  A K  + +  +I
Sbjct: 174 SKQKRE---------------LSHRGLAVKKLIPSLKKI 197


>gi|262201911|ref|YP_003273119.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Gordonia bronchialis DSM 43247]
 gi|262085258|gb|ACY21226.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Gordonia bronchialis DSM 43247]
          Length = 205

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 109/216 (50%), Gaps = 28/216 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEE--TGNSFEENAMIKSLTA 62
           + +++AS N  K+ E+  ++   GI     + L+ +   PEE  TG +FE+NA+IK+ + 
Sbjct: 2   SRLLLASRNAKKLAELQRVVDAAGITGLEVIGLDAVPEFPEEPETGATFEDNALIKARSG 61

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A+  G+P L+DDSG+ +D L+G PG+ SARW    +G    D A  ++     S    D 
Sbjct: 62  ARATGLPCLADDSGITVDALNGMPGVLSARW----SGRHGDDAANNELLLGQISDVPDD- 116

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPN---GYDRTFG 179
             R   F+S  +L  PDG      G+  G+I+  PRG  GFGYDP+F P+      R+  
Sbjct: 117 -RRGGGFVSACALVRPDGSEVVVRGEWRGVILREPRGPNGFGYDPLFAPDDEVAAGRSAA 175

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           E+   EK               D LSHR +A    V
Sbjct: 176 ELDPAEK---------------DSLSHRGKALAQLV 196


>gi|187934835|ref|YP_001884653.1| deoxyribonucleotide triphosphate pyrophosphatase [Clostridium
           botulinum B str. Eklund 17B]
 gi|187722988|gb|ACD24209.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Clostridium botulinum B str. Eklund 17B]
          Length = 205

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 109/195 (55%), Gaps = 20/195 (10%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKS 59
           M+KLI     +AS+N+ KI EM  L+  L I   S  E N+ I  EE G++FEENA  K+
Sbjct: 1   MKKLI-----LASNNIKKIKEMKELLKDLNIEIKSLNEENIDIDVEEDGSTFEENAKKKA 55

Query: 60  ------LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA 113
                 L +        LSDDSGL +D L+G PGI+SAR+A    GE   D   +K    
Sbjct: 56  KEIYDFLKSRNERNFLVLSDDSGLEVDYLNGAPGIYSARYA----GEHGND---KKNNEK 108

Query: 114 LRSKFAHDP-AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPN 172
           L S+ +  P + R+A F+  +++   DG   + +G  +G I+  P+G  GFGYDP+F   
Sbjct: 109 LLSELSSVPTSKRTAKFVCQIAMFDEDGRYYSITGDANGCILEKPQGDDGFGYDPLFLYR 168

Query: 173 GYDRTFGEMTEEEKN 187
             ++TF E+T EEKN
Sbjct: 169 PLNKTFAELTLEEKN 183


>gi|312128052|ref|YP_003992926.1| non-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311778071|gb|ADQ07557.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 203

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 111/214 (51%), Gaps = 29/214 (13%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPL--GIMTTSALELNLIIPEETGNSFEENAMIK 58
           MRKL+     +A+ N  K  E+  LI      ++T +  + ++ I E+ G +FEENA+ K
Sbjct: 1   MRKLL-----VATKNEGKAKEIKQLIGSYFDDVVTLNDFDSSINIIED-GRTFEENALKK 54

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
           +         P L+DDSGL +D L G+PG+ SAR+A  N  + D    ++K+ + L+   
Sbjct: 55  AKMIYTLFRQPTLADDSGLEVDALGGRPGVMSARYAGENATDED---RIKKLLDELKDVP 111

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
                 R A F+ VL      G +    G   G I + PRG+ GFGYDP+F P+G+DRTF
Sbjct: 112 EEK---RCAQFVCVLIFIDQQGRIYQTKGICRGKIAFEPRGENGFGYDPVFVPDGFDRTF 168

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            E+  + KN                +SHRA+AF+
Sbjct: 169 AELDSQIKN---------------QISHRAKAFE 187


>gi|37520101|ref|NP_923478.1| hypothetical protein glr0532 [Gloeobacter violaceus PCC 7421]
 gi|62900256|sp|Q7NN81|NTPA_GLOVI RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|35211093|dbj|BAC88473.1| glr0532 [Gloeobacter violaceus PCC 7421]
          Length = 195

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 110/212 (51%), Gaps = 28/212 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +++A++N  K+ E+  L+   G +  +A     +  EETG +F ENA +K+L AA+  G 
Sbjct: 5   LILATNNQGKLQELRRLLAGTGWVVQAAPPDFAV--EETGTTFAENARLKALAAAERTGE 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
            ++ DDSGL +D L G PG++SAR+   N GER     + ++  AL  +     A R A 
Sbjct: 63  WSVGDDSGLAVDALGGAPGVYSARYGR-NDGER-----ISRLLAALAGQ-----ADRGAR 111

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           FI  ++LA P   ++    +  G+I+  PRG  GFGYDPIF     D+TF E+       
Sbjct: 112 FICAIALAEPGRVLKEVEAECRGVILHAPRGNGGFGYDPIFLVPELDKTFAEL------- 164

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
                    I+  +  SHR RA +  +  C R
Sbjct: 165 --------DIVEKERHSHRGRAVRKLLSGCSR 188


>gi|319651758|ref|ZP_08005884.1| nucleoside-triphosphatase [Bacillus sp. 2_A_57_CT2]
 gi|317396577|gb|EFV77289.1| nucleoside-triphosphatase [Bacillus sp. 2_A_57_CT2]
          Length = 203

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 106/208 (50%), Gaps = 24/208 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             ++IA+ N  K  E + +  PLG    + L+  +    EETG++FEENA++K+   ++ 
Sbjct: 2   QEVIIATKNAGKAREFERMFKPLGYEVKTLLDYPDFHDVEETGSTFEENAILKAEAVSEA 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAF 124
            G   ++DDSGL+ID L GKPGI+SAR+A    GE   D   M+K+ + L S   H    
Sbjct: 62  FGRMVIADDSGLIIDALGGKPGIYSARYA----GEEKNDQKNMEKVLDELESIPDHK--- 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F   L++A P       +G   G I+   RG  GFGYDPIF     ++   E+  E
Sbjct: 115 RQARFYCALAIAAPGKTTVTVAGTCEGHILREKRGTNGFGYDPIFFTEEKNKAMAELMPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
           EK+                +SHRA A K
Sbjct: 175 EKS---------------QISHRAHALK 187


>gi|90962077|ref|YP_535993.1| HAM1 protein [Lactobacillus salivarius UCC118]
 gi|90821271|gb|ABD99910.1| HAM1 protein [Lactobacillus salivarius UCC118]
          Length = 199

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 105/206 (50%), Gaps = 23/206 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNA 66
           +I+IA+ N  K  E   L    GI   + L++ N    +E G +F ENA+IK+ T     
Sbjct: 4   HILIATKNAGKAREFKKLFSEKGIEVKTLLDMENTPEIDENGKTFTENALIKAQTLTDLY 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +P L+DDSG+V+D L+G+PGI+SAR+A  +  E +    +  +E     K       R+
Sbjct: 64  KIPVLADDSGIVVDYLNGEPGIYSARYAGDHDDEANKKKLLHNLEGVPFEK-------RT 116

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           AHF   L +  P        G V G IV   RG+ GFGYDP+F    +D+TFGE T +EK
Sbjct: 117 AHFHCSLVITSPVKDPLIAEGNVEGYIVEEERGKGGFGYDPLFFYPPFDKTFGETTADEK 176

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                +SHRA A K
Sbjct: 177 NA---------------VSHRANAIK 187


>gi|332669878|ref|YP_004452886.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Cellulomonas fimi ATCC 484]
 gi|332338916|gb|AEE45499.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Cellulomonas fimi ATCC 484]
          Length = 208

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 109/221 (49%), Gaps = 30/221 (13%)

Query: 8   NIVIASHNVDKIHEMDSLIMPL-----GIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
            +V+A+HN  K+ E+ +++ P            A ++    P E G +F ENA++K+   
Sbjct: 8   RLVLATHNAHKVGELRAILAPALPALDPAAVVGARDVGAPEPVEDGVTFAENALLKARAL 67

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A   G+PA++DDSGL +DVL G PGI SARW+  +  +      +      +R      P
Sbjct: 68  AAFTGLPAVADDSGLAVDVLGGAPGIFSARWSGRHGDDAANLALLLAQLGDVR------P 121

Query: 123 AFRSAHFISVLSLAWPDG--HVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             R A F+   ++  PDG  HVE   G + G +   PRG  GFGYDP+  P G  RT  E
Sbjct: 122 EHRGARFVCAAAIVTPDGFEHVEQ--GALFGTLATEPRGTNGFGYDPVLVPAGGSRTCAE 179

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           +  +EKN                +SHR +AF+  V   +R+
Sbjct: 180 LDPQEKNA---------------ISHRGQAFRALVPTLVRV 205


>gi|147669675|ref|YP_001214493.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Dehalococcoides sp. BAV1]
 gi|146270623|gb|ABQ17615.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dehalococcoides sp. BAV1]
          Length = 199

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 109/212 (51%), Gaps = 26/212 (12%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAKNA 66
            +++AS+N  K+ E  SL+   G    +  EL + I   ETG +FEENA +K+   A+ +
Sbjct: 3   KLLLASNNAGKLKEYQSLLSGCGFEVVTPAELGIKITVAETGTTFEENARLKAAALAEAS 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+  L+DDSGL +D L G+PG++SAR+A E+ T     D  + K+E+   +K       R
Sbjct: 63  GLLTLADDSGLEVDALGGEPGVYSARYAGENATDTVRNDYLLSKMEDIPANK-------R 115

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F  V+++  P   +    G   G+I   P G  GFGYDPIF    Y +T  E+  E 
Sbjct: 116 TARFRCVIAIVQPGHTLPAIEGSCEGLIATEPHGVNGFGYDPIFYLPEYRKTMAELPLEI 175

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFK--CFV 215
           KN                LSHRA A +  C V
Sbjct: 176 KNS---------------LSHRAIAAQKACLV 192


>gi|23099560|ref|NP_693026.1| hypothetical protein OB2105 [Oceanobacillus iheyensis HTE831]
 gi|62900299|sp|Q8EPJ6|NTPA_OCEIH RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|22777790|dbj|BAC14061.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 197

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/181 (39%), Positives = 95/181 (52%), Gaps = 8/181 (4%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP--EETGNSFEENAMIKSLTAAKNA 66
           I++A+ N  K  E         I   S L+L   IP  EETG +FEENA +K+   ++  
Sbjct: 4   IIVATKNKGKAKEFKEFFASFDIEAISLLDLPESIPDIEETGTTFEENAALKAEQISERF 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
               ++DDSGL+ID LDG+PG++SAR+A    GE   D A   IE  L+         RS
Sbjct: 64  NTAVIADDSGLLIDALDGRPGLYSARYA----GEPTNDQA--NIEKVLKEMQDVPDNDRS 117

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A FI VL++A P       +G   G I    +G  GFGYDPIF P  YD T  E+   +K
Sbjct: 118 ARFICVLAIAQPGKETNFCTGYCEGHIHSKQKGDHGFGYDPIFIPKKYDVTMAELDPAKK 177

Query: 187 N 187
           N
Sbjct: 178 N 178


>gi|209523767|ref|ZP_03272320.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Arthrospira maxima CS-328]
 gi|209495799|gb|EDZ96101.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Arthrospira maxima CS-328]
          Length = 193

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 109/204 (53%), Gaps = 29/204 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +V+A+ N  K++EM + +   GI     L+ + +  EETG +F ENA +K+   AK  G 
Sbjct: 5   LVVATGNPGKLNEMQAYLG--GIDVKLQLKPDNLEVEETGKTFLENACLKASEVAKATGE 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
            A++DDSGL +D L G PG++SAR+A +++        ++++E A         A RSA 
Sbjct: 63  WAIADDSGLAVDALGGMPGVYSARYASTDSDR--ISKLLKELETA---------ADRSAQ 111

Query: 129 FISVLSLAWPDGH-VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           FI  ++++ PDG  V+   G   G+I   P+GQ GFGYDPIF       TF EM+ E K 
Sbjct: 112 FICAIAISRPDGSIVQQVQGICPGVIAQTPQGQGGFGYDPIFYVPEQQMTFAEMSPELKR 171

Query: 188 GGIDSATLFSILSTDLLSHRARAF 211
                           +SHR +AF
Sbjct: 172 K---------------ISHRGKAF 180


>gi|150020092|ref|YP_001305446.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Thermosipho melanesiensis BI429]
 gi|149792613|gb|ABR30061.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermosipho melanesiensis BI429]
          Length = 191

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 112/216 (51%), Gaps = 28/216 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           I +A+ N+ K+ E+  ++     +  S  ++++I   E G SF EN++ K+    K    
Sbjct: 2   IYVATSNMHKVEEIKKIVGENVNLQRSPEKVDVI---EDGKSFYENSVKKAYYYGKKLES 58

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
           P +SDDSGL I+ LDG PG+ SAR+ E     R +   M KI + L+     D   RSA 
Sbjct: 59  PVISDDSGLEINALDGFPGVESARFMEG----RPYVEKMSKILDMLK-----DKEDRSAQ 109

Query: 129 FISVLSLAWP-DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           F+ V +   P +G + +  GKV GII    RG  GFGYDP F P+GY++TFGE+ +  K 
Sbjct: 110 FVCVATYFNPKNGLLISVEGKVFGIISTEVRGTFGFGYDPFFIPDGYEKTFGELGDSIKK 169

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
                           +SHRA+AF+   +    + E
Sbjct: 170 K---------------ISHRAKAFRKLFEILKEVKE 190


>gi|300214770|gb|ADJ79186.1| Nucleoside-triphosphatase [Lactobacillus salivarius CECT 5713]
          Length = 199

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 105/206 (50%), Gaps = 23/206 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNA 66
           +I+IA+ N  K  E   L    GI   + L++ N    +E G +F ENA+IK+ T     
Sbjct: 4   HILIATKNAGKAREFKKLFSEKGIEVKTLLDMENTPEIDENGKTFTENALIKAQTLTDLY 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +P L+DDSG+V+D L+G+PGI+SAR+A  +  E +    +  +E     K       R+
Sbjct: 64  KVPVLADDSGIVVDYLNGEPGIYSARYAGDHDDEANKKKLLHNLEGVPFEK-------RT 116

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           AHF   L +  P        G V G IV   RG+ GFGYDP+F    +D+TFGE T +EK
Sbjct: 117 AHFHCSLVITSPVKDPLIAEGNVEGYIVEEERGKGGFGYDPLFFYPPFDKTFGETTADEK 176

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                +SHRA A K
Sbjct: 177 NA---------------VSHRANAIK 187


>gi|260599283|ref|YP_003211854.1| dITP/XTP pyrophosphatase [Cronobacter turicensis z3032]
 gi|260218460|emb|CBA33597.1| Nucleoside-triphosphatase rdgB [Cronobacter turicensis z3032]
          Length = 202

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 115/223 (51%), Gaps = 33/223 (14%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M+      +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+ 
Sbjct: 1   MQDYAMQKVVLATGNAGKVRELASLLQEFGLDVVAQTELGVESAEETGLTFIENAILKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G  A++DDSGL +D L G PGI+SAR+A S+  +++    ++K+  AL     H
Sbjct: 61  HAAQVTGFAAIADDSGLSVDALGGAPGIYSARYAGSDASDQE---NLEKLLVAL-----H 112

Query: 121 D--PAFRSAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNG 173
           D     R A F  VL       H ++     F G  SG+I   P GQ GFGYDPIF    
Sbjct: 113 DVPDEQRQAQFHCVLVYMR---HADDPTPLVFHGVWSGVITRAPAGQGGFGYDPIFFIPT 169

Query: 174 YDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
             +T  E+T EEK+                +SHR +A K  ++
Sbjct: 170 LGKTAAELTREEKSA---------------ISHRGQALKLLLE 197


>gi|254430879|ref|ZP_05044582.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Cyanobium sp. PCC 7001]
 gi|197625332|gb|EDY37891.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Cyanobium sp. PCC 7001]
          Length = 224

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 108/211 (51%), Gaps = 34/211 (16%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP----EETGNSFEENAMIKSLTAAK 64
           +VIAS N  K+ E   L+  L       LE+    P    EETG++F ENA +K++  A+
Sbjct: 18  LVIASGNRGKVREFGQLLAGLD------LEVRPQPPGLEVEETGSTFAENARLKAIAVAR 71

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G  AL+DDSGL +D L G PG+HSAR+A+S+ G R     + ++   L  K A     
Sbjct: 72  ATGCWALADDSGLSVDALGGAPGVHSARYADSD-GAR-----IARLLAEL--KAAESEPG 123

Query: 125 RSAHFISVLSLAWPDGHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           R A F + L++A P G V     G   G+I+  PRG  GFGYDP+F      +TF EM  
Sbjct: 124 RQARFTAALAVADPSGAVRLEVEGHCPGLILEAPRGDGGFGYDPVFYVPEAGQTFAEM-- 181

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
                  DSAT        LL HR RAF   
Sbjct: 182 -------DSAT------KSLLGHRGRAFAAL 199


>gi|228476257|ref|ZP_04060959.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus hominis SK119]
 gi|314936669|ref|ZP_07844016.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus hominis subsp. hominis C80]
 gi|228269660|gb|EEK11162.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus hominis SK119]
 gi|313655288|gb|EFS19033.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus hominis subsp. hominis C80]
          Length = 193

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 110/209 (52%), Gaps = 28/209 (13%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +IVIAS+N  KI++  ++     ++  S +  +  + EETG +FEENA +KS  AAK   
Sbjct: 3   DIVIASNNKGKINDFKTIFPNDNVIGISEIIKDFDV-EETGTTFEENARLKSEAAAKALN 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA--ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
              ++DDSGL +  L+G+PG++SAR+A  E N  E + D  ++K+E             R
Sbjct: 62  KRVIADDSGLEVYALNGEPGVYSARYAGLEKND-ESNIDKVLKKLEGKTN---------R 111

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F+ V+S++ P+     F G VSG I    +G  GFGYDPIF     ++T  E+T EE
Sbjct: 112 KAQFVCVISMSAPNEPTHIFKGTVSGEITTERKGDYGFGYDPIFYLPEKNKTMAELTTEE 171

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCF 214
           K+                +SHR  A K  
Sbjct: 172 KSD---------------VSHRGNAIKAL 185


>gi|227513135|ref|ZP_03943184.1| nucleoside-triphosphatase [Lactobacillus buchneri ATCC 11577]
 gi|227083710|gb|EEI19022.1| nucleoside-triphosphatase [Lactobacillus buchneri ATCC 11577]
          Length = 199

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 104/208 (50%), Gaps = 25/208 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNAG 67
           IVIAS N +K+ E D      GI   S     N+   EETG +FEENA +KS        
Sbjct: 7   IVIASKNANKVKEFDEAFKGTGIKIESLKSFSNVPDVEETGQTFEENAFLKSSAIMAFTK 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +P ++DDSGLV+  L+G+PG+HSAR+A    G+ D D    K+   +++K       R A
Sbjct: 67  LPVIADDSGLVVHALNGQPGVHSARYA----GDHDDDANNAKLLKEMQNK-----TNRDA 117

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           +F SVL    P+G      G+V+G I+   RG   FGYDP+F       T  EM+  +KN
Sbjct: 118 YFESVLIYLSPEGDKVISKGRVNGQILRARRGSNNFGYDPLFYVPEQQLTLAEMSTHDKN 177

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFV 215
                           +SHR RA +  +
Sbjct: 178 A---------------ISHRGRAIRQLI 190


>gi|282865122|ref|ZP_06274175.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Streptomyces sp. ACTE]
 gi|282560045|gb|EFB65594.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Streptomyces sp. ACTE]
          Length = 200

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 115/219 (52%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ +      I+  + L  +L+       IP+  ETG +F ENA++
Sbjct: 2   TRLILATRNAGKITELHA------ILADAGLTHDLVGADAYPDIPDVKETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRS 116
           K+   A+  G PA++DDSGL +DVL G PGI SARW+ ++  +  + D+ + ++ +    
Sbjct: 56  KAHALAQATGHPAVADDSGLCVDVLGGAPGIFSARWSGTHGDDAANLDLLLAQLSDI--- 112

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
               D   R A+F    +LA PDG      G+++G +   P G  GFGYDPI QP+G  R
Sbjct: 113 ----DIPHRGAYFACAAALALPDGTERVVEGRLTGTLRHTPAGTHGFGYDPILQPDGESR 168

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T  EKN                +SHR +AF+  V
Sbjct: 169 TCAELTPAEKNA---------------ISHRGKAFRALV 192


>gi|50955003|ref|YP_062291.1| hypothetical protein Lxx13570 [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|62900199|sp|Q6AEL0|NTPA_LEIXX RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|50951485|gb|AAT89186.1| conserved hypothetical protein [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 199

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 110/213 (51%), Gaps = 32/213 (15%)

Query: 8   NIVIASHNVDKIHEMDSLI---MP-LGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
            +V+A+HN +K  E   ++   +P L I+     E     P E G +FE+NA+IK+  AA
Sbjct: 3   RVVLATHNRNKALEFQQILGDAVPGLQIVGYDGPE-----PVEDGITFEQNALIKARAAA 57

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP- 122
           +  GM AL+DDSG+ +D + G PGI SARWA  + G+   ++ +      L  + A  P 
Sbjct: 58  ERTGMIALADDSGICVDAMGGAPGIFSARWAGRH-GDAQANLRL------LLDQLADLPD 110

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           + R+AHF + L+L  P+G      G   G I    RG  G GYDPIF P+G+D T  E+ 
Sbjct: 111 SSRAAHFTATLALVTPEGETTVVEGVWPGRIAREARGGHGHGYDPIFLPDGHDVTAAELG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            E KN                 SHRARAF   V
Sbjct: 171 PEAKNA---------------ESHRARAFAAIV 188


>gi|156743982|ref|YP_001434111.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Roseiflexus castenholzii DSM 13941]
 gi|156235310|gb|ABU60093.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Roseiflexus castenholzii DSM 13941]
          Length = 204

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 103/185 (55%), Gaps = 15/185 (8%)

Query: 8   NIVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            ++IA+ N  K+ E  ++   +PL + T + L +   + EETG +F ENA IK+   A+ 
Sbjct: 3   RLLIATTNPGKLREYAAIFADLPLDLCTLADLGIQDDV-EETGATFAENARIKAEYYAQR 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA--ESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +G+P L+DDSGL +  L G+PG+ SAR+A  E+   ER+           L  K  H P 
Sbjct: 62  SGLPTLADDSGLEVAALGGEPGVRSARYAGPEATDAERN---------AFLLRKLEHVPF 112

Query: 124 F-RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F+ V++LA P G +E   G + G+I + P+G  GFGYDPIF     D T  E+ 
Sbjct: 113 HARLARFVCVIALALPGGPIEFVEGVLPGVIEFEPKGHYGFGYDPIFYVLDEDATLAELP 172

Query: 183 EEEKN 187
            E KN
Sbjct: 173 PERKN 177


>gi|317508771|ref|ZP_07966421.1| Ham1 family protein [Segniliparus rugosus ATCC BAA-974]
 gi|316252934|gb|EFV12354.1| Ham1 family protein [Segniliparus rugosus ATCC BAA-974]
          Length = 201

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/210 (34%), Positives = 109/210 (51%), Gaps = 28/210 (13%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI----IPEETGNSFEENAMIKSLTAA 63
            +++AS N  K+ E+  ++   G+   + L L  +    +P ETG SFEENA+IK+   A
Sbjct: 3   EVLVASGNAKKLAELRRILERAGVGGLAVLGLGDVAAYELPAETGTSFEENALIKARAGA 62

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTG-ERDFDMAMQKIENALRSKFAHDP 122
              G+  L+DDSG  +D L G PG+ SARWA +  G E + ++ ++++++     FA D 
Sbjct: 63  FATGLATLADDSGFAVDSLCGMPGVLSARWAGARAGDEANRELLLEQMQD-----FAPDK 117

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQP-NGYDRTFGEM 181
             R A F+SV +L  PDG      G+ +G +     G  GFGYDP+F P +   RT  ++
Sbjct: 118 --RRARFVSVCALVVPDGPEILTRGEWAGAVAEAASGSGGFGYDPVFLPDDARGRTAAQL 175

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAF 211
              EK               D LSHR RA 
Sbjct: 176 EPLEK---------------DALSHRGRAL 190


>gi|25028956|ref|NP_739010.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Corynebacterium efficiens YS-314]
 gi|62900302|sp|Q8FMU9|NTPA_COREF RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|23494243|dbj|BAC19210.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
          Length = 221

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 110/218 (50%), Gaps = 33/218 (15%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII----PEETGNSFEENAMIKSLTAAK 64
           +++AS+N  K+ E+  ++   GI     L L  +     P E G +F ENA+IK+   A 
Sbjct: 17  LLVASNNAKKLGELQRILDQAGIENVELLALADVPSYPEPVEDGRTFTENALIKARAGAS 76

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-A 123
           N G+  L+DDSGL +D L+G PG+ SARWA    G+   D A   +   L ++ A  P  
Sbjct: 77  NTGLITLADDSGLEVDALNGMPGVLSARWA----GKHGNDQANNDL---LLAQIADIPEE 129

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQP------NGYDRT 177
            R A F+SV ++  PDG      G+  G ++  P G  GFGYDP+F P       G DR+
Sbjct: 130 HRGAAFVSVCAIVTPDGREFVEEGRWHGTLLREPVGTNGFGYDPLFVPMEESLIEGRDRS 189

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
             ++T +EK               D LSHR +A +  V
Sbjct: 190 SAQLTAQEK---------------DALSHRGKALRALV 212


>gi|269218708|ref|ZP_06162562.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269211819|gb|EEZ78159.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 193

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 110/211 (52%), Gaps = 25/211 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPL--GIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            +V+A+ N  K+ E+ ++++PL  G     A   ++  P E   +F  NA+IK+   A+ 
Sbjct: 2   KLVLATRNPHKVAELRAILLPLLPGAQILGAEAFDVPEPVEDEVTFAGNALIKARQLAEA 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ +L+DDSG+ +D + G PG+ SARW     G    D A  ++   L ++ A  P  R
Sbjct: 62  TGLLSLADDSGICVDAMGGAPGVFSARW----CGRHGDDAANLEL---LLAQMADVPERR 114

Query: 126 -SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
             A F+   ++A PDG  E   G + G +++ PRG+ GFGYDPIF+P G   +  E+T E
Sbjct: 115 RGASFVCAAAMAAPDGREEVAEGVMRGSLLFAPRGENGFGYDPIFRPEGLSVSSAELTPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            K               + +SHR +AF+   
Sbjct: 175 RK---------------EAISHRGKAFRALA 190


>gi|325677884|ref|ZP_08157526.1| non-canonical purine NTP pyrophosphatase RdgB [Ruminococcus albus
           8]
 gi|324110438|gb|EGC04612.1| non-canonical purine NTP pyrophosphatase RdgB [Ruminococcus albus
           8]
          Length = 194

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 103/202 (50%), Gaps = 12/202 (5%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLG--IMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            +VIAS+N  KI E   L+   G  +M+ S   L L + EETG +F EN+ +K+  A   
Sbjct: 2   KLVIASNNKGKIREYKQLLEKHGYEVMSQSEAGLKLEV-EETGTTFAENSALKARAAHAE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G   L+DDSGL +D LDG PG++SAR+   +      +  ++ +E+    K       R
Sbjct: 61  LGCAVLADDSGLAVDALDGAPGVYSARYGGIDDDAERCEYLLKNLEDVPDDK-------R 113

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            AHF+  +     DG   +  G+V G I   P G+ GFGYDP+F   G  R+F ++  EE
Sbjct: 114 GAHFVCTIHFIDTDGSEISVEGRVYGEIGRKPVGENGFGYDPVFMYKG--RSFAQIPAEE 171

Query: 186 KNGGIDSATLFSILSTDLLSHR 207
           KN     A     L   L++ R
Sbjct: 172 KNAVSHRAEALKKLEEKLVAKR 193


>gi|254385743|ref|ZP_05001064.1| nucleoside-triphosphatase [Streptomyces sp. Mg1]
 gi|194344609|gb|EDX25575.1| nucleoside-triphosphatase [Streptomyces sp. Mg1]
          Length = 202

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 117/222 (52%), Gaps = 38/222 (17%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEEN 54
           +  + +++A+ N  K+ E+ +      I++ + L   L+       IP+  ETG +F EN
Sbjct: 1   MTTSRLILATRNAGKVTELRA------ILSDAGLPHELVGADAYPQIPDVKETGVTFAEN 54

Query: 55  AMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENA 113
           A++K+   A+  G+PA++DDSGL +DVL+G PGI SARWA ++  ++ + D+ + ++ + 
Sbjct: 55  ALLKAHALAQATGLPAVADDSGLCVDVLNGAPGIFSARWAGTHGDDKANLDLLLAQLGDI 114

Query: 114 LRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNG 173
                      R AHF    +LA PDG      G++ G +   P G  GFGYDPI QP G
Sbjct: 115 ADEN-------RGAHFACAAALALPDGTERVVEGRLLGTLRHTPAGTGGFGYDPILQPTG 167

Query: 174 YDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
             RT  E+T  EKN                +SHR +AF+  V
Sbjct: 168 DTRTCAELTAAEKNA---------------ISHRGQAFRALV 194


>gi|303245619|ref|ZP_07331902.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfovibrio fructosovorans JJ]
 gi|302492882|gb|EFL52747.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfovibrio fructosovorans JJ]
          Length = 208

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 100/184 (54%), Gaps = 11/184 (5%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLTAAK 64
             +V+A+ N  KI E+++L+MPLG+          I  IPE TG +F +NA IK+    K
Sbjct: 10  TQVVLATRNKGKIKELNALLMPLGVRVVGLDAFPDIGDIPE-TGETFLDNARIKAQAVCK 68

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+ +L+DDSGL +D L G PG+HSAR+    +GE   D A         +  AH P  
Sbjct: 69  ATGLVSLADDSGLCVDALSGAPGVHSARF----SGEHASDAANNAKLL---AAMAHVPER 121

Query: 125 -RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+  F+SV+  A PDG      G   G ++  P G  GFGYDP+F  +   ++  E+T 
Sbjct: 122 DRTCRFVSVVVAACPDGRELTAEGTWEGRVLAAPAGNGGFGYDPLFFDSTAGKSSAELTP 181

Query: 184 EEKN 187
           EEKN
Sbjct: 182 EEKN 185


>gi|163840219|ref|YP_001624624.1| xanthosine triphosphate pyrophosphatase [Renibacterium salmoninarum
           ATCC 33209]
 gi|162953695|gb|ABY23210.1| xanthosine triphosphate pyrophosphatase [Renibacterium salmoninarum
           ATCC 33209]
          Length = 213

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 109/215 (50%), Gaps = 32/215 (14%)

Query: 6   ENNIVIASHNVDKIHEMDSLI------MPLGIMTTSALELNLIIPEETGNSFEENAMIKS 59
           +  +++A+HN  K+ E+  L+      + +      A         ETG +F ENA++K+
Sbjct: 9   QPRLILATHNQGKLRELRELLRGQVPGLDVDSQVIDAASAGAPDVAETGVTFAENALLKA 68

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
              +   G+PA++DDSGL ++VL G PGI SARWA    G+   ++A+      L ++  
Sbjct: 69  HAVSAATGLPAIADDSGLAVEVLGGSPGIFSARWA-GQHGDDKSNLAL------LLAQLG 121

Query: 120 H-DPAFRSAHFISVLSLAWPDGHVENFS-GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
              P  R+A FI   +L  P   VE    G++ G ++  PRG+ GFGYDPI QP G DR+
Sbjct: 122 DIGPEHRAAKFICAAALVAPG--VETVELGELKGALLAAPRGEKGFGYDPILQPEGLDRS 179

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
             E+   EKN                +SHR  AF+
Sbjct: 180 CAELEPAEKNA---------------ISHRGEAFR 199


>gi|325299391|ref|YP_004259308.1| Nucleoside-triphosphatase rdgB [Bacteroides salanitronis DSM 18170]
 gi|324318944|gb|ADY36835.1| Nucleoside-triphosphatase rdgB [Bacteroides salanitronis DSM 18170]
          Length = 195

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 115/214 (53%), Gaps = 27/214 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIM-PLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           ++  +V A++N  K+ E+ +++   L I++ + +  +  IPE T ++ E NA +K+    
Sbjct: 1   MKKKLVFATNNAHKLEEIRAILGDKLEILSLNDINCHADIPE-TADTLEGNARLKAGYIY 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFAHDP 122
           +N GM   +DD+GL ++ L G PGI+SAR+A    GE  D +  M+K+ + +  K     
Sbjct: 60  QNYGMDCFADDTGLEVEALGGAPGIYSARYA---GGEGHDSEANMRKLLSEMEGKENRRA 116

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
            FR+A  I ++     +G    F G V G I+   RG  GFGYDP+FQP GY  TF EM 
Sbjct: 117 RFRTA--ICLIE----NGKEHLFEGIVQGNIIEARRGTAGFGYDPVFQPEGYAETFAEMG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
            EEKN                +SHRARA +  V+
Sbjct: 171 NEEKN---------------KISHRARAVQQLVE 189


>gi|168264451|ref|ZP_02686424.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168463710|ref|ZP_02697627.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|200388967|ref|ZP_03215579.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|195633550|gb|EDX51964.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|199606065|gb|EDZ04610.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205347034|gb|EDZ33665.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
          Length = 197

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA+IK+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAIIKARHAAKMT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E+ T +++ +  +  + +    K       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQQNLEKLLHTLRDVPDDK-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I     G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|311031423|ref|ZP_07709513.1| nucleoside-triphosphatase [Bacillus sp. m3-13]
          Length = 209

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 106/186 (56%), Gaps = 7/186 (3%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLT 61
           K+    I+IA++N  K+ +   ++ P G    S  +   I   EETG +FE+NA++K+  
Sbjct: 7   KIKMKEIIIATNNPGKVKDFKVILEPKGFQVKSLADFPEIHDVEETGTTFEKNALLKAEA 66

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            + + G   L+DDSGL +D L+G+PG++SAR+A     E+D    +QK+ + L+     D
Sbjct: 67  VSAHLGKIVLADDSGLEVDALNGEPGVYSARYAGM---EKDDRKNIQKVLDGLKG--VPD 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F+ VL++  P+G      G   G I   P G+ GFGYDPIF  N   RT  ++
Sbjct: 122 EK-RTARFVCVLAVVDPEGEKFTVRGTCEGTISQEPIGENGFGYDPIFYVNEKQRTMAQL 180

Query: 182 TEEEKN 187
           ++EEK+
Sbjct: 181 SKEEKS 186


>gi|228993219|ref|ZP_04153140.1| Nucleoside-triphosphatase [Bacillus pseudomycoides DSM 12442]
 gi|228766545|gb|EEM15187.1| Nucleoside-triphosphatase [Bacillus pseudomycoides DSM 12442]
          Length = 206

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 108/208 (51%), Gaps = 24/208 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNA 66
           ++V+A+ N+ K+ E   L     +   S  +  N+   EETG +FEENA++K+ +  K  
Sbjct: 6   HVVVATKNIGKVREFAELFERFDLEVKSLHDFPNIEEVEETGETFEENALLKADSLCKQL 65

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
               ++DDSGL++D L+G PG+ SAR+A    GE+  D A   I+  L          R+
Sbjct: 66  NSIVIADDSGLIVDALNGNPGVRSARYA----GEQKDDQA--NIDKVLTGLDGVSMEKRT 119

Query: 127 AHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           A F   L++A+P+ + E+   +G   G I+   RG+ GFGYDPIF    Y R   E+T +
Sbjct: 120 ARFYCALAVAFPEENKESVIVNGTCEGKILEQRRGENGFGYDPIFYVEEYKRAMAELTSD 179

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
           EKN                +SHR RA +
Sbjct: 180 EKNE---------------ISHRGRALR 192


>gi|21282763|ref|NP_645851.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus MW2]
 gi|49485989|ref|YP_043210.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57650261|ref|YP_186025.1| hypothetical protein SACOL1162 [Staphylococcus aureus subsp. aureus
           COL]
 gi|82750758|ref|YP_416499.1| nucleoside-triphosphatase [Staphylococcus aureus RF122]
 gi|87162116|ref|YP_493748.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|88194853|ref|YP_499651.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|151221276|ref|YP_001332098.1| hypothetical protein NWMN_1064 [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|221140451|ref|ZP_03564944.1| hypothetical protein SauraJ_02301 [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253731765|ref|ZP_04865930.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|258451848|ref|ZP_05699869.1| Ham1 family nucleoside triphosphatase [Staphylococcus aureus A5948]
 gi|262048732|ref|ZP_06021614.1| hypothetical protein SAD30_1562 [Staphylococcus aureus D30]
 gi|282919929|ref|ZP_06327658.1| Ham1 family protein [Staphylococcus aureus A9765]
 gi|284024076|ref|ZP_06378474.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus 132]
 gi|294848142|ref|ZP_06788889.1| Ham1 family protein [Staphylococcus aureus A9754]
 gi|297208210|ref|ZP_06924640.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|300912287|ref|ZP_07129730.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304381291|ref|ZP_07363944.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|22653749|sp|P58995|NTPA_STAAW RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|62900148|sp|Q5HGT2|NTPA_STAAC RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|62900219|sp|Q6GA63|NTPA_STAAS RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|21204201|dbj|BAB94899.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49244432|emb|CAG42860.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57284447|gb|AAW36541.1| HAM1 protein [Staphylococcus aureus subsp. aureus COL]
 gi|82656289|emb|CAI80703.1| nucleoside triphosphatase [Staphylococcus aureus RF122]
 gi|87128090|gb|ABD22604.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|87202411|gb|ABD30221.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|150374076|dbj|BAF67336.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|253724494|gb|EES93223.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|257860456|gb|EEV83283.1| Ham1 family nucleoside triphosphatase [Staphylococcus aureus A5948]
 gi|259163188|gb|EEW47748.1| hypothetical protein SAD30_1562 [Staphylococcus aureus D30]
 gi|269940645|emb|CBI49024.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282594645|gb|EFB99629.1| Ham1 family protein [Staphylococcus aureus A9765]
 gi|294824942|gb|EFG41364.1| Ham1 family protein [Staphylococcus aureus A9754]
 gi|296886949|gb|EFH25852.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|300886533|gb|EFK81735.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302750974|gb|ADL65151.1| deoxyribonucleotide triphosphate pyrophosphatase [Staphylococcus
           aureus subsp. aureus str. JKD6008]
 gi|304340274|gb|EFM06215.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|315196876|gb|EFU27219.1| hypothetical protein CGSSa01_03880 [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320141034|gb|EFW32881.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320143091|gb|EFW34881.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus aureus subsp. aureus MRSA177]
 gi|323440702|gb|EGA98412.1| nucleoside-triphosphatase [Staphylococcus aureus O11]
 gi|323442355|gb|EGA99984.1| nucleoside-triphosphatase [Staphylococcus aureus O46]
 gi|329313819|gb|AEB88232.1| Nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329730737|gb|EGG67116.1| non-canonical purine NTP pyrophosphatase RdgB [Staphylococcus
           aureus subsp. aureus 21189]
          Length = 195

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 105/179 (58%), Gaps = 11/179 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIAS+N  KI++   +     ++  S L  +  + EETG++FEENA++KS  AAK    
Sbjct: 4   IVIASNNQGKINDFKVIFPDYHVIGISELIPDFDV-EETGSTFEENAILKSEAAAKALNK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             ++DDSGL +  L+G+PGI+SAR+A E+ + E + +  + K+ N            R A
Sbjct: 63  TVIADDSGLEVFALNGEPGIYSARYAGENKSDEANIEKLLNKLGNTTD---------RRA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ PD   + F G VSG I     G+ GFGYDPIF     D+T  ++++E+K
Sbjct: 114 QFVCVISMSGPDMETKVFKGTVSGEIADGKYGENGFGYDPIFYVPKLDKTMAQLSKEQK 172


>gi|253575654|ref|ZP_04852990.1| non-canonical purine NTP pyrophosphatase [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251844992|gb|EES73004.1| non-canonical purine NTP pyrophosphatase [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 211

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 104/215 (48%), Gaps = 20/215 (9%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAK 64
             I++A+ N  K+ E    + PLG    S  +     PE  E G +F ENA  K+ T   
Sbjct: 5   TEIIVATRNAGKVREFAHALAPLGKEVRSLADYP-DAPEVVEDGTTFAENARKKAKTVGD 63

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPA 123
             G P L+DDSGL +D LDG PG++SAR+A E  + E + +  + ++E     +    P 
Sbjct: 64  ALGRPVLADDSGLCVDQLDGAPGVYSARYAGEGASDEDNNEKLLAELEKRRLGEDTEQPL 123

Query: 124 FRSAHFISVLSLAWP-DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             +A F+  L+L  P +G     SG+V G I   P G  GFGYDP+F    Y++T  E+T
Sbjct: 124 LSTARFVCHLALYDPANGQFIEASGEVEGWITSEPAGGGGFGYDPLFYLPAYEKTMAELT 183

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
            EEK                 +SHR  A +   D 
Sbjct: 184 LEEKQA---------------VSHRGAALRALADK 203


>gi|212213419|ref|YP_002304355.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Coxiella
           burnetii CbuG_Q212]
 gi|212011829|gb|ACJ19210.1| xanthosine triphosphate pyrophosphatase [Coxiella burnetii
           CbuG_Q212]
          Length = 200

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 102/197 (51%), Gaps = 8/197 (4%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IV+AS N  K+ EM  L+  L I      E ++   EETG++F ENA+IK+  AAK  G+
Sbjct: 4   IVLASQNSSKLAEMQELLRDLEIKFIPQTEFSVPDIEETGSTFVENAIIKARHAAKQTGL 63

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
           PAL+DDSGL I  L+  PG+ S+R+A  N  +       ++I+  L +  A D   R A 
Sbjct: 64  PALADDSGLTIAALNSAPGVFSSRYAGKNATD------AERIQKVLEALEAADDLDRGAS 117

Query: 129 FISVLSLAWPDGHVENF--SGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           F  V++L   +         G   G I   PRG+ GFGYDPIF    + RT  E+  +EK
Sbjct: 118 FHCVIALMENENDPAPLICHGVWEGEIAREPRGKNGFGYDPIFYVPSHQRTAAELDPQEK 177

Query: 187 NGGIDSATLFSILSTDL 203
           N           LST L
Sbjct: 178 NAISHRGQALEQLSTVL 194


>gi|317057723|ref|YP_004106190.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ruminococcus albus 7]
 gi|315449992|gb|ADU23556.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ruminococcus albus 7]
          Length = 201

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 107/206 (51%), Gaps = 27/206 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLG--IMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           +VIAS+N  KI E   ++   G  +M+ S   L+L + EETG +F EN+ +K+  A K  
Sbjct: 12  LVIASNNKGKIREYKQILEKHGYEVMSQSEAGLDLEV-EETGTTFAENSALKARAAYKAL 70

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G   L+DDSGL +D L+G+PG++SAR+   +   +     ++K+E+    K       R 
Sbjct: 71  GCAVLADDSGLSVDALNGEPGVYSARYGGIDNDMKRSLYLLKKMEDVPDDK-------RG 123

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           AHF+  +     DG      G+V G I   P G+ GFGYDPIF   G  R+F ++  EEK
Sbjct: 124 AHFVCTIHFIDTDGSEICVEGRVYGTINRAPVGENGFGYDPIFMYEG--RSFAQIPAEEK 181

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                +SHRA A K
Sbjct: 182 NA---------------VSHRANALK 192


>gi|302332759|gb|ADL22952.1| deoxyribonucleotide triphosphate pyrophosphatase [Staphylococcus
           aureus subsp. aureus JKD6159]
          Length = 195

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 105/179 (58%), Gaps = 11/179 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIAS+N  KI++   +     ++  S L  +  + EETG++FEENA++KS  AAK    
Sbjct: 4   IVIASNNQGKINDFKVIFPDYHVIGISELIPDFDV-EETGSTFEENAILKSEAAAKALNK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             ++DDSGL +  L+G+PGI+SAR+A E+ + E + +  + K+ N    +         A
Sbjct: 63  TVIADDSGLEVFALNGEPGIYSARYAGENKSDEANIEKLLNKLGNTTDCR---------A 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ PD   + F G VSG I     G+ GFGYDPIF     D+T  ++++EEK
Sbjct: 114 QFVCVISMSGPDMETKVFKGTVSGEIADGKYGENGFGYDPIFYVPKLDKTMAQLSKEEK 172


>gi|295706787|ref|YP_003599862.1| non-canonical purine NTP pyrophosphatase [Bacillus megaterium DSM
           319]
 gi|294804446|gb|ADF41512.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacillus megaterium DSM 319]
          Length = 197

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 106/206 (51%), Gaps = 24/206 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           I+IA+ N  K+ + ++L  P G    S L+   I   EETG +F ENA +K+   +    
Sbjct: 4   IIIATKNAGKVKDFETLFSPKGFKVKSLLDFPEIEDVEETGVTFAENATLKAEAISSALN 63

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAHDPAFRS 126
            P ++DDSGL ID L+G+PG++SAR+A  N  +  + +  +QK+ +    K       R+
Sbjct: 64  KPVIADDSGLAIDALNGEPGVYSARYAGENKDDNANIEKVLQKLNDVPFEK-------RT 116

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F   L++A P    E   G   G I+   RG+ GFGYDPIF    +  +  E+T+E+K
Sbjct: 117 ARFHCALAIAVPGKRTEIVEGTCEGHILEEKRGENGFGYDPIFFVEKWRCSMAELTKEQK 176

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                +SHRA A K
Sbjct: 177 NQ---------------ISHRANALK 187


>gi|15924142|ref|NP_371676.1| hypothetical protein SAV1152 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15926735|ref|NP_374268.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           N315]
 gi|148267643|ref|YP_001246586.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus JH9]
 gi|150393698|ref|YP_001316373.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus JH1]
 gi|156979473|ref|YP_001441732.1| hypothetical protein SAHV_1142 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|253317066|ref|ZP_04840279.1| hypothetical protein SauraC_13204 [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253733612|ref|ZP_04867777.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255005937|ref|ZP_05144538.2| hypothetical protein SauraM_05690 [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257795119|ref|ZP_05644098.1| Ham1 family protein [Staphylococcus aureus A9781]
 gi|258407173|ref|ZP_05680322.1| nucleoside-triphosphatase [Staphylococcus aureus A9763]
 gi|258421736|ref|ZP_05684657.1| nucleoside-triphosphatase [Staphylococcus aureus A9719]
 gi|258432920|ref|ZP_05688609.1| nucleoside-triphosphatase [Staphylococcus aureus A9299]
 gi|258443410|ref|ZP_05691753.1| nucleoside-triphosphatase [Staphylococcus aureus A8115]
 gi|258446083|ref|ZP_05694245.1| Ham1 family protein [Staphylococcus aureus A6300]
 gi|258449804|ref|ZP_05697902.1| Ham1 family protein [Staphylococcus aureus A6224]
 gi|258454903|ref|ZP_05702866.1| nucleoside-triphosphatase [Staphylococcus aureus A5937]
 gi|269202764|ref|YP_003282033.1| hypothetical protein SAAV_1119 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282894179|ref|ZP_06302410.1| Ham1 family protein [Staphylococcus aureus A8117]
 gi|282928674|ref|ZP_06336271.1| Ham1 family protein [Staphylococcus aureus A10102]
 gi|295405956|ref|ZP_06815765.1| Ham1 family protein [Staphylococcus aureus A8819]
 gi|296275638|ref|ZP_06858145.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus MR1]
 gi|297246516|ref|ZP_06930354.1| Ham1 family protein [Staphylococcus aureus A8796]
 gi|54037246|sp|P99094|NTPA_STAAN RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|54041340|sp|P64309|NTPA_STAAM RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|13700951|dbj|BAB42247.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           N315]
 gi|14246922|dbj|BAB57314.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|147740712|gb|ABQ49010.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Staphylococcus aureus subsp. aureus JH9]
 gi|149946150|gb|ABR52086.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Staphylococcus aureus subsp. aureus JH1]
 gi|156721608|dbj|BAF78025.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|253728411|gb|EES97140.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257789091|gb|EEV27431.1| Ham1 family protein [Staphylococcus aureus A9781]
 gi|257841328|gb|EEV65773.1| nucleoside-triphosphatase [Staphylococcus aureus A9763]
 gi|257842069|gb|EEV66497.1| nucleoside-triphosphatase [Staphylococcus aureus A9719]
 gi|257849360|gb|EEV73337.1| nucleoside-triphosphatase [Staphylococcus aureus A9299]
 gi|257851500|gb|EEV75439.1| nucleoside-triphosphatase [Staphylococcus aureus A8115]
 gi|257855141|gb|EEV78082.1| Ham1 family protein [Staphylococcus aureus A6300]
 gi|257856724|gb|EEV79627.1| Ham1 family protein [Staphylococcus aureus A6224]
 gi|257862783|gb|EEV85548.1| nucleoside-triphosphatase [Staphylococcus aureus A5937]
 gi|262075054|gb|ACY11027.1| hypothetical protein SAAV_1119 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282589713|gb|EFB94799.1| Ham1 family protein [Staphylococcus aureus A10102]
 gi|282763665|gb|EFC03794.1| Ham1 family protein [Staphylococcus aureus A8117]
 gi|285816831|gb|ADC37318.1| Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Staphylococcus aureus 04-02981]
 gi|294969391|gb|EFG45411.1| Ham1 family protein [Staphylococcus aureus A8819]
 gi|297176622|gb|EFH35885.1| Ham1 family protein [Staphylococcus aureus A8796]
 gi|312829544|emb|CBX34386.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315128550|gb|EFT84555.1| hypothetical protein CGSSa03_01315 [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329725178|gb|EGG61667.1| non-canonical purine NTP pyrophosphatase RdgB [Staphylococcus
           aureus subsp. aureus 21172]
          Length = 195

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 105/179 (58%), Gaps = 11/179 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIAS+N  KI++   +     ++  S L  +  + EETG++FEENA++KS  AAK    
Sbjct: 4   IVIASNNQGKINDFKVIFPDYHVIGISELIPDFDV-EETGSTFEENAILKSEAAAKALNK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             ++DDSGL +  L+G+PGI+SAR+A E+ + E + +  + K+ N            R A
Sbjct: 63  TVIADDSGLEVFALNGEPGIYSARYAGENKSDEANIEKLLNKLGNTTD---------RRA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ PD   + F G VSG I     G+ GFGYDPIF     D+T  ++++E+K
Sbjct: 114 QFVCVISMSGPDMETKVFKGTVSGEIADGKYGENGFGYDPIFYVPKLDKTMAQLSKEQK 172


>gi|315656449|ref|ZP_07909338.1| non-canonical purine NTP pyrophosphatase RdgB [Mobiluncus curtisii
           subsp. holmesii ATCC 35242]
 gi|315493008|gb|EFU82610.1| non-canonical purine NTP pyrophosphatase RdgB [Mobiluncus curtisii
           subsp. holmesii ATCC 35242]
          Length = 231

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 108/213 (50%), Gaps = 30/213 (14%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPL-------GIMTTSALELNLIIPEETGNSFEENAMIK 58
           E  +V+A+ N  K+ E++ ++ PL       GI+  +A  L    P E G SF  NA+IK
Sbjct: 23  EAQVVMATGNTHKVREVEEILRPLVPSLRPGGIV--AAGTLGAPEPREDGTSFSANALIK 80

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
           +   A    +P L+DDSGL +D+L G PGI SARW   +  +R     +      +    
Sbjct: 81  ARALASVVDVPILADDSGLSVDILGGSPGIFSARWCGHHGDDRANLELLLNQLQDI---- 136

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
             D  +R+A FI    L  P G     +G + G +V  P+G+ GFGYDPIF  +G + T 
Sbjct: 137 --DDGYRTAAFICAAVLLIPGGGTYLGNGVMGGRLVREPKGKNGFGYDPIFLADGQEATN 194

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
           GE++++ KN                +SHRA+AF
Sbjct: 195 GELSKDAKNA---------------ISHRAKAF 212


>gi|331654466|ref|ZP_08355466.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli M718]
 gi|331047848|gb|EGI19925.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli M718]
          Length = 197

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETLKDVPDEQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|242238223|ref|YP_002986404.1| deoxyribonucleotide triphosphate pyrophosphatase [Dickeya dadantii
           Ech703]
 gi|242130280|gb|ACS84582.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Dickeya
           dadantii Ech703]
          Length = 197

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 110/216 (50%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+  L+   G    +   LN+   EETG +F ENA++K+  AA+  
Sbjct: 2   QKLVLATGNAGKVRELAGLLADFGFDVVAQTALNVDNAEETGLTFIENAILKARHAARKT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR+A  +  +R + +  +Q +EN    +       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYAGHDATDRQNLEKLLQALENVPDEQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H ++       G+  G+I   P G+ GFGYDPIFQ     +T  +
Sbjct: 115 RASFHCVLVYLR---HADDPTPLVCHGRWQGMITRAPAGEGGFGYDPIFQVPSLGKTAAQ 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           ++ EEK+                 SHR +A +  +D
Sbjct: 172 LSREEKHAH---------------SHRGQALRLLLD 192


>gi|327312863|ref|YP_004328300.1| non-canonical purine NTP pyrophosphatase RdgB [Prevotella denticola
           F0289]
 gi|326945526|gb|AEA21411.1| non-canonical purine NTP pyrophosphatase RdgB [Prevotella denticola
           F0289]
          Length = 194

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/215 (35%), Positives = 113/215 (52%), Gaps = 25/215 (11%)

Query: 8   NIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
            IV A++N  K+ E+  ++     I++ + +  +  IPE TG + +ENA  KS    ++ 
Sbjct: 2   KIVFATNNKHKLEEIKEILGKDFEIVSLAEIGCHEDIPE-TGLTLQENARQKSTYVVEHY 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
                +DD+GL +D L G+PG+HSAR+AE    + D +  M+K    L SK A     R+
Sbjct: 61  RQNCFADDTGLEVDALGGEPGVHSARYAEGT--DHDSEANMRK----LLSKMA-GVENRT 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F +V+SL   DG    F G+V G I     G  GFGYDPIF P GYD++F E+ EE K
Sbjct: 114 ARFRTVISLII-DGVEHQFEGRVDGRIATEKHGSEGFGYDPIFIPEGYDKSFAELGEEVK 172

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           N                +SHRA+A K   +   ++
Sbjct: 173 NK---------------ISHRAKAVKKLAEYLRKV 192


>gi|297571667|ref|YP_003697441.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Arcanobacterium haemolyticum DSM 20595]
 gi|296932014|gb|ADH92822.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Arcanobacterium haemolyticum DSM 20595]
          Length = 209

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 105/214 (49%), Gaps = 26/214 (12%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPL-----GIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           +  +++A+ N  K+ E+  ++ PL          SA  L+L  P E   +F  NA+IK+ 
Sbjct: 3   QPRLILATRNNHKLGELRQILAPLIPELASDEIHSANALDLPEPVEDATTFAGNALIKAR 62

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             A+  G+ A++DDSG+ +DVL G PGI SARW    +G    DMA   +  A  +    
Sbjct: 63  QIAQATGVAAVADDSGICVDVLGGAPGIFSARW----SGGHGDDMANLNLLLAQLADV-- 116

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F     L  PDG      G + G + + P G  GFGYDPIFQP+GY  T  E
Sbjct: 117 KPEHRRARFTCAAVLVLPDGREFVREGVMEGTLRYEPCGDGGFGYDPIFQPDGYHVTSAE 176

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
           +T ++KN                +SHR RAF   
Sbjct: 177 LTSDQKNA---------------ISHRGRAFSAL 195


>gi|282916400|ref|ZP_06324162.1| Ham1 family protein [Staphylococcus aureus subsp. aureus D139]
 gi|282319840|gb|EFB50188.1| Ham1 family protein [Staphylococcus aureus subsp. aureus D139]
          Length = 195

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 105/179 (58%), Gaps = 11/179 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIAS+N  KI++   +     ++  S L  +  + EETG++FEENA++KS  AAK    
Sbjct: 4   IVIASNNQGKINDFKVIFPDYHVIGISELIPDFDV-EETGSTFEENAILKSEAAAKALNK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             ++DDSGL +  L+G+PGI+SAR+A E+ + E + +  + K+ N            R A
Sbjct: 63  TVIADDSGLEVFALNGEPGIYSARYAGENKSDEANIEKLLNKLGNTTD---------RRA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ PD   + F G VSG I     G+ GFGYDPIF     D+T  ++++E+K
Sbjct: 114 QFVCVISMSGPDMETKVFKGTVSGEIADGKYGENGFGYDPIFYVPKLDKTMAQLSKEQK 172


>gi|283770212|ref|ZP_06343104.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus H19]
 gi|283460359|gb|EFC07449.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus H19]
          Length = 195

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 105/179 (58%), Gaps = 11/179 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIAS+N  KI++   +     ++  S L  +  + EETG++FEENA++KS  AAK    
Sbjct: 4   IVIASNNQGKINDFKVIFPDYHVIGISELIPDFDV-EETGSTFEENAILKSEAAAKALNK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             ++DDSGL +  L+G+PGI+SAR+A E+ + E + +  + K+ N            R A
Sbjct: 63  TVIADDSGLEVFALNGEPGIYSARYAGENKSDEANIEKLLNKLGNTTD---------RRA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ PD   + F G VSG I     G+ GFGYDPIF     D+T  ++++E+K
Sbjct: 114 QFVCVISMSGPDMETKVFKGTVSGEIADGKYGENGFGYDPIFYVPKLDKTMAQLSKEQK 172


>gi|170679994|ref|YP_001745115.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli SMS-3-5]
 gi|215488252|ref|YP_002330683.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218555513|ref|YP_002388426.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli IAI1]
 gi|293416215|ref|ZP_06658855.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Escherichia coli B185]
 gi|312964783|ref|ZP_07779023.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 2362-75]
 gi|331684581|ref|ZP_08385173.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli H299]
 gi|170517712|gb|ACB15890.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli SMS-3-5]
 gi|215266324|emb|CAS10755.1| dITP/XTP pyrophosphatase [Escherichia coli O127:H6 str. E2348/69]
 gi|218362281|emb|CAQ99902.1| dITP/XTP pyrophosphatase [Escherichia coli IAI1]
 gi|291432404|gb|EFF05386.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Escherichia coli B185]
 gi|312290339|gb|EFR18219.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 2362-75]
 gi|323966471|gb|EGB61904.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli M863]
 gi|327251722|gb|EGE63408.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli STEC_7v]
 gi|331078196|gb|EGI49402.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli H299]
          Length = 197

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETLKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|300727546|ref|ZP_07060937.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella bryantii B14]
 gi|299775249|gb|EFI71850.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella bryantii B14]
          Length = 199

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 109/209 (52%), Gaps = 30/209 (14%)

Query: 9   IVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           IV A++N  K+ E+  ++     +++   +  ++ IPE TG + E NA  K+    +N G
Sbjct: 3   IVFATNNQHKLQEIREILGSDFEVVSLKDIGCDVDIPE-TGTTLEANAHQKASYIYENYG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +   +DD+GL ++ LDG PG+HSAR+AE    + D +  M K+   L  K       R A
Sbjct: 62  LDCFADDTGLEVEALDGAPGVHSARYAEGT--DHDSEANMAKLLKELEGK-----NNRKA 114

Query: 128 HFISVLSLAWPDGHVE------NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            F +V++L   +G         +F G+V G I     G+ GFGYDPIF P GYD++F E+
Sbjct: 115 RFRTVIALIQKEGDSTICSREYSFEGEVKGEIATEKSGKGGFGYDPIFVPEGYDKSFAEL 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARA 210
            EE KN                +SHRARA
Sbjct: 175 GEEIKN---------------KISHRARA 188


>gi|160946004|ref|ZP_02093230.1| hypothetical protein FAEPRAM212_03537 [Faecalibacterium prausnitzii
           M21/2]
 gi|158443735|gb|EDP20740.1| hypothetical protein FAEPRAM212_03537 [Faecalibacterium prausnitzii
           M21/2]
          Length = 263

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 111/223 (49%), Gaps = 35/223 (15%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLT 61
           + I+  I  A+ N  K+ E+  ++   G    S  EL + I PEETG +F ENA+IK+ T
Sbjct: 49  RSIKMKICAATGNAGKLRELRRILEAQGHEVVSQKELGITIEPEETGTTFAENALIKAET 108

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
             K +G+P ++DDSGL +D LDG PG++SAR+   +    D +    K+  A+++  A  
Sbjct: 109 ICKASGLPTIADDSGLCVDALDGAPGVYSARYCGHHG---DDEANNDKLLAAMQAVPAGQ 165

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPP-RGQLGFGYDPIF----------- 169
              R A F+S +    PDG      G+  G I +    G  GFGYDP+F           
Sbjct: 166 ---RGAKFVSAVCFILPDGRHLTCMGECPGSIAFTRLCGDYGFGYDPLFIPADCGVGKTD 222

Query: 170 -QPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
            +PN  +R++ ++T +EK               D +SHR  A 
Sbjct: 223 KRPNTENRSYAQLTPDEK---------------DAISHRGNAL 250


>gi|293391739|ref|ZP_06636073.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952273|gb|EFE02392.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 226

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 111/205 (54%), Gaps = 10/205 (4%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R  ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  
Sbjct: 27  RTNMKQKIVLATGNQGKVREMADVLADFGFDVIAQTDLGIDSPEETGLTFVENAILKARY 86

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+ +G+PA++DDSGLV+D L+G PG++SAR+A    GE   D    K    L ++ A+ 
Sbjct: 87  AAEKSGLPAIADDSGLVVDALNGAPGLYSARYA----GEEGNDA---KNRAKLLAELAYV 139

Query: 122 PA-FRSAHFISVLSLAW--PDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
           PA  R A F+S + L     D       G+  G+I +  +G+ GFGYD +F       TF
Sbjct: 140 PAEQRKAKFVSTIVLLQHPTDPSPIIAQGECHGVIAFEEKGENGFGYDALFFSPQQGCTF 199

Query: 179 GEMTEEEKNGGIDSATLFSILSTDL 203
            E+   EK      A   ++L T L
Sbjct: 200 AELDTVEKKKISHRARALAVLKTKL 224


>gi|229081746|ref|ZP_04214239.1| Nucleoside-triphosphatase [Bacillus cereus Rock4-2]
 gi|228701591|gb|EEL54084.1| Nucleoside-triphosphatase [Bacillus cereus Rock4-2]
          Length = 205

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 108/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKAYSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEVAFEK------- 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|323183525|gb|EFZ68922.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 1357]
 gi|324119749|gb|EGC13629.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli E1167]
          Length = 197

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR+    +GE   D+  +QK+   L+     D   R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARY----SGEDATDLKNLQKLLETLKD--VQDDQ-R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|239982009|ref|ZP_04704533.1| hypothetical protein SalbJ_21422 [Streptomyces albus J1074]
          Length = 200

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/219 (33%), Positives = 115/219 (52%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ +      I+  + L   L+       IP+  ETG +F ENA++
Sbjct: 2   TRLILATRNTGKITELRA------ILADAGLSHELVGADAYPEIPDVKETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRS 116
           K+   A+  G+PA++DDSGL ++VL G PGI SARWA  +  ++ + D+ + ++ +    
Sbjct: 56  KAHALAQATGLPAVADDSGLCVEVLGGAPGIFSARWAGRHGDDQANLDLLLAQLSDI--- 112

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
               D   R+A+F    +LA PDG      G+++G +   P G  GFGYDPI QP+G  R
Sbjct: 113 ----DDPHRAAYFACAAALALPDGTERVVEGRLTGTLRHAPAGTHGFGYDPILQPDGETR 168

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T  EKN                +SHR +AF+   
Sbjct: 169 TCAELTPPEKNA---------------ISHRGKAFRALA 192


>gi|225019241|ref|ZP_03708433.1| hypothetical protein CLOSTMETH_03194 [Clostridium methylpentosum
           DSM 5476]
 gi|224947872|gb|EEG29081.1| hypothetical protein CLOSTMETH_03194 [Clostridium methylpentosum
           DSM 5476]
          Length = 205

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 105/206 (50%), Gaps = 26/206 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           +++A++N  K+ E   ++ PLG    S  E    +  EETG +F ENA +K+    +  G
Sbjct: 3   LILATNNPSKLEEFRRILSPLGFEVLSQSEAGFDMQVEETGKTFAENAFLKADAIYRATG 62

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           +P ++DDSGLV+  L G PG++SAR+A E  T E++     QK+ N L          R 
Sbjct: 63  LPTVADDSGLVVKALKGAPGVYSARYAGEHATDEQN----NQKLLNELIYVGVEK---RQ 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+  +    P+G      G   G I +  RG+ GFGYDP+F  NG  ++F EMT+ EK
Sbjct: 116 AKFVCSICYIDPNGEAHYTDGVCEGRIGFAERGENGFGYDPLFYANG--KSFAEMTDAEK 173

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
                          D  SHR RA +
Sbjct: 174 ---------------DKYSHRGRALR 184


>gi|291453859|ref|ZP_06593249.1| ribonuclease PH/Ham1 protein [Streptomyces albus J1074]
 gi|291356808|gb|EFE83710.1| ribonuclease PH/Ham1 protein [Streptomyces albus J1074]
          Length = 206

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/219 (33%), Positives = 115/219 (52%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ +      I+  + L   L+       IP+  ETG +F ENA++
Sbjct: 8   TRLILATRNTGKITELRA------ILADAGLSHELVGADAYPEIPDVKETGVTFAENALL 61

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRS 116
           K+   A+  G+PA++DDSGL ++VL G PGI SARWA  +  ++ + D+ + ++ +    
Sbjct: 62  KAHALAQATGLPAVADDSGLCVEVLGGAPGIFSARWAGRHGDDQANLDLLLAQLSDI--- 118

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
               D   R+A+F    +LA PDG      G+++G +   P G  GFGYDPI QP+G  R
Sbjct: 119 ----DDPHRAAYFACAAALALPDGTERVVEGRLTGTLRHAPAGTHGFGYDPILQPDGETR 174

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T  EKN                +SHR +AF+   
Sbjct: 175 TCAELTPPEKNA---------------ISHRGKAFRALA 198


>gi|304390774|ref|ZP_07372726.1| nucleoside-triphosphatase [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|304325657|gb|EFL92903.1| nucleoside-triphosphatase [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
          Length = 231

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 108/213 (50%), Gaps = 30/213 (14%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPL-------GIMTTSALELNLIIPEETGNSFEENAMIK 58
           E  +V+A+ N  K+ E++ ++ PL       GI+  +A  L    P E G SF  NA+IK
Sbjct: 23  EAQVVMATGNTHKVREVEEILRPLVPSLRPGGIV--AAGTLGAPEPREDGTSFSANALIK 80

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
           +   A    +P L+DDSGL +D+L G PGI SARW   +  +R     +      +    
Sbjct: 81  ARALASVVDVPILADDSGLSVDILGGSPGIFSARWCGHHGDDRANLELLLNQLQDI---- 136

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
             D  +R+A FI    L  P G     +G + G +V  P+G+ GFGYDPIF  +G + T 
Sbjct: 137 --DDGYRTAAFICAAVLLIPGGGTYLGNGVMGGRLVREPKGKNGFGYDPIFLADGQEVTN 194

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
           GE++++ KN                +SHRA+AF
Sbjct: 195 GELSKDAKNA---------------ISHRAKAF 212


>gi|170765987|ref|ZP_02900798.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia albertii TW07627]
 gi|170125133|gb|EDS94064.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia albertii TW07627]
          Length = 197

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLEIVAQTELGVDSAEETGLTFIENAILKARHAAKMT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQKNLQKLLETLKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGTWPGVITREPVGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|254523680|ref|ZP_05135735.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Stenotrophomonas sp. SKA14]
 gi|219721271|gb|EED39796.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Stenotrophomonas sp. SKA14]
          Length = 198

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 98/185 (52%), Gaps = 12/185 (6%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+ASHN  K+ EM  ++  L +  TSA EL L   EETG +F ENA++K+  A +  
Sbjct: 2   KKLVLASHNAGKLVEMQEILADLPLQITSAAELGLGDVEETGLTFVENALLKARAACQAT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA-LRSKFAHDP-AF 124
           G+PAL+DDSGL++D LDG PG++SAR+A   T             NA L    A  P   
Sbjct: 62  GLPALADDSGLIVDALDGAPGLYSARYAGQPTN--------AAANNAKLLDAMAEVPDGQ 113

Query: 125 RSAHFISVLSLA--WPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           RSA F +V+ L     D       G+  G I   PRG  GFGY+P+F    +  T  EM 
Sbjct: 114 RSARFYAVIVLLRHATDPQPLICEGRWEGQITREPRGSNGFGYNPVFLDTTHGLTAAEME 173

Query: 183 EEEKN 187
              KN
Sbjct: 174 TPLKN 178


>gi|325268324|ref|ZP_08134957.1| ribonuclease PH/Ham1 protein [Prevotella multiformis DSM 16608]
 gi|324989466|gb|EGC21416.1| ribonuclease PH/Ham1 protein [Prevotella multiformis DSM 16608]
          Length = 196

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 113/215 (52%), Gaps = 25/215 (11%)

Query: 8   NIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
            IV A++N  K+ E+  ++     I++ + +  +  IPE TG + +ENA  KS    ++ 
Sbjct: 4   KIVFATNNRHKLEEIKEILGKDFEIVSLAEIGCHEDIPE-TGLTLQENARQKSTYVVEHY 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
                +DD+GL +D L G+PG+ SAR+AE    + D +  M+K    L SK A     R+
Sbjct: 63  RQNCFADDTGLEVDALGGEPGVRSARYAEGT--DHDSEANMRK----LLSKMA-GVENRT 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F +V+SL   DG    F G+V G I     G  GFGYDPIF P GYD++F E+ EE K
Sbjct: 116 ARFRTVISLII-DGVEHQFEGRVDGRIATEKHGSEGFGYDPIFIPEGYDKSFAELGEEVK 174

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           N                +SHRARA K   ++  +I
Sbjct: 175 NK---------------ISHRARAVKKLAEHLRKI 194


>gi|323978751|gb|EGB73832.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli TW10509]
          Length = 197

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 113/216 (52%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E  T +++    ++ +++   ++       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETLKDVPDNQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPVGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|229494046|ref|ZP_04387815.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Rhodococcus erythropolis SK121]
 gi|229319115|gb|EEN84967.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Rhodococcus erythropolis SK121]
          Length = 202

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 103/212 (48%), Gaps = 25/212 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP----EETGNSFEENAMIKSLTAA 63
            +++AS N  K+ E+  ++   G+     + L+ + P     ETG +FEENA+ K+   A
Sbjct: 4   RVLVASRNAKKLKELHRVLDAAGVSGIELVGLDEVPPFPEAPETGATFEENALAKARDGA 63

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
              GMP ++DDSG+ ID L+G PG+ SARW    +G    D A   +  A       +  
Sbjct: 64  AATGMPCIADDSGVEIDALNGMPGVLSARW----SGTHGNDGANTALVLAQLGDVPDE-- 117

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+S  +L  P G      G+  G+I   P G  GFGYDPIF+P+G  R+  E+T 
Sbjct: 118 RRGAAFVSACALVIPGGDETVVRGEWRGVIGREPAGDGGFGYDPIFRPDGDTRSAAELTP 177

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            EK               D  SHR RA    V
Sbjct: 178 AEK---------------DAASHRGRALVQLV 194


>gi|331664537|ref|ZP_08365443.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli TA143]
 gi|331058468|gb|EGI30449.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli TA143]
          Length = 197

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|298694439|gb|ADI97661.1| nucleoside triphosphatase [Staphylococcus aureus subsp. aureus
           ED133]
          Length = 195

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 105/179 (58%), Gaps = 11/179 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIAS+N  KI++   +     ++  S L  +  + EETG++FEENA++KS  AAK    
Sbjct: 4   IVIASNNQGKINDFKVIFPDYHVIGISELIPDFDV-EETGSTFEENAILKSEAAAKALNK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             ++DDSGL +  L+G+PGI+SAR+A E+ + E + +  + K+ N            R A
Sbjct: 63  TVIADDSGLEVFALNGEPGIYSARYAGENKSDEANIEKLLNKLGNTTD---------RRA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ PD   + F G +SG I     G+ GFGYDPIF     D+T  ++++E+K
Sbjct: 114 QFVCVISMSGPDMETKVFKGTISGEIADGKYGENGFGYDPIFYVPKLDKTMAQLSKEQK 172


>gi|256787471|ref|ZP_05525902.1| hypothetical protein SlivT_23531 [Streptomyces lividans TK24]
 gi|289771368|ref|ZP_06530746.1| Ham1 family protein [Streptomyces lividans TK24]
 gi|289701567|gb|EFD68996.1| Ham1 family protein [Streptomyces lividans TK24]
          Length = 200

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 113/219 (51%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ +      I+  + L  +L+       IP+  ETG +F ENA++
Sbjct: 2   TRLILATRNAGKITELRA------ILADAGLPHDLVGADAYPHIPDVKETGVTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRS 116
           K+   A+  G+PA++DDSGL  DVL+G PGI SARWA  +  ++ + D+ + +I +    
Sbjct: 56  KAHALAEATGLPAVADDSGLCADVLNGAPGIFSARWAGRHGDDKANLDLLLAQIADIADE 115

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
                   R AHF    +LA PDG      G++ G +   P G  GFGYDPI QP G  R
Sbjct: 116 -------HRGAHFACAAALALPDGTERVVEGQLRGTLRHAPAGTGGFGYDPILQPEGETR 168

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+T  EKN                +SHR +AF+  V
Sbjct: 169 TCAELTAAEKNA---------------ISHRGKAFRALV 192


>gi|71083076|ref|YP_265795.1| HAM1-like protein [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062189|gb|AAZ21192.1| HAM1-like protein [Candidatus Pelagibacter ubique HTCC1062]
          Length = 200

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 111/216 (51%), Gaps = 29/216 (13%)

Query: 4   LIENNIV---IASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           +++N I+   + ++N  K+ E+  L +P  +   S  +  +  P E G +F+EN++IK+ 
Sbjct: 1   MLKNKIIKLLVGTNNKGKLREIKDL-LPKNVEIYSPQDFKIKSPPENGKTFKENSLIKAK 59

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             +K + M  LSDDSGL IDVLDG PGI+SARW        DF  AM ++   L  K   
Sbjct: 60  FFSKKSKMICLSDDSGLEIDVLDGDPGIYSARWGGKKG---DFKKAMNRVFKELDKK--- 113

Query: 121 DPAFR----SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
           D  +R     A FI  L++   +  + N  GKV G I    +G+ GFGYDPIF P G   
Sbjct: 114 DKNWREKKIKARFICALTIYNKNKEIINSIGKVEGFISPVIKGKNGFGYDPIFIPLGKKI 173

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           TFGEM   +K                 + HR +AFK
Sbjct: 174 TFGEMRASQKYK---------------IDHRFKAFK 194


>gi|220932374|ref|YP_002509282.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Halothermothrix orenii H 168]
 gi|219993684|gb|ACL70287.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Halothermothrix orenii H 168]
          Length = 202

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 106/205 (51%), Gaps = 22/205 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +++AS N  KI E+   +  L I      + +L   EE G +F ENA+ K+ T A+  G
Sbjct: 4   KLLVASGNQGKIREIKKYLNDLDIEIVGLDDFSLPPVEEDGETFYENALKKARTRARETG 63

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +  L+DDSGL +D L GKPG++SAR+A +   + D +   +K+   L+   A     R A
Sbjct: 64  LLTLADDSGLEVDYLQGKPGVYSARYAGAGASDEDNN---KKLLEELKGVPAGQ---RGA 117

Query: 128 HFISVLSLAWPD-GHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F  V+ L  P+ G   + +G   GII+  PRG  GFGYDP+F    Y +T  E+T E K
Sbjct: 118 RFKCVMVLYDPELGEDISVTGSCEGIIMEKPRGDNGFGYDPLFYVPEYGKTMAELTLETK 177

Query: 187 NGGIDSATLFSILSTDLLSHRARAF 211
           N                +SHRARA 
Sbjct: 178 NK---------------ISHRARAL 187


>gi|297625968|ref|YP_003687731.1| HAM1, NTPase/HAM1 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296921733|emb|CBL56291.1| HAM1, NTPase/HAM1 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 268

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 116/223 (52%), Gaps = 35/223 (15%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII----PEETGNSFEENAMIKSL 60
           + + +++A++N  K+ E+  +I+    M    L L  I     PEET  +FE NA+IK+ 
Sbjct: 1   MTSEVLLATNNAKKLTELRRIIVEYD-MDIQVLSLKDIASYPEPEETEWTFEGNALIKAR 59

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFA 119
               ++G+PAL+DDSGL +D L   PG+ S+RW      +  + ++ +++IE+  R +  
Sbjct: 60  QGMIHSGLPALADDSGLCVDALGHMPGVRSSRWDGPEQEDIANMELVLRQIEDVPRGR-- 117

Query: 120 HDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPN------- 172
                R A F+SV++L  PDG      G+++G +   P+G  GFGYDPIF P+       
Sbjct: 118 -----RQAQFVSVMALVMPDGREFTTRGEMTGHLTTRPKGSHGFGYDPIFVPDEQVPDSE 172

Query: 173 GYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           G  RT  EM+  EK               D +SHR R+ +  +
Sbjct: 173 GRLRTAAEMSAAEK---------------DAISHRGRSVRAML 200


>gi|294791356|ref|ZP_06756513.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Scardovia inopinata F0304]
 gi|294457827|gb|EFG26181.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Scardovia inopinata F0304]
          Length = 246

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 108/214 (50%), Gaps = 39/214 (18%)

Query: 6   ENNIVIASHNVDKIHEMDSLIM------PLGIMTTSALELNLIIPEETGNSFEENAMIKS 59
           +  +V+A+HN  K+ E+  ++         G++  ++  L L  PEETG +FEENA++K+
Sbjct: 19  KKTLVVATHNQGKVAEIQRILADSLGQAAEGLIAVTSASLGLPDPEETGTTFEENALLKA 78

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
             AA+  G PA++DDSGL++D++   PG+ SARWA    G    D A   +   L ++ +
Sbjct: 79  RDAAERTGFPAMADDSGLIVDLMGRAPGVLSARWA----GRHGDDAANNAL---LLNQLS 131

Query: 120 HDP-AFRSAHFISVLSLAWPDGHVENFSGK-----------VSGIIVWPPRGQLGFGYDP 167
             P   R A F    +L  P     N  G+           + GII+  PRG+ GFGYDP
Sbjct: 132 DIPDGKRQARFCCACALVIPRQESGNHQGERGYKEYVETGVMPGIIIRQPRGENGFGYDP 191

Query: 168 IFQPN--------------GYDRTFGEMTEEEKN 187
           IF P+              G   T  +MT E+KN
Sbjct: 192 IFVPDDQSQVSSGQFEATGGRPLTTAQMTAEQKN 225


>gi|291460911|ref|ZP_06025826.2| ribonuclease PH/Ham1 protein [Fusobacterium periodonticum ATCC
           33693]
 gi|291380070|gb|EFE87588.1| ribonuclease PH/Ham1 protein [Fusobacterium periodonticum ATCC
           33693]
          Length = 436

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 114/215 (53%), Gaps = 30/215 (13%)

Query: 3   KLIEN---NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMI 57
           K+IE     I +A+ N  KI E+  +   +  +   +++  + IPE  E G +FEEN+  
Sbjct: 236 KVIEQENLKIFLATGNKHKIEEISDIFSGIENIEILSIKDGIEIPEVIEDGKTFEENSKK 295

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSK 117
           K++  AK   M  ++DDSGL +D L+G+PG++SAR+  S TG+ DF    + IEN     
Sbjct: 296 KAVEIAKFLNMITIADDSGLCVDALNGEPGVYSARY--SGTGD-DFKNNEKLIENL---- 348

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                  R A F+SV++LA P+G   +F G++ G I+  PRG  GFGYDP F    Y +T
Sbjct: 349 --KGIENRKAKFVSVITLAKPNGDTYSFEGEILGDIIDTPRGNTGFGYDPHFYVEEYQKT 406

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
             E+ E                  + +SHRA+A +
Sbjct: 407 LAELPE----------------IKNKISHRAKALE 425


>gi|271963273|ref|YP_003337469.1| HAM1 protein [Streptosporangium roseum DSM 43021]
 gi|270506448|gb|ACZ84726.1| HAM1 protein [Streptosporangium roseum DSM 43021]
          Length = 212

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 117/218 (53%), Gaps = 38/218 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI----IPE-----ETGNSFEENAMI 57
           + +V+A+ N+ KI E+        I+  +++ + ++     PE     ETG +F  NA++
Sbjct: 14  DRVVLATRNMGKIVELRR------ILADASVPVEIVGLEEFPEIGDVAETGLTFAANALL 67

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRS 116
           K+   A+ +G+PA++DDSGL +D L+G PGI SARW+  +  +R + ++ + ++ +  R 
Sbjct: 68  KAHAVAQASGLPAIADDSGLCVDALNGMPGIFSARWSGRHGDDRANLELLLAQVSDVPRE 127

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
                   R AHF    +LA P G      G + G+I+  PRG  GFGYDPIF P+G  R
Sbjct: 128 H-------RGAHFACAAALALPSGQERVAEGSLHGLIIDAPRGTNGFGYDPIFLPDGESR 180

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
           T  E++ +EK               D +SHR RAF+  
Sbjct: 181 TTAELSAQEK---------------DAISHRGRAFRAL 203


>gi|113474795|ref|YP_720856.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Trichodesmium erythraeum IMS101]
 gi|110165843|gb|ABG50383.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Trichodesmium erythraeum IMS101]
          Length = 205

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 107/211 (50%), Gaps = 35/211 (16%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALEL---NLIIPEETGNSFEENAMIKSLTAAKN 65
           +V+A+ N+ K+ EM   +  L +     LEL   +L I EETG +F  NA +K+   AK 
Sbjct: 14  LVVATGNLGKVVEMQEYMADLNLQ----LELKPKDLEI-EETGKTFLANACLKASEVAKV 68

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
               A++DDSGL +D LDGKPGI+SAR+A +           ++IE  LR     D   R
Sbjct: 69  TEKWAIADDSGLAVDALDGKPGIYSARYAPT---------VAEQIERVLRE--LKDSQNR 117

Query: 126 SAHFISVLSLAWPDGHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
            A F+  L +A PDG +     G   G I++  RG  GFGYDPIF      +TF EM+ E
Sbjct: 118 QAKFVCALVIARPDGTIALKAEGICYGEILYSTRGNGGFGYDPIFYVPSEKKTFAEMSPE 177

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            K                 LSHR +AF+  +
Sbjct: 178 TKRS---------------LSHRGKAFQILL 193


>gi|145593657|ref|YP_001157954.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Salinispora tropica CNB-440]
 gi|145302994|gb|ABP53576.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Salinispora tropica CNB-440]
          Length = 204

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 114/213 (53%), Gaps = 30/213 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLI--IPE--ETGNSFEENAMIKSLT 61
           N +++A+ N  K+ E+  ++   LG    + + L+ +   PE  ETG +F ENA+IK+  
Sbjct: 2   NKVLLATRNRKKLIELQRILDGALGAHRIALIGLDDVEAYPELPETGLTFGENALIKARE 61

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAH 120
             +  G+P ++DDSGL ++ L+G PG+ SARWA    G+   D A +Q + N    + A 
Sbjct: 62  GCRRTGLPTIADDSGLAVEALNGMPGVFSARWA----GQHGDDHANLQLVLN----QIAD 113

Query: 121 DP-AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
            P   R A F+  ++LA P G      G+ +G ++  P G  GFGYDPIF+ +G DRT  
Sbjct: 114 VPDEHRGASFVCTVALALPGGKEHLVDGRQAGRLLREPHGDGGFGYDPIFRGDGQDRTNA 173

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           E+T  EK               D +SHR +A +
Sbjct: 174 ELTPAEK---------------DAISHRGKALR 191


>gi|258423806|ref|ZP_05686692.1| nucleoside-triphosphatase [Staphylococcus aureus A9635]
 gi|257846038|gb|EEV70066.1| nucleoside-triphosphatase [Staphylococcus aureus A9635]
          Length = 195

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 103/179 (57%), Gaps = 11/179 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIAS+N  KI++   +     ++  S L  +  + EETG +FEENA +KS  AAK    
Sbjct: 4   IVIASNNQGKINDFKVIFPDYHVIGISELIPDFDV-EETGVTFEENAKLKSEAAAKALNK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             ++DDSGL +  L+G+PGI+SAR+A E+ + E + +  + K+ N            R A
Sbjct: 63  TVIADDSGLEVFALNGEPGIYSARYAGENKSDEANIEKLLNKLGNTTD---------RRA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ PD   + F G VSG I     G+ GFGYDPIF     DRT  ++++E+K
Sbjct: 114 QFVCVISMSGPDMETKVFKGTVSGEIADGKYGENGFGYDPIFYVPKLDRTMAQLSKEQK 172


>gi|312870422|ref|ZP_07730545.1| Ham1 family protein [Lactobacillus oris PB013-T2-3]
 gi|311094054|gb|EFQ52375.1| Ham1 family protein [Lactobacillus oris PB013-T2-3]
          Length = 152

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/167 (40%), Positives = 91/167 (54%), Gaps = 23/167 (13%)

Query: 52  EENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIE 111
           EENA+IK+ TA     +P L+DDSGLV+D L+G PG+HSAR+A    G+ D      K+ 
Sbjct: 1   EENALIKARTAVAKLDLPVLADDSGLVVDALNGAPGVHSARYA----GDHDDAANNAKL- 55

Query: 112 NALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQP 171
             LR       A R+AHF + +    PDG     SG+V G I+  PRGQ GFGYDP+F P
Sbjct: 56  --LRELTGVPAAQRTAHFHTTIVALKPDGAKLETSGRVEGQILTQPRGQNGFGYDPLFMP 113

Query: 172 NGY-DRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
             +  R+  E+T  EKN                +SHR RA + F++ 
Sbjct: 114 KEFPGRSMAELTPAEKN---------------QISHRGRALRAFMEQ 145


>gi|254819171|ref|ZP_05224172.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Mycobacterium intracellulare ATCC 13950]
          Length = 200

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 113/212 (53%), Gaps = 28/212 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP----EETGNSFEENAMIKSLTAAK 64
           +++AS N  K+ E+  ++   G+   + + L+ + P     ETG +FEENA+ K+  A  
Sbjct: 1   MLVASRNPKKLAELRRVLDAAGLTGLTLVSLDDVAPFEEAPETGATFEENALAKARDAFT 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-A 123
            +G+P+++DDSGL +  L+G PG+ SARW+ S+ G+   + A+      L ++    P  
Sbjct: 61  ASGLPSVADDSGLEVAALNGMPGVLSARWSGSH-GDDAGNTAL------LLAQMRDVPDE 113

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+S  +L    G V    G+  G I   PRG  GFGYDP+F PNGY+RT  E++ 
Sbjct: 114 RRGAAFVSACALVSGAGEV-VVRGEWPGSIAREPRGHGGFGYDPVFVPNGYERTAAELSP 172

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            EK               D +SHR RA +  +
Sbjct: 173 SEK---------------DAVSHRGRALQLLL 189


>gi|16766404|ref|NP_462019.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|56415041|ref|YP_152116.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|161506345|ref|YP_001573457.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|161616067|ref|YP_001590032.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Paratyphi B
           str. SPB7]
 gi|167990370|ref|ZP_02571470.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168234346|ref|ZP_02659404.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168236171|ref|ZP_02661229.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family protein
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168242906|ref|ZP_02667838.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168819867|ref|ZP_02831867.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|194442220|ref|YP_002042362.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194448347|ref|YP_002047091.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194472795|ref|ZP_03078779.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194736901|ref|YP_002116051.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197250440|ref|YP_002148017.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197262335|ref|ZP_03162409.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197363970|ref|YP_002143607.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|198243603|ref|YP_002217078.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|207858364|ref|YP_002245015.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|238909901|ref|ZP_04653738.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Tennessee
           str. CDC07-0191]
 gi|22653762|sp|Q8ZM45|RDGB_SALTY RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|62900167|sp|Q5PMK9|RDGB_SALPA RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|16421656|gb|AAL21978.1| putative xanthosine triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|56129298|gb|AAV78804.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|160867692|gb|ABX24315.1| hypothetical protein SARI_04542 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161365431|gb|ABX69199.1| hypothetical protein SPAB_03868 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194400883|gb|ACF61105.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194406651|gb|ACF66870.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194459159|gb|EDX47998.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194712403|gb|ACF91624.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197095447|emb|CAR61006.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197214143|gb|ACH51540.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197240590|gb|EDY23210.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197290664|gb|EDY30018.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family protein
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197938119|gb|ACH75452.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|205331210|gb|EDZ17974.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205331687|gb|EDZ18451.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205338196|gb|EDZ24960.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205343452|gb|EDZ30216.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|206710167|emb|CAR34523.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|267995268|gb|ACY90153.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 14028S]
 gi|301159658|emb|CBW19177.1| HAM1 protein homolog [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312914125|dbj|BAJ38099.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. T000240]
 gi|320087535|emb|CBY97300.1| Nucleoside-triphosphatase rdgB Nucleoside triphosphate
           phosphohydrolase; NTPase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321225776|gb|EFX50830.1| Nucleoside 5-triphosphatase RdgB dHAPTP, dITP, XTP-specific
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322613500|gb|EFY10441.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315996572]
 gi|322621092|gb|EFY17950.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-1]
 gi|322624156|gb|EFY20990.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-3]
 gi|322628105|gb|EFY24894.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-4]
 gi|322633224|gb|EFY29966.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-1]
 gi|322636198|gb|EFY32906.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-2]
 gi|322639536|gb|EFY36224.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 531954]
 gi|322647531|gb|EFY44020.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. NC_MB110209-0054]
 gi|322648715|gb|EFY45162.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. OH_2009072675]
 gi|322653770|gb|EFY50096.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. CASC_09SCPH15965]
 gi|322657876|gb|EFY54144.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 19N]
 gi|322663979|gb|EFY60178.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 81038-01]
 gi|322669010|gb|EFY65161.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MD_MDA09249507]
 gi|322672996|gb|EFY69103.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 414877]
 gi|322678013|gb|EFY74076.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 366867]
 gi|322681189|gb|EFY77222.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 413180]
 gi|322687881|gb|EFY83848.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 446600]
 gi|322716096|gb|EFZ07667.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323131459|gb|ADX18889.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 4/74]
 gi|323194923|gb|EFZ80110.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609458-1]
 gi|323199627|gb|EFZ84717.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556150-1]
 gi|323202626|gb|EFZ87666.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609460]
 gi|323207887|gb|EFZ92833.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 507440-20]
 gi|323212561|gb|EFZ97378.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556152]
 gi|323214956|gb|EFZ99704.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB101509-0077]
 gi|323222686|gb|EGA07051.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB102109-0047]
 gi|323225429|gb|EGA09661.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB110209-0055]
 gi|323230556|gb|EGA14674.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB111609-0052]
 gi|323235093|gb|EGA19179.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009083312]
 gi|323239132|gb|EGA23182.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009085258]
 gi|323244510|gb|EGA28516.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315731156]
 gi|323247125|gb|EGA31091.1| dITP/XTP pyrophosphatase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253392|gb|EGA37221.1| dITP/XTP pyrophosphatase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256301|gb|EGA40037.1| dITP/XTP pyrophosphatase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262523|gb|EGA46079.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008284]
 gi|323267381|gb|EGA50865.1| dITP/XTP pyrophosphatase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269215|gb|EGA52670.1| dITP/XTP pyrophosphatase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326624850|gb|EGE31195.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           3246]
 gi|332989970|gb|AEF08953.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. UK-1]
          Length = 197

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKMT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E+ T +++ +  +  + +    K       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQQNLEKLLHTLRDVPDDK-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I     G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|293449284|ref|ZP_06663705.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Escherichia coli B088]
 gi|291322374|gb|EFE61803.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Escherichia coli B088]
 gi|323946548|gb|EGB42571.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli H120]
          Length = 197

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 113/216 (52%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E  T +++    ++ +++   ++       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETLKDVPDNQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGMITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|325859777|ref|ZP_08172907.1| non-canonical purine NTP pyrophosphatase RdgB [Prevotella denticola
           CRIS 18C-A]
 gi|325482703|gb|EGC85706.1| non-canonical purine NTP pyrophosphatase RdgB [Prevotella denticola
           CRIS 18C-A]
          Length = 196

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 112/214 (52%), Gaps = 25/214 (11%)

Query: 9   IVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           IV A++N  K+ E+  ++     I++ + +  +  IPE TG + +ENA  KS    ++  
Sbjct: 5   IVFATNNKHKLEEIKEILGKDFEIVSLAEIGCHEDIPE-TGLTLQENARQKSTYVVEHYR 63

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
               +DD+GL +D L G+PG+HSAR+AE    + D +  M K    L SK A     R+A
Sbjct: 64  QNCFADDTGLEVDALGGEPGVHSARYAEGT--DHDSEANMHK----LLSKMA-GVENRTA 116

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F +V+SL   DG    F G+V G I     G  GFGYDPIF P GYD++F E+ EE KN
Sbjct: 117 RFRTVISLII-DGVEHQFEGRVDGHIATEKHGSEGFGYDPIFIPEGYDKSFAELGEEVKN 175

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
                           +SHRA+A K   +   ++
Sbjct: 176 K---------------ISHRAKAVKKLAEYLRKV 194


>gi|257069147|ref|YP_003155402.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brachybacterium faecium DSM 4810]
 gi|256559965|gb|ACU85812.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brachybacterium faecium DSM 4810]
          Length = 212

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/222 (30%), Positives = 117/222 (52%), Gaps = 32/222 (14%)

Query: 8   NIVIASHNVDKIHEMDSLIM-------PLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
            +++ASHN  K+ E+  ++        P  +++++ + L  ++  E   +FE NA++K+ 
Sbjct: 13  RVILASHNAKKLGELQRILTAAVPGLAPEQVISSAGIALPDVV--EDAVTFEGNALLKAR 70

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           +AA   G+ A++DDSGL +DVL G PGI SARW    +G    D A   +   L ++   
Sbjct: 71  SAAAATGLLAVADDSGLAVDVLGGAPGIFSARW----SGRHGDDEANNDL---LLAQLGD 123

Query: 121 DP-AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
            P A R+A F+   +L  P G      G++ G+++   RG+ GFGYDP+F P+G  R+  
Sbjct: 124 VPDAHRTARFVCAAALVAPGGAESVERGEMVGLLLRERRGEGGFGYDPLFLPDGETRSAA 183

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           E++  +K               D +SHR +AF+    +  ++
Sbjct: 184 ELSPAQK---------------DAISHRGKAFRALAGHVAQL 210


>gi|229158098|ref|ZP_04286168.1| Nucleoside-triphosphatase [Bacillus cereus ATCC 4342]
 gi|228625417|gb|EEK82174.1| Nucleoside-triphosphatase [Bacillus cereus ATCC 4342]
          Length = 205

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 112/212 (52%), Gaps = 30/212 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++         +D AF
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQEL---------NDVAF 115

Query: 125 --RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y ++  E
Sbjct: 116 EKRKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKSMAE 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           ++ +EKN                +SHR RA +
Sbjct: 176 LSSDEKNA---------------ISHRGRALR 192


>gi|227524350|ref|ZP_03954399.1| nucleoside-triphosphatase [Lactobacillus hilgardii ATCC 8290]
 gi|227088581|gb|EEI23893.1| nucleoside-triphosphatase [Lactobacillus hilgardii ATCC 8290]
          Length = 199

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 104/208 (50%), Gaps = 25/208 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNAG 67
           IVIAS N +K+ E D      GI   S     N+   EETG +FEENA +KS        
Sbjct: 7   IVIASKNANKVKEFDEAFKGTGIKIESLKSFSNVPDVEETGQTFEENAFLKSSAIMAFTK 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +P ++DDSGLV+  L+G+PG+HSAR+A    G+ D D    K+   +++K       R A
Sbjct: 67  LPVIADDSGLVVHALNGQPGVHSARYA----GDHDDDANNAKLLKEMQNK-----TNRDA 117

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           +F SVL    P+G      G+V+G I+   RG   FGYDP+F       T  EM+  +KN
Sbjct: 118 YFESVLIYLSPEGDKVISKGRVNGQILRARRGFNNFGYDPLFYVPEQQLTLAEMSTHDKN 177

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFV 215
                           +SHR RA +  +
Sbjct: 178 A---------------ISHRGRAIRQLI 190


>gi|91762498|ref|ZP_01264463.1| HAM1-like protein [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718300|gb|EAS84950.1| HAM1-like protein [Candidatus Pelagibacter ubique HTCC1002]
          Length = 200

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 111/216 (51%), Gaps = 29/216 (13%)

Query: 4   LIENNIV---IASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           +++N I+   + ++N  K+ E+  L +P  +   S  +  +  P E G +F+EN++IK+ 
Sbjct: 1   MLKNKIIKLLVGTNNKGKLREIKDL-LPKNVEIYSPQDFKIKSPPENGKTFKENSLIKAK 59

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             +K + M  LSDDSGL IDVLDG PGI+SARW        DF  AM ++   L  K   
Sbjct: 60  FFSKKSKMTCLSDDSGLEIDVLDGDPGIYSARWGGKKG---DFKKAMNRVFKELDKK--- 113

Query: 121 DPAFR----SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
           D  +R     A FI  L++   +  + N  G+V G I    +G+ GFGYDPIF P G   
Sbjct: 114 DKNWREKKIKARFICALTIYNKNKEIINSIGRVEGFISPVIKGKNGFGYDPIFIPLGKKI 173

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           TFGEM   +K                 + HR +AFK
Sbjct: 174 TFGEMRASQKYK---------------IDHRFKAFK 194


>gi|91794037|ref|YP_563688.1| Ham1-like protein [Shewanella denitrificans OS217]
 gi|91716039|gb|ABE55965.1| Ham1-like protein [Shewanella denitrificans OS217]
          Length = 200

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/186 (38%), Positives = 101/186 (54%), Gaps = 16/186 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+AS N  K+ E + +  P  I      + N+    ETG +F ENA+IK+  AAK  
Sbjct: 2   QQIVLASGNKGKLKEFEQMFAPFSIKVLPQSQFNVTEVAETGTTFVENAIIKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           GMPA+SDDSGL +D L+G PGI+SAR+A  N  E++  +   K+  AL  +     A RS
Sbjct: 62  GMPAISDDSGLEVDALNGAPGIYSARYAAPNANEKNNYL---KLLTALEGE-----ANRS 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVS-----GIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  VL       H ++ S  +      G I   P+G+ G GYDPIF P   + T  E+
Sbjct: 114 ARFQCVLVYMR---HCDDPSPVICQASWEGKIALQPQGENGHGYDPIFIPELEECTASEL 170

Query: 182 TEEEKN 187
           ++ +KN
Sbjct: 171 SDSQKN 176


>gi|300947685|ref|ZP_07161854.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 116-1]
 gi|300954199|ref|ZP_07166664.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 175-1]
 gi|284922897|emb|CBG35986.1| conserved hypothetical protein [Escherichia coli 042]
 gi|300318783|gb|EFJ68567.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 175-1]
 gi|300452731|gb|EFK16351.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 116-1]
          Length = 197

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNVGKVRELASLLSDFGLNIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            +PA++DDSGL +DVL G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  ALPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|315634898|ref|ZP_07890180.1| non-canonical purine NTP pyrophosphatase RdgB [Aggregatibacter
           segnis ATCC 33393]
 gi|315476450|gb|EFU67200.1| non-canonical purine NTP pyrophosphatase RdgB [Aggregatibacter
           segnis ATCC 33393]
          Length = 199

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 109/213 (51%), Gaps = 23/213 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  AA+
Sbjct: 1   MKQKIVLATGNQGKVREMADVLADFGFEVIAQTDLGIDSPEETGLTFVENAILKARYAAE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA- 123
            +G+PA++DDSGLV+D L+G PG++SAR+A       D + A  K    L ++ A+ P  
Sbjct: 61  KSGLPAIADDSGLVVDALNGAPGLYSARYAGV-----DGEQADAKNREKLLAELANVPTE 115

Query: 124 FRSAHFISVLSLAW--PDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            RSA F+S + L     D       G   G+I +  +G  GFGYD +F       TF E+
Sbjct: 116 HRSAQFVSTIVLLQHPTDPSPIIAQGACHGVITFEEKGDNGFGYDSLFFSPETGCTFAEL 175

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
              EK                 +SHRARA    
Sbjct: 176 ETAEKKK---------------ISHRARALSAL 193


>gi|311896218|dbj|BAJ28626.1| putative nucleoside-triphosphatase [Kitasatospora setae KM-6054]
          Length = 201

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 113/220 (51%), Gaps = 38/220 (17%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI----IPE-----ETGNSFEENA 55
           +   +V+A+ N  K+ E+        I+  + L++ L+     PE     ETG +F ENA
Sbjct: 1   MTKRLVLATRNQHKVAELRD------ILGAAGLDVELVGADAFPEVPDVPETGVTFAENA 54

Query: 56  MIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENAL 114
           ++K+   AK  G+PA++DDSGL +DVL G PGI SARWA  +  +R + D+ + ++ +  
Sbjct: 55  LLKAHALAKATGLPAVADDSGLCVDVLGGAPGIFSARWAGRHGDDRANLDLLLAQLGDIA 114

Query: 115 RSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGY 174
                     R+A F    +LA PDG      G++ G +   P G  GFGYDP+ QP G 
Sbjct: 115 AE-------HRAASFACAAALALPDGTERVVEGRLHGTLRTEPAGANGFGYDPVLQPLGE 167

Query: 175 DRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
            RT  E+T +EKN                +SHR +AF+  
Sbjct: 168 SRTCAELTADEKNA---------------ISHRGQAFRSL 192


>gi|227891098|ref|ZP_04008903.1| nucleoside-triphosphatase [Lactobacillus salivarius ATCC 11741]
 gi|227866972|gb|EEJ74393.1| nucleoside-triphosphatase [Lactobacillus salivarius ATCC 11741]
          Length = 199

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 104/206 (50%), Gaps = 23/206 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNA 66
           +I+IA+ N  K  E   L    GI   + L++ N    +E G +F ENA+IK+ T     
Sbjct: 4   HILIATKNAGKAREFKKLFSEKGIEVKTLLDMENTPEIDENGKTFTENALIKAQTLTDLY 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +P L+DDSG+V+D L+G+PGI+SAR+A  +  E +    +  +E     K       R+
Sbjct: 64  KIPVLADDSGIVVDYLNGEPGIYSARYAGDHDDEANKKKLLHNLEGVPFEK-------RT 116

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           AHF   L +  P        G V G IV   RG+ GFGYDP+F     D+TFGE T +EK
Sbjct: 117 AHFHCSLVITSPVKDPLIAEGNVEGYIVEEERGKGGFGYDPLFFYPPLDKTFGETTADEK 176

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                +SHRA A K
Sbjct: 177 NA---------------VSHRANAIK 187


>gi|300928103|ref|ZP_07143648.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 187-1]
 gi|300463869|gb|EFK27362.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 187-1]
          Length = 197

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETLKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGMITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|255324312|ref|ZP_05365433.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Corynebacterium tuberculostearicum SK141]
 gi|255298642|gb|EET77938.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Corynebacterium tuberculostearicum SK141]
          Length = 202

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 109/212 (51%), Gaps = 27/212 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE----ETGNSFEENAMIKSLTAAK 64
           I++AS+N  K+ E++ ++   GI       L+ + P     E G +F +NA+IK+   A 
Sbjct: 3   ILVASNNPKKLAELERILADAGIEGVELRPLSAVEPYPEPVEDGRTFADNALIKARAGAA 62

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-A 123
             G   ++DDSGL I+ L+G PG+ SARW    +G+   D A   +   + ++ A  P  
Sbjct: 63  ATGFATVADDSGLAIEELNGMPGVLSARW----SGQHGNDQANNDL---VLAQMADVPDE 115

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+SV +L  PDG      G+  G  +  PRG  GFGYDP+FQP G  R+  EM+ 
Sbjct: 116 RRAAAFVSVCALVTPDGTEHVAEGRWEGRFLREPRGDNGFGYDPLFQPEGESRSAAEMSP 175

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           EEKN                +SHR RA    V
Sbjct: 176 EEKNA---------------VSHRGRALSQLV 192


>gi|205354026|ref|YP_002227827.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|205273807|emb|CAR38802.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326629139|gb|EGE35482.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
          Length = 197

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKMT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E+ T +++ +  +  + +    K       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQQNLEKLLHTLRDVPDDK-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I     G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPIVCHGSWPGVITRQEAGNGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|16130855|ref|NP_417429.1| dITP/XTP pyrophosphatase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89109731|ref|AP_003511.1| dITP/XTP pyrophosphatase [Escherichia coli str. K-12 substr. W3110]
 gi|170082506|ref|YP_001731826.1| dITP/XTP pyrophosphatase [Escherichia coli str. K-12 substr. DH10B]
 gi|188496240|ref|ZP_03003510.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli 53638]
 gi|238902076|ref|YP_002927872.1| dITP/XTP pyrophosphatase [Escherichia coli BW2952]
 gi|253772208|ref|YP_003035039.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|301643692|ref|ZP_07243731.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 146-1]
 gi|307139639|ref|ZP_07498995.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli H736]
 gi|331643647|ref|ZP_08344778.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli H736]
 gi|1723866|sp|P52061|RDGB_ECOLI RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|882483|gb|AAA69121.1| ORF_o197 [Escherichia coli str. K-12 substr. MG1655]
 gi|1789324|gb|AAC75991.1| dITP/XTP pyrophosphatase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|85675764|dbj|BAE77017.1| dITP/XTP pyrophosphatase [Escherichia coli str. K12 substr. W3110]
 gi|169890341|gb|ACB04048.1| dITP/XTP pyrophosphatase [Escherichia coli str. K-12 substr. DH10B]
 gi|188491439|gb|EDU66542.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli 53638]
 gi|238860781|gb|ACR62779.1| dITP/XTP pyrophosphatase [Escherichia coli BW2952]
 gi|253323252|gb|ACT27854.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|260448003|gb|ACX38425.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli DH1]
 gi|301077894|gb|EFK92700.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 146-1]
 gi|309703309|emb|CBJ02645.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|315137551|dbj|BAJ44710.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli DH1]
 gi|315614884|gb|EFU95522.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 3431]
 gi|323936043|gb|EGB32338.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli E1520]
 gi|331037118|gb|EGI09342.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli H736]
          Length = 197

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            +PA++DDSGL +DVL G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  ALPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|206901258|ref|YP_002251051.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Dictyoglomus thermophilum H-6-12]
 gi|226737260|sp|B5YEU3|NTPA_DICT6 RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|206740361|gb|ACI19419.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Dictyoglomus thermophilum H-6-12]
          Length = 205

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 110/214 (51%), Gaps = 28/214 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLG--IMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           IV+A+ N  K+ E+  ++      I T   LE ++ +PEETG S+EENA IK+   A+  
Sbjct: 6   IVLATKNEGKVREILEILSEYKDQIKTLKELEFDMDLPEETGKSYEENAFIKAKYVAEIT 65

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G P +++DSGL ID L G+ GI+SAR+  +   +    + ++K+++            R 
Sbjct: 66  GYPVIAEDSGLEIDALQGELGIYSARFGGNVGYKEKISLVLEKMKDTPWED-------RK 118

Query: 127 AHFISVLSLAWPDGHVENFS-GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           A FI           V+  + GKV G I + P+G+ GFGYDPIF     D+TFGE+ + E
Sbjct: 119 ARFICKAVFYDMKEDVKIITGGKVEGYIAYEPKGEKGFGYDPIFYFPLLDKTFGEIDKSE 178

Query: 186 KNGGIDSATLFSILSTDLLSHRARAF---KCFVD 216
           KN                 SHR  AF   K F+D
Sbjct: 179 KNK---------------YSHRFLAFSKLKLFLD 197


>gi|62181613|ref|YP_218030.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62129246|gb|AAX66949.1| putative Xanthosine triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
          Length = 197

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 111/215 (51%), Gaps = 31/215 (14%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK  G
Sbjct: 3   KVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKMTG 62

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           +PA++DDSGL +DVL G PGI+SAR++ E+ T +++ +  +  + +    K       R 
Sbjct: 63  LPAIADDSGLAVDVLGGAPGIYSARYSGENATDQQNLEKLLHTLRDVPDDK-------RQ 115

Query: 127 AHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  VL       H E+ +     G   G+I     G  GFGYDPIF      +T  E+
Sbjct: 116 ARFHCVLVYLR---HAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAEL 172

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           T EEK+                +SHR +A K  +D
Sbjct: 173 TREEKSA---------------ISHRGQALKLLLD 192


>gi|290476323|ref|YP_003469227.1| 6-N-hydroxylaminopurine mutagenesis regulatory protein [Xenorhabdus
           bovienii SS-2004]
 gi|289175660|emb|CBJ82463.1| putative protein controls HAP (6-N-hydroxylaminopurine) mutagenesis
           (Ham1) [Xenorhabdus bovienii SS-2004]
          Length = 197

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 112/218 (51%), Gaps = 29/218 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+  L+   G+   +  EL +   +ETG +F ENA+IK+  AA   
Sbjct: 2   QKIVLATGNAGKVRELADLLTDFGLDIVAQTELGVDSADETGLTFIENAIIKARHAAAIT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSGL ++ L G PGI+SAR+A  +  +RD    ++K+  A+R         R 
Sbjct: 62  GLPAIADDSGLSVNALGGAPGIYSARYAGIDASDRD---NLEKLLEAMRDIPDEK---RQ 115

Query: 127 AHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  VL       H E+     F G+ SGII   P G  GFGYDPIF    +  T  E+
Sbjct: 116 AQFNCVLVYLR---HAEDPTPLIFHGRWSGIITHEPAGNGGFGYDPIFYVPEFGCTAAEL 172

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           + E+K+                +SHR +A K  ++  L
Sbjct: 173 SHEQKSA---------------VSHRGQALKMLLEAML 195


>gi|227488225|ref|ZP_03918541.1| nucleoside-triphosphatase [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227542823|ref|ZP_03972872.1| nucleoside-triphosphatase [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227091795|gb|EEI27107.1| nucleoside-triphosphatase [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227181449|gb|EEI62421.1| nucleoside-triphosphatase [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 187

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 109/216 (50%), Gaps = 31/216 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           I++ASHN  K  E+  L   L ++T    E     P E G SF+ENA+IK+   AK  G+
Sbjct: 2   ILLASHNAAKAAELKRLTG-LEVVTPDYPE-----PVEDGLSFKENALIKARAGAKATGL 55

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
             L+DDSGL ++ L+G PGI SARW    +G    D A  K+   L ++    P  R A 
Sbjct: 56  VTLADDSGLTVEALNGMPGILSARW----SGTHGDDEANNKL---LLAQLTDLP--REAA 106

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQP-NGYDRTFGEMTEEEKN 187
           F+  ++L  PDG       +  G I   PRG+ GFGYDPIF P +G  +T  E+T EEK 
Sbjct: 107 FVCCVALVTPDGEEYVEECRWPGTIATEPRGENGFGYDPIFVPHDGNGKTSAELTAEEK- 165

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
                         D LSHR +A +       +I +
Sbjct: 166 --------------DRLSHRGQAMRKIATRLAQISQ 187


>gi|328956949|ref|YP_004374335.1| ribonuclease PH [Carnobacterium sp. 17-4]
 gi|328673273|gb|AEB29319.1| ribonuclease PH [Carnobacterium sp. 17-4]
          Length = 454

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 102/184 (55%), Gaps = 9/184 (4%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAK 64
           ++ I+IA+ N  K  E ++L    G    +  +   I   EETG +FEENA++K+ T A+
Sbjct: 256 KDEILIATANAGKAREFEALFAKKGFKVKTLRDFPEIPEVEETGTTFEENALLKAETIAR 315

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQ-KIENALRSKFAHDPA 123
              M  L+DDSGL +D LDG PG+ SAR+A    GE   D A   K+ + L      D  
Sbjct: 316 TLNMLVLADDSGLKVDALDGAPGVFSARYA----GEFKSDAANNAKLLHELTGVAKGD-- 369

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F   L+LA P        G+V G+I+  P+G+ GFGYDP+F      +T  E+T+
Sbjct: 370 -RTAQFHCTLALALPGKTSLVVEGEVEGLILTIPKGENGFGYDPLFFVESKGKTMAELTQ 428

Query: 184 EEKN 187
           +EKN
Sbjct: 429 DEKN 432


>gi|307329926|ref|ZP_07609079.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Streptomyces violaceusniger Tu 4113]
 gi|306884417|gb|EFN15450.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Streptomyces violaceusniger Tu 4113]
          Length = 211

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 114/219 (52%), Gaps = 38/219 (17%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +V+A+ N  KI E+ S      I+  + L+  L+       +P+  ETG +F ENA++
Sbjct: 13  RRLVLATRNAYKITELRS------ILGEAGLDAELVGADAYPEVPDVKETGVTFAENALL 66

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRS 116
           K+   A+  G PA++DDSGL +DVL G PGI SARW+  +  +R + D+ + ++ +    
Sbjct: 67  KAHALARATGHPAIADDSGLCVDVLGGAPGIFSARWSGRHGDDRANLDLLLAQLSDVPDE 126

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
                   R AHF    +LA PDG     SG+++G +   P G  GFGYDPI QP+G  R
Sbjct: 127 -------HRGAHFACAAALALPDGTERVVSGRLTGTLRHEPVGGGGFGYDPILQPHGETR 179

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  E+  EEKN                +SHR +AF+   
Sbjct: 180 TCAELDPEEKNA---------------ISHRGKAFRAIA 203


>gi|218133783|ref|ZP_03462587.1| hypothetical protein BACPEC_01665 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991158|gb|EEC57164.1| hypothetical protein BACPEC_01665 [Bacteroides pectinophilus ATCC
           43243]
          Length = 203

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 106/204 (51%), Gaps = 22/204 (10%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           I+ A+ N  K+ E+  ++  L +   S  +  + I  +E G +FEENA+IK+    +   
Sbjct: 5   IIFATGNAGKMKEIQMIMSDLDVEVVSMKDAGINIDIDENGTTFEENALIKARAVMQECN 64

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           M  L+DDSGL +D L+ +PG++SAR+   +T    +D+  + I + L     +D   RSA
Sbjct: 65  MITLADDSGLEVDYLNKEPGVYSARYMGEDTS---YDIKNRSIIDRLEGVTGND---RSA 118

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+ V++ A PDG      G + G+I +  +G+ GFGYDPI     YD T  E++ E KN
Sbjct: 119 RFVCVIAAALPDGRTLTTRGTIEGLIGYEQKGENGFGYDPIVYVPEYDATTAELSMEVKN 178

Query: 188 GGIDSATLFSILSTDLLSHRARAF 211
                           +SHR +A 
Sbjct: 179 S---------------ISHRGKAL 187


>gi|261248234|emb|CBG26071.1| HAM1 protein homolog [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
          Length = 197

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 110/216 (50%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKMT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E+ T +++ +  +  + +    K       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQQNLEKLLHTLRDVPDDK-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I     G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK                 +SHR +A K  +D
Sbjct: 172 LTREEKRA---------------ISHRGQALKLLLD 192


>gi|239931008|ref|ZP_04687961.1| hypothetical protein SghaA1_22501 [Streptomyces ghanaensis ATCC
           14672]
 gi|291439381|ref|ZP_06578771.1| ribonuclease PH/Ham1 protein [Streptomyces ghanaensis ATCC 14672]
 gi|291342276|gb|EFE69232.1| ribonuclease PH/Ham1 protein [Streptomyces ghanaensis ATCC 14672]
          Length = 200

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 112/218 (51%), Gaps = 36/218 (16%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-------IPE--ETGNSFEENAMI 57
             +++A+ N  KI E+ +      I+  + L  +LI       +P+  ETG +F ENA++
Sbjct: 2   TRLILATRNAGKITELRA------ILAEAGLPHDLIGADAHPEVPDVKETGTTFAENALL 55

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSK 117
           K+ T A+  G+PA++DDSGL +DVL G PGI SARW    +G    D A   +  A  + 
Sbjct: 56  KAHTLARATGLPAVADDSGLCVDVLGGAPGIFSARW----SGRHGDDRANLDLLLAQLAD 111

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
            A +   R AHF    +LA PDG      G++ G +   P G  GFGYDPI QP G  RT
Sbjct: 112 IADE--HRGAHFACAAALALPDGTERVVEGRLRGTLRHAPSGTGGFGYDPILQPEGETRT 169

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
             E++  EKN                +SHR +AF+  V
Sbjct: 170 CAELSPAEKNA---------------ISHRGKAFRELV 192


>gi|297583710|ref|YP_003699490.1| non-canonical purine NTP pyrophosphatase [Bacillus selenitireducens
           MLS10]
 gi|297142167|gb|ADH98924.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bacillus selenitireducens MLS10]
          Length = 207

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 100/185 (54%), Gaps = 12/185 (6%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAK 64
             ++IA+ N  K+ E +      G+   S  +   I P+  E G +FE NA+ K++T  +
Sbjct: 2   KEVMIATRNKGKVAEFEQFFANKGVQVRSLFDAEEI-PDIVEDGATFEANAIKKAVTVQE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWA--ESNTGERDFDMAMQKIENALRSKFAHDP 122
             G+  +SDDSGL +D LDG PGI+SAR+A  E  + E +    +Q++E         + 
Sbjct: 61  ALGITVISDDSGLEVDALDGAPGIYSARYAGLEEKSDEANNAKLLQELEGV-------EG 113

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             RSA F+ VL+ A+P G V+   G   G+I     G  GFGYDP+F   G +RT   +T
Sbjct: 114 EERSARFVCVLAAAFPSGVVKTVRGTAEGLIADSLSGTEGFGYDPLFILKGEERTMAHLT 173

Query: 183 EEEKN 187
           + EKN
Sbjct: 174 KAEKN 178


>gi|160878527|ref|YP_001557495.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Clostridium phytofermentans ISDg]
 gi|160427193|gb|ABX40756.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium phytofermentans ISDg]
          Length = 193

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 110/212 (51%), Gaps = 27/212 (12%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKS 59
           MRK     I+ A+ N  K+ E+  ++  L     S  E  + I  EETG +FEENA+IK+
Sbjct: 1   MRK-----IIFATSNEGKMREIRMILKDLDYEVVSMKEAGIDISIEETGTTFEENAIIKA 55

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
            T  +  G   L+DDSGL +D L+  PG++SAR+   +T    +D+    I + L    A
Sbjct: 56  KTIMEMTGEIVLADDSGLEVDYLEKAPGVYSARYLGEDT---SYDIKNNHILSLLEG-VA 111

Query: 120 HDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
            +   RSA F+ V++ AWP+G ++     + G I +   G+ GFGYDPIF    Y  T  
Sbjct: 112 EEK--RSARFVCVIACAWPNGEIKVKRATIEGNIGYEIAGENGFGYDPIFVVPEYGCTTA 169

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
           E+T E+KN                +SHRA+A 
Sbjct: 170 ELTAEQKN---------------TISHRAKAL 186


>gi|42783631|ref|NP_980878.1| HAM1 protein [Bacillus cereus ATCC 10987]
 gi|62900237|sp|Q72ZT2|NTPA_BACC1 RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|42739560|gb|AAS43486.1| HAM1 protein [Bacillus cereus ATCC 10987]
 gi|324328383|gb|ADY23643.1| nucleoside-triphosphatase [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 202

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 111/212 (52%), Gaps = 30/212 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 2   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++         +D AF
Sbjct: 62  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQEL---------NDVAF 112

Query: 125 --RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E
Sbjct: 113 EKRKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAE 172

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           ++ +EKN                +SHR RA +
Sbjct: 173 LSSDEKNA---------------ISHRGRALR 189


>gi|157155704|ref|YP_001464307.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli E24377A]
 gi|191167916|ref|ZP_03029719.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli B7A]
 gi|193063581|ref|ZP_03044670.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli E22]
 gi|194426340|ref|ZP_03058895.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli B171]
 gi|194431748|ref|ZP_03064039.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Shigella dysenteriae 1012]
 gi|209920413|ref|YP_002294497.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli SE11]
 gi|218696552|ref|YP_002404219.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli 55989]
 gi|260869641|ref|YP_003236043.1| dITP/XTP pyrophosphatase [Escherichia coli O111:H- str. 11128]
 gi|300815576|ref|ZP_07095800.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 107-1]
 gi|300824811|ref|ZP_07104915.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 119-7]
 gi|300906482|ref|ZP_07124177.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 84-1]
 gi|300921296|ref|ZP_07137665.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 115-1]
 gi|301306563|ref|ZP_07212625.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 124-1]
 gi|307310425|ref|ZP_07590073.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli W]
 gi|309794043|ref|ZP_07688468.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 145-7]
 gi|331669700|ref|ZP_08370546.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli TA271]
 gi|331678948|ref|ZP_08379622.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli H591]
 gi|157077734|gb|ABV17442.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli E24377A]
 gi|190902001|gb|EDV61747.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli B7A]
 gi|192930858|gb|EDV83463.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli E22]
 gi|194415648|gb|EDX31915.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli B171]
 gi|194420104|gb|EDX36182.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Shigella dysenteriae 1012]
 gi|195183147|dbj|BAG66692.1| putative ribosomal protein [Escherichia coli O111:H-]
 gi|209913672|dbj|BAG78746.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218353284|emb|CAU99247.1| dITP/XTP pyrophosphatase [Escherichia coli 55989]
 gi|257765997|dbj|BAI37492.1| dITP/XTP pyrophosphatase [Escherichia coli O111:H- str. 11128]
 gi|300401725|gb|EFJ85263.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 84-1]
 gi|300411758|gb|EFJ95068.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 115-1]
 gi|300522718|gb|EFK43787.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 119-7]
 gi|300531505|gb|EFK52567.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 107-1]
 gi|300838181|gb|EFK65941.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 124-1]
 gi|306909320|gb|EFN39815.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli W]
 gi|308122450|gb|EFO59712.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 145-7]
 gi|315062260|gb|ADT76587.1| dITP/XTP pyrophosphatase [Escherichia coli W]
 gi|315256846|gb|EFU36814.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 85-1]
 gi|320181041|gb|EFW55962.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           boydii ATCC 9905]
 gi|320202618|gb|EFW77188.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli EC4100B]
 gi|323162600|gb|EFZ48447.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli E128010]
 gi|323180414|gb|EFZ65966.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 1180]
 gi|323377156|gb|ADX49424.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli KO11]
 gi|324017227|gb|EGB86446.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 117-3]
 gi|331063368|gb|EGI35281.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli TA271]
 gi|331073778|gb|EGI45099.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli H591]
 gi|332087623|gb|EGI92750.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella dysenteriae 155-74]
          Length = 197

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR+    +GE   D+  +QK+   L+     D   R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARY----SGEDATDLKNLQKLLETLKD-VPDDQ--R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|260663403|ref|ZP_05864294.1| Ham1 family protein [Lactobacillus fermentum 28-3-CHN]
 gi|260552255|gb|EEX25307.1| Ham1 family protein [Lactobacillus fermentum 28-3-CHN]
          Length = 197

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 110/208 (52%), Gaps = 24/208 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +V+A++N  K  E   ++ P+GI   +  +       E GNSFEENA+ K+  A     +
Sbjct: 4   LVVATNNPGKAREFQEMLAPMGIEVKTLADFPPFPIVEDGNSFEENALKKAQAAVSALNL 63

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-AFRSA 127
           P ++DDSGL++D LDG+PGIHSAR+A    G+ +     QK    L +K A  P   R+A
Sbjct: 64  PVVADDSGLMVDALDGEPGIHSARYA----GDHNDAANNQK----LLAKLAGVPDEERTA 115

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           HF + +    P+G     +G+V+G I+    G  GFGYDP+F  +    + G +T+E+KN
Sbjct: 116 HFHTTIVGLKPNGAKLVANGQVNGHILHELTGTNGFGYDPLFYVDELATSMGNLTDEQKN 175

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFV 215
                           +SHR RA +  +
Sbjct: 176 A---------------ISHRGRALRALM 188


>gi|222528844|ref|YP_002572726.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor bescii DSM 6725]
 gi|222455691|gb|ACM59953.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor bescii DSM 6725]
          Length = 203

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 109/215 (50%), Gaps = 31/215 (14%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPL--GIMTTSALELNLIIPEETGNSFEENAMIK 58
           MRKL+     +A+ N  K  E+  LI      ++T +  + ++ I E+ G +FEENA+ K
Sbjct: 1   MRKLL-----VATKNEGKAKEIKQLIGSYFDDVVTLNDFDSSVNIIED-GRTFEENALKK 54

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSK 117
           +         P L+DDSGL +D L G+PG+ SAR+A E  T E      + +++N    K
Sbjct: 55  AKMIYTLYRQPTLADDSGLEVDALGGRPGVMSARYAGERATDEDRIKKLLDELKNVPEDK 114

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                  R A F+ VL      G +    G   G I + PRG+ GFGYDP+F P+G+D+T
Sbjct: 115 -------RGAQFVCVLVFIDQQGRIYQTKGICRGRIAFEPRGENGFGYDPVFVPDGFDKT 167

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           F E+    KN                +SHRA+AF+
Sbjct: 168 FAELDSHIKN---------------QISHRAKAFE 187


>gi|226942463|ref|YP_002797536.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Azotobacter vinelandii DJ]
 gi|226717390|gb|ACO76561.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Azotobacter vinelandii DJ]
          Length = 198

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 108/211 (51%), Gaps = 33/211 (15%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + +V+ASHN  K+ E+ +L+    +   S  E + + PEETG SF ENA++K+  AA+ +
Sbjct: 5   SQLVLASHNAGKLKELQALLGN-AVRVRSVGEFSDVAPEETGLSFVENAILKARHAARLS 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQ-KIENALRSKFAHDPAFR 125
           G+PAL+DDSGL +D L G PGIHSAR+A         D A   K+  ALR       A R
Sbjct: 64  GLPALADDSGLAVDALGGAPGIHSARYAGGGG-----DAANNAKLLEALREV---PDAER 115

Query: 126 SAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F+  L+L     H E+       G   G I+  PRG  GFGYDP+F       +  E
Sbjct: 116 GARFVCALALVR---HAEDPLPIICEGLWQGRILHAPRGTEGFGYDPLFWVPERGCSSAE 172

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
           +   EKN                LSHRARA 
Sbjct: 173 LASAEKN---------------RLSHRARAM 188


>gi|229198609|ref|ZP_04325311.1| Nucleoside-triphosphatase [Bacillus cereus m1293]
 gi|228584891|gb|EEK43007.1| Nucleoside-triphosphatase [Bacillus cereus m1293]
          Length = 205

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 111/212 (52%), Gaps = 30/212 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++         +D AF
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQEL---------NDVAF 115

Query: 125 --RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E
Sbjct: 116 EKRKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAE 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           ++ +EKN                +SHR RA +
Sbjct: 176 LSSDEKNA---------------ISHRGRALR 192


>gi|227514546|ref|ZP_03944595.1| nucleoside-triphosphatase [Lactobacillus fermentum ATCC 14931]
 gi|227087103|gb|EEI22415.1| nucleoside-triphosphatase [Lactobacillus fermentum ATCC 14931]
          Length = 203

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 110/208 (52%), Gaps = 24/208 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +V+A++N  K  E   ++ P+GI   +  +       E GNSFEENA+ K+  A     +
Sbjct: 10  LVVATNNPGKAREFQEMLAPMGIEVKTLADFPPFPIVEDGNSFEENALKKAQAAVSALNL 69

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-AFRSA 127
           P ++DDSGL++D LDG+PGIHSAR+A    G+ +     QK    L +K A  P   R+A
Sbjct: 70  PVVADDSGLMVDALDGEPGIHSARYA----GDHNDAANNQK----LLAKLAGVPDEERTA 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           HF + +    P+G     +G+V+G I+    G  GFGYDP+F  +    + G +T+E+KN
Sbjct: 122 HFHTTIVGLKPNGAKLVANGQVNGHILHELTGTNGFGYDPLFYVDELATSMGNLTDEQKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFV 215
                           +SHR RA +  +
Sbjct: 182 A---------------ISHRGRALRALM 194


>gi|138896230|ref|YP_001126683.1| nucleoside-triphosphatase [Geobacillus thermodenitrificans NG80-2]
 gi|134267743|gb|ABO67938.1| Nucleoside-triphosphatase [Geobacillus thermodenitrificans NG80-2]
          Length = 204

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 103/208 (49%), Gaps = 24/208 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             IVIA+ N  K+ E  ++    GI   S L+  ++   EETG++F ENA +K+    + 
Sbjct: 2   KEIVIATKNAGKVREFAAMFAKRGIEVKSLLDFPDVPDVEETGSTFVENAKLKAEAVCQR 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
              P ++DDSGL +D L G+PG+HSAR+A E     R+    +++++     K       
Sbjct: 62  LQRPVIADDSGLAVDALGGRPGVHSARYAGEDKNDARNIAKLLRELDGVPMEK------- 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P            G I   PRG+ GFGYDP+F      +T  E+T E
Sbjct: 115 RTARFHCALAVAIPGQPTAIVEATCDGYIAEAPRGEGGFGYDPVFYLPERGKTMAELTPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
           EKN                +SHRA+A +
Sbjct: 175 EKNA---------------ISHRAKALE 187


>gi|226360554|ref|YP_002778332.1| deoxyribonucleotide triphosphate pyrophosphatase [Rhodococcus
           opacus B4]
 gi|226239039|dbj|BAH49387.1| nucleoside-triphosphatase [Rhodococcus opacus B4]
          Length = 205

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 107/222 (48%), Gaps = 25/222 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPE--ETGNSFEENAMIKSLTA 62
             +++AS N  K+ E+  ++   G+     + L+ +   PE  ETG +FEENA+ K+   
Sbjct: 5   TRVLVASRNAKKLRELHRVLAAAGVDGIELVGLDAVPDYPEAPETGATFEENALAKARDG 64

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A   G+P ++DDSG+ +D L+G PGI SARW    +G    D A   +  A  +    D 
Sbjct: 65  AAATGLPCVADDSGIEVDALNGMPGILSARW----SGTHGNDPANTALVLAQLADVPED- 119

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F+S  +L  P G      G+  G +V  P G  GFGYDP+F P G  R+  +++
Sbjct: 120 -RRGAAFVSACALVVPGGEETVVRGEWRGSVVREPVGDGGFGYDPVFVPEGDTRSAAQLS 178

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
            EEK               D  SHR RA    V     + E+
Sbjct: 179 PEEK---------------DASSHRGRALIQLVPALAALSER 205


>gi|312622867|ref|YP_004024480.1| non-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203334|gb|ADQ46661.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 204

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 110/215 (51%), Gaps = 31/215 (14%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPL--GIMTTSALELNLIIPEETGNSFEENAMIK 58
           MRKL      +A+ N  K  E+  LI      ++T +  + ++ I E+ G +FEENA+ K
Sbjct: 1   MRKLF-----VATKNEGKAKEIKQLIGSYFDDVVTLNHFDSSINIIED-GRTFEENALKK 54

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSK 117
           + T         L+DDSGL +D L G+PG+ SAR+A E  T E      + ++++   SK
Sbjct: 55  AKTIYALYRQVTLADDSGLEVDALGGRPGVMSARYAGERATDEDRIKKLLDELKDVPESK 114

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                  R A F+ VL      G +    G   G I + PRG+ GFGYDPIF P+G+D+T
Sbjct: 115 -------RGAQFVCVLVFIDQQGRIYQTKGICRGRIAFEPRGKNGFGYDPIFVPDGFDKT 167

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           F E+  + KN                +SHRA+AF+
Sbjct: 168 FAELDSQIKN---------------QISHRAKAFE 187


>gi|315606170|ref|ZP_07881198.1| non-canonical purine NTP pyrophosphatase RdgB [Actinomyces sp. oral
           taxon 180 str. F0310]
 gi|315312128|gb|EFU60217.1| non-canonical purine NTP pyrophosphatase RdgB [Actinomyces sp. oral
           taxon 180 str. F0310]
          Length = 204

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 106/215 (49%), Gaps = 30/215 (13%)

Query: 8   NIVIASHNVDKIHEMDSLIMPL-------GIMTTSALELNLIIPEETGNSFEENAMIKSL 60
            +V A+ N  KI E+++++           I   SA ++    P E G +FEEN++IK+ 
Sbjct: 4   RLVFATSNAHKIFELEAILADAWRGFEAGCIAPMSAFDVPS--PVEDGVTFEENSLIKAR 61

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             A+  G+ A++DDSG+ +DVL G PGI SARW+      R  D A        +     
Sbjct: 62  ALARATGLAAIADDSGITVDVLGGAPGIFSARWS-----GRHGDDAANLSLLLDQLSDVP 116

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           DP  R A F+S   L  P G      G+V G +   P GQ GFGYDPIF P+GY  T  +
Sbjct: 117 DP-HRGAAFVSAAVLVTPGGEEVVRRGEVRGTLTREPIGQGGFGYDPIFIPDGYRVTTAQ 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           M+ +EKN                +SHR  AF+  +
Sbjct: 176 MSPQEKNA---------------ISHRGIAFRALM 195


>gi|295103255|emb|CBL00799.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Faecalibacterium prausnitzii SL3/3]
          Length = 211

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 108/218 (49%), Gaps = 35/218 (16%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAKNA 66
            I  A+ N  K+ E+  ++   G    S  EL + I PEETG +F ENA+IK+ T  K +
Sbjct: 2   KICAATGNAGKLRELRRILEAQGHEVVSQKELGITIEPEETGTTFAENALIKAETICKAS 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+P ++DDSGL +D LDG PG++SAR+   +    D +    K+  A+++  A     R 
Sbjct: 62  GLPTIADDSGLCVDALDGAPGVYSARYCGHHG---DDEANNDKLLAAMQAVPAGQ---RG 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPP-RGQLGFGYDPIF------------QPNG 173
           A F+S +    PDG      G+  G I +    G  GFGYDP+F            +PN 
Sbjct: 116 AKFVSAVCFILPDGRHLTCMGECPGSIAFTRLCGDYGFGYDPLFIPADCGVGKTDKRPNT 175

Query: 174 YDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
            +R++ ++T +EK               D +SHR  A 
Sbjct: 176 ENRSYAQLTPDEK---------------DAISHRGNAL 198


>gi|295133957|ref|YP_003584633.1| HAM1 protein [Zunongwangia profunda SM-A87]
 gi|294981972|gb|ADF52437.1| HAM1 protein [Zunongwangia profunda SM-A87]
          Length = 190

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 114/211 (54%), Gaps = 30/211 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           +V A+HN +K  E++++ +P  I   S  ++       ET ++ + NA++K+       G
Sbjct: 3   LVFATHNRNKFKEIEAM-LPDHISLLSLDDIGCTEDIAETADTIDGNAILKAEYVRHRYG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAFRS 126
               +DD+GL +D L G PG++SAR+A    G++  D A + K+   L+ K +     R 
Sbjct: 62  YNCFADDTGLEVDALAGAPGVYSARYA----GDQKDDKANVAKLLEQLKDKES-----RK 112

Query: 127 AHFISVLSLAWPDGHVEN-FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           AHF +V++L   +   EN F+G   G I+   RG+ GFGYDP+F PNGYDRTF EM  +E
Sbjct: 113 AHFKTVIALNLKNN--ENLFTGICEGKIIEERRGEKGFGYDPVFVPNGYDRTFAEMEMKE 170

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           K                 +SHR +AFK  +D
Sbjct: 171 KAE---------------ISHRGKAFKALID 186


>gi|147677127|ref|YP_001211342.1| nucleoside-triphosphatase [Pelotomaculum thermopropionicum SI]
 gi|146273224|dbj|BAF58973.1| xanthosine triphosphate pyrophosphatase [Pelotomaculum
           thermopropionicum SI]
          Length = 203

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 68/181 (37%), Positives = 95/181 (52%), Gaps = 7/181 (3%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNA 66
            +V+A+ N +KI EM  L+ P GI   S  +   I   EE G +F ENA+ K+    +  
Sbjct: 3   KLVLATRNKNKIKEMIELLAPSGIEALSLDQFPRIGRIEEDGRTFRENAVKKASAVCEQT 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           GM AL+DDSGL +D LDG PG+ S+R+A   + +R  +      E  L       P  R 
Sbjct: 63  GMMALADDSGLEVDCLDGAPGVFSSRFAGEGSDDRANN------EKLLELLTGVPPEQRR 116

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F  V+++A PDG V    G   G I    RG+ GFGYDP+F    + +T  E+  + K
Sbjct: 117 ARFRCVIAIAAPDGFVYTAEGTCEGYIAEELRGEGGFGYDPLFYLPEFGKTLAELDLKTK 176

Query: 187 N 187
           N
Sbjct: 177 N 177


>gi|74313511|ref|YP_311930.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           sonnei Ss046]
 gi|73856988|gb|AAZ89695.1| putative ribosomal protein [Shigella sonnei Ss046]
 gi|323167994|gb|EFZ53683.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella sonnei 53G]
          Length = 197

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARYAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQKNLQKLLETLKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|288819169|ref|YP_003433517.1| nucleoside-triphosphatase [Hydrogenobacter thermophilus TK-6]
 gi|288788569|dbj|BAI70316.1| nucleoside-triphosphatase [Hydrogenobacter thermophilus TK-6]
 gi|308752751|gb|ADO46234.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Hydrogenobacter thermophilus TK-6]
          Length = 204

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 109/211 (51%), Gaps = 21/211 (9%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +++A+ N  K+ EM  L+   GI     L    I  EE+G+SF ENA +K+    +  
Sbjct: 4   RKVLLATRNPGKVEEMRRLLEVYGIYVE--LPDKYIEVEESGSSFLENAYLKAQAYHREY 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRS--KFAHDPAF 124
            MP L+DDSGLVI  +DG PG+ S+R+ +   G ++ ++   K E  +R   +       
Sbjct: 62  LMPVLADDSGLVIPSIDGYPGVFSSRFYQHEYGGKE-EVVSDKDEANIRKVLRLMKGKQD 120

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           RSA F++ L L++ D       G+  G I+  PRG  GFGYDPIF+P G +++  ++  E
Sbjct: 121 RSAKFVAFLVLSFGDAGYWA-KGECRGKILEEPRGSGGFGYDPIFEPEGLEKSMAQLRPE 179

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           EK               D +SHR RA +  V
Sbjct: 180 EK---------------DAISHRGRAVRNLV 195


>gi|229175160|ref|ZP_04302676.1| Nucleoside-triphosphatase [Bacillus cereus MM3]
 gi|228608296|gb|EEK65602.1| Nucleoside-triphosphatase [Bacillus cereus MM3]
          Length = 205

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 108/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEIAFEK------- 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y R   E++
Sbjct: 118 RKARFYCALAVAFPEGDKKPVIVNGTCEGYILEQRRGENGFGYDPIFYVEEYKRAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|311741213|ref|ZP_07715037.1| nucleoside-triphosphatase [Corynebacterium pseudogenitalium ATCC
           33035]
 gi|311303383|gb|EFQ79462.1| nucleoside-triphosphatase [Corynebacterium pseudogenitalium ATCC
           33035]
          Length = 202

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 108/212 (50%), Gaps = 27/212 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE----ETGNSFEENAMIKSLTAAK 64
           I++AS+N  K+ E++ ++   GI       L+ + P     E G +F +NA+IK+   A 
Sbjct: 3   ILVASNNPKKLAELERILADAGIEGVELRPLSAVEPYPEPVEDGRTFADNALIKARAGAA 62

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-A 123
             G   ++DDSGL I+ L+G PG+ SARW    +G+   D A   +   + ++ A  P  
Sbjct: 63  ATGFATVADDSGLAIEELNGMPGVLSARW----SGQHGNDQANNDL---VLAQMADVPDE 115

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+SV +L  PDG      G+  G  +  PRG  GFGYDP+FQP G  R+  EM  
Sbjct: 116 RRAAAFVSVCALVTPDGAEHVAEGRWEGRFLREPRGDNGFGYDPLFQPEGESRSAAEMAP 175

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           EEKN                +SHR RA    V
Sbjct: 176 EEKNA---------------VSHRGRALSQLV 192


>gi|229032135|ref|ZP_04188112.1| Nucleoside-triphosphatase [Bacillus cereus AH1271]
 gi|228729191|gb|EEL80190.1| Nucleoside-triphosphatase [Bacillus cereus AH1271]
          Length = 205

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 108/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + +K 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSKQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEVAFDK------- 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEGDKKPVIVNGTCEGYILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|196039297|ref|ZP_03106603.1| HAM1 protein [Bacillus cereus NVH0597-99]
 gi|206969488|ref|ZP_03230442.1| HAM1 protein [Bacillus cereus AH1134]
 gi|196029924|gb|EDX68525.1| HAM1 protein [Bacillus cereus NVH0597-99]
 gi|206735176|gb|EDZ52344.1| HAM1 protein [Bacillus cereus AH1134]
          Length = 202

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 109/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 2   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 62  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEVAFEK------- 114

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y ++  E++
Sbjct: 115 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKSMAELS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 175 SDEKNA---------------ISHRGRALR 189


>gi|323341505|ref|ZP_08081746.1| ribonuclease PH/Ham1 protein [Lactobacillus ruminis ATCC 25644]
 gi|323091116|gb|EFZ33747.1| ribonuclease PH/Ham1 protein [Lactobacillus ruminis ATCC 25644]
          Length = 198

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 104/203 (51%), Gaps = 23/203 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE-ETGNSFEENAMIKSLTAAKNAG 67
           I+IA+ N  K  E   L  P GI   +  +LN  +   E G +F ENA+IK+ T      
Sbjct: 4   ILIATKNDGKAREYRKLFEPKGIEVITLKDLNEQVEIIENGRTFSENALIKAQTLTDKLN 63

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +P L+DDSGLV+D L+G PGI+SAR+A  +  E +    +++++     K       R+A
Sbjct: 64  IPVLADDSGLVVDALNGAPGIYSARYAGDHDDEANNKKLLEELKKVPDEK-------RTA 116

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           HF   +    PD      +G V G+I     G+ GFGYDP+F    + +TFGE+  EEKN
Sbjct: 117 HFHCSIVATAPDKTPLEANGDVYGLIAHEKHGEDGFGYDPLFYYPEFGKTFGEIGMEEKN 176

Query: 188 GGIDSATLFSILSTDLLSHRARA 210
                           +SHRA+A
Sbjct: 177 K---------------VSHRAKA 184


>gi|152987680|ref|YP_001345881.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Pseudomonas aeruginosa PA7]
 gi|150962838|gb|ABR84863.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Pseudomonas aeruginosa PA7]
          Length = 197

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 110/209 (52%), Gaps = 31/209 (14%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V+ASHN  K+ E+ +++    +   S  E + + PEETG SF ENA++K+  AA+ +G
Sbjct: 6   QLVLASHNAGKLKELQAMLGA-SVKVRSIGEFSQVEPEETGLSFVENAILKARNAARISG 64

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSGL +D L G PGI+SAR+A+      +    ++ +++          A R A
Sbjct: 65  LPALADDSGLAVDFLGGAPGIYSARYADGRGDAANNAKLLEALKDV-------PDAGRGA 117

Query: 128 HFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
            F+SVL+L     H ++       G   G I+   RG  GFGYDP+F     D +  E+ 
Sbjct: 118 QFVSVLALVR---HADDPLPILCEGIWEGRILREARGAHGFGYDPLFWVPERDCSSAELA 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAF 211
            EEKN                LSHRARA 
Sbjct: 175 PEEKN---------------RLSHRARAM 188


>gi|161509326|ref|YP_001574985.1| nucleoside-triphosphatase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|160368135|gb|ABX29106.1| possible HAM1 family protein [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
          Length = 195

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 104/179 (58%), Gaps = 11/179 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIAS+N  KI++   +     ++  S L  +  + EETG++FEENA++KS  AAK    
Sbjct: 4   IVIASNNQGKINDFKVIFPDYHVIGISELIPDFDV-EETGSTFEENAILKSEAAAKALNK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARW-AESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             ++DDSGL +  L+G+PGI+SAR+  E+ + E + +  + K+ N            R A
Sbjct: 63  TVIADDSGLEVFALNGEPGIYSARYDGENKSDEANIEKLLNKLGNTTD---------RRA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ PD   + F G VSG I     G+ GFGYDPIF     D+T  ++++E+K
Sbjct: 114 QFVCVISMSGPDMETKVFKGTVSGEIADGKYGENGFGYDPIFYVPKLDKTMAQLSKEQK 172


>gi|260654136|ref|ZP_05859626.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Jonquetella anthropi E3_33 E1]
 gi|260631121|gb|EEX49315.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Jonquetella anthropi E3_33 E1]
          Length = 203

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 104/208 (50%), Gaps = 29/208 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL--NLIIPEETGNSFEENAMIKSLTAAK 64
             +VIA+ N +K  E   L+ PLGI      +L  NL + EETG +F ENA +K+    +
Sbjct: 8   RQLVIATGNRNKFVEFQKLLAPLGITLLMGKDLCPNLEV-EETGETFLENARLKAQAWCE 66

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
              +PAL+DDSG+ +  L G+PG+ SAR+A ++           +    L  + A   A 
Sbjct: 67  RTNLPALADDSGIEVAALGGRPGVRSARYAPTDA----------ECRAKLLGELAG-VAD 115

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           RSA F + L L WPDG   +      G +     G+ GFGYD +F P G  +TF +MT E
Sbjct: 116 RSARFAAALVLCWPDGSEWSTLQYCDGSVTEQELGERGFGYDSLFLPLGETKTFAQMTME 175

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
           EK               D +SHR +A +
Sbjct: 176 EK---------------DAVSHRGKATR 188


>gi|227824542|ref|ZP_03989374.1| non-canonical purine NTP pyrophosphatase [Acidaminococcus sp. D21]
 gi|226905041|gb|EEH90959.1| non-canonical purine NTP pyrophosphatase [Acidaminococcus sp. D21]
          Length = 201

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 107/214 (50%), Gaps = 27/214 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             +VIA+HN  K+ E   L+  LG+      +  ++  PEETG +F  NA +K+   AK 
Sbjct: 7   QQVVIATHNQGKMEEFKVLLEALGLDFCCLNDFPDIPEPEETGKTFAANARLKATYYAKA 66

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            G   L+DDSGL +  L G PG+ SAR+A E  T E + ++ +  ++  +R         
Sbjct: 67  TGRMCLADDSGLEVLSLKGAPGVRSARYAGEEATDEENNELLLANMKMQVR--------- 117

Query: 125 RSAHFISVLSLAWPDGH-VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           R+  F   L++A P+G  V   SG   GI++  P G  GFGYDP+F      +  GE T 
Sbjct: 118 RNCRFFCALAVASPEGKIVVESSGICDGILLHEPHGTNGFGYDPLFWSTELHKPLGEATM 177

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           EEKNG               +SHRA+A K  V  
Sbjct: 178 EEKNG---------------ISHRAKAAKKLVSQ 196


>gi|260857087|ref|YP_003230978.1| dITP/XTP pyrophosphatase [Escherichia coli O26:H11 str. 11368]
 gi|257755736|dbj|BAI27238.1| dITP/XTP pyrophosphatase [Escherichia coli O26:H11 str. 11368]
          Length = 197

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR+    +GE   D+  +QK+   L+     D   R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARY----SGEDATDLKNLQKLLETLKD-VPDDQ--R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTHEEKSA---------------ISHRGQALKLLLD 192


>gi|197117593|ref|YP_002138020.1| nucleoside-triphosphatase [Geobacter bemidjiensis Bem]
 gi|197086953|gb|ACH38224.1| xanthosine/inosine triphosphate pyrophosphohydrolase [Geobacter
           bemidjiensis Bem]
          Length = 201

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 108/208 (51%), Gaps = 24/208 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             +++AS N  K+ E + L+  +     S  +   L   EE G+SFE NA+ K+ +AA  
Sbjct: 2   KELLVASGNKGKLREFEKLLEGVVETILSPADFPGLPEVEEDGDSFEANALKKARSAALF 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAF 124
            G P LSDDSGL +D L G+PG++SAR+A    G+   +   +Q++    R +       
Sbjct: 62  TGKPVLSDDSGLCVDHLGGRPGVYSARFAGEGAGDAANNARLLQEMAGVPREE------- 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+  F  V++L  PDG  + F G + G I+  PRG+ GFGYDP+F    + +TF E+  E
Sbjct: 115 RTGAFHCVIALCLPDGSCQTFDGMLKGEILDAPRGEGGFGYDPLFLVPEHGQTFSELPME 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
            KN                +SHR RA +
Sbjct: 175 IKN---------------TISHRGRAMQ 187


>gi|294812844|ref|ZP_06771487.1| Nucleoside-triphosphatase [Streptomyces clavuligerus ATCC 27064]
 gi|326441378|ref|ZP_08216112.1| dITP/XTP pyrophosphatase [Streptomyces clavuligerus ATCC 27064]
 gi|294325443|gb|EFG07086.1| Nucleoside-triphosphatase [Streptomyces clavuligerus ATCC 27064]
          Length = 200

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 113/213 (53%), Gaps = 26/213 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLI----MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
             IV+A+ N  KI E+  ++    +P  ++ T A   ++   +ETG +F ENA++K+ T 
Sbjct: 2   TRIVLATRNAGKITELRQILADARLPHELVGTDAYP-DIPDVKETGVTFAENALLKAHTL 60

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A+  G+PA++DDSGL +DVL G PGI SARWA    G    D A   +  A  S  A  P
Sbjct: 61  ARATGLPAIADDSGLCVDVLGGAPGIFSARWA----GAHGDDAANLALLLAQLSDIA--P 114

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F    +LA PDG      G++ G +   P G  GFGYDPI QP G  RT  E++
Sbjct: 115 EHRAAQFFCAAALALPDGTERVAEGRLLGTLRTTPTGTGGFGYDPILQPEGEARTAAELS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            EEKN                +SHR +AF+  V
Sbjct: 175 PEEKNA---------------ISHRGKAFRALV 192


>gi|332086883|gb|EGI92019.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella boydii 5216-82]
          Length = 197

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR+    +GE   D+  +QK+   L+     D   R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARY----SGEDATDLKNLQKLLETLKD-VPDDQ--R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLIYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|314933348|ref|ZP_07840713.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus caprae C87]
 gi|313653498|gb|EFS17255.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus caprae C87]
          Length = 195

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 102/180 (56%), Gaps = 11/180 (6%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +IVIA++N  KI++   +     ++  S L  N  + EETG++FEENA +KS  AAK   
Sbjct: 3   DIVIATNNKGKINDFKVIFKEDNVIGISELIPNFDV-EETGSTFEENAKLKSEAAAKALN 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAE-SNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
              ++DDSGL +  L+G+PG++SAR+A    + + + D  +  +EN          + R 
Sbjct: 62  KRVIADDSGLEVFALNGEPGVYSARYAGLDKSDDANIDKLLANLEN---------ESDRR 112

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+ V+S++ P    + F G VSG I    +G  GFGYDPIF      RT  E+T+EEK
Sbjct: 113 AQFVCVISMSAPGEETKTFKGTVSGEITHTRQGNHGFGYDPIFFVPDKKRTMAELTDEEK 172


>gi|282932657|ref|ZP_06338071.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Lactobacillus jensenii 208-1]
 gi|297205619|ref|ZP_06923015.1| nucleoside-triphosphatase [Lactobacillus jensenii JV-V16]
 gi|281303231|gb|EFA95419.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Lactobacillus jensenii 208-1]
 gi|297150197|gb|EFH30494.1| nucleoside-triphosphatase [Lactobacillus jensenii JV-V16]
          Length = 205

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 114/216 (52%), Gaps = 32/216 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMPLG----IMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++ A++N +K+ E+ +     G    I T + LE    +  E G++FEENA +K+ T A+
Sbjct: 5   LLFATNNQNKVKELKAAFQKAGLDIEIKTNADLEAAPHV-SENGSTFEENATLKAHTLAE 63

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARW-AESNTGERDFDMAMQKIENALRSKFAHDPA 123
            + +P LSDDSGLV+D L+G PG+HSAR+  E++   R+    +  +      +      
Sbjct: 64  FSKLPTLSDDSGLVVDKLNGAPGVHSARYGGEAHNDARNNAKLLASLGGIPEEE------ 117

Query: 124 FRSAHFISVLSLAWPDGHVEN---FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            RSA F S   L+ P GH +     +G+  G+++  PRG  GFGYDP+F      +TF E
Sbjct: 118 -RSAKFCSTFVLSMP-GHFDKDLVVTGECEGVVLAIPRGHDGFGYDPLFYVPEKGKTFAE 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           MT +EKN                +SHR +A K  V+
Sbjct: 176 MTTDEKNE---------------VSHRGKALKQLVE 196


>gi|295396714|ref|ZP_06806860.1| nucleoside-triphosphatase [Brevibacterium mcbrellneri ATCC 49030]
 gi|294970460|gb|EFG46389.1| nucleoside-triphosphatase [Brevibacterium mcbrellneri ATCC 49030]
          Length = 196

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 117/212 (55%), Gaps = 32/212 (15%)

Query: 10  VIASHNVDKIHEMDSL---IMPLG-IMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
           V+A+HN  K  E+ ++   ++P   ++T   L L  ++ +E   +FEENA+IK+   A+ 
Sbjct: 5   VLATHNAGKKVELQAILSQVIPTAEVVTAGELGLADVVEDEL--TFEENALIKARAVAEE 62

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-AF 124
            G+PA++DDSGLV+DVL   PGI SARWA    GE   D A  ++   L ++ +  P   
Sbjct: 63  TGLPAIADDSGLVVDVLGSAPGILSARWA----GEHGDDRANLEL---LLAQLSDIPDRG 115

Query: 125 RSAHFISVLSLAWPDGHVENF-SGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           R A F  V + A+ +   E   +G++ G I+  P G  GFGYDPIFQP+G + +  +++ 
Sbjct: 116 RGARF--VCAAAYVNAGAEVVCTGEMRGTILREPVGDGGFGYDPIFQPDGENVSAAQLSS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           EEKN                +SHR +A +  V
Sbjct: 174 EEKNA---------------ISHRGKALRKLV 190


>gi|325285238|ref|YP_004261028.1| Nucleoside-triphosphatase rdgB [Cellulophaga lytica DSM 7489]
 gi|324320692|gb|ADY28157.1| Nucleoside-triphosphatase rdgB [Cellulophaga lytica DSM 7489]
          Length = 194

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 111/209 (53%), Gaps = 28/209 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLTAAKNA 66
           IV A+HN +K  E+ +L+ P  I   S  ++     IPE T ++ E NA+ K+    +  
Sbjct: 3   IVFATHNTNKFKEVKALV-PTTITLVSLTDIGCFDDIPE-TADTIEGNAIQKASYVTEKY 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +P  SDD+GL+++ L+G+PGI++AR+A       D +MA       L  K   +P  R 
Sbjct: 61  NLPCFSDDTGLLVNALNGEPGIYAARYAGEQKSAED-NMA------KLLHKLGDNPN-RE 112

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           AHF +V++L   +G    F+G V+G+I    +G  GFGYDPIF P GY +TF ++    K
Sbjct: 113 AHFKTVIALHI-NGEQHIFTGVVNGVITKGKQGTDGFGYDPIFTPEGYSQTFAQLPLNTK 171

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFV 215
           N                +SHRA+A +  +
Sbjct: 172 NK---------------ISHRAKATQQLI 185


>gi|311693172|gb|ADP96045.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [marine
           bacterium HP15]
          Length = 199

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 112/219 (51%), Gaps = 31/219 (14%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           + N +VIAS+N  KI E+  L+ PLG+   +  +L +   EE   +F ENA++K+  AA+
Sbjct: 1   MTNRLVIASNNRGKIAELTELLAPLGMTPIAQGDLGVGEAEEPAVTFVENAILKARHAAR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-A 123
             G+PAL+DDSGL +D L+G+PG+ SAR+A  +  ++D         +AL    A  P  
Sbjct: 61  ETGLPALADDSGLAVDALEGRPGVRSARFAGDDATDQDN-------VDALLDAMAGVPDG 113

Query: 124 FRSAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
            R A F  VL       H E+ +     G+  G I+  P+G  GFGYDP+F    +  + 
Sbjct: 114 QRGAQFHCVLVYLR---HAEDPTPIICHGRWPGSILRSPQGDGGFGYDPVFLAPEHGCSA 170

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
            E++  EK                 +SHR RA K  +D 
Sbjct: 171 AELSRAEKGS---------------ISHRGRALKILLDQ 194


>gi|164686704|ref|ZP_02210732.1| hypothetical protein CLOBAR_00299 [Clostridium bartlettii DSM
           16795]
 gi|164604094|gb|EDQ97559.1| hypothetical protein CLOBAR_00299 [Clostridium bartlettii DSM
           16795]
          Length = 449

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 108/209 (51%), Gaps = 25/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPL--GIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           N++VIA+ N  K+ E+  ++  L   I +   ++L  +  EE G +FE NA+IK+   AK
Sbjct: 251 NDVVIATGNAHKLEEIGDILKDLDYNIYSLKDVDLGGLEIEENGKTFEHNALIKAREVAK 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPA 123
              M  ++DDSGL +D +  KPGI+SAR+A E+ T E +    ++ + N   S+      
Sbjct: 311 RTKMITIADDSGLEVDAIGKKPGIYSARYAGENATDEENRAKLLKSLGNTPMSQ------ 364

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+  +++ +PDG      G   G I +  +G  GFGYD +F  N YD+TF E+  
Sbjct: 365 -RGARFVCCIAVVFPDGKEFVVRGTCEGTIGFEEKGSNGFGYDNLFIVNKYDKTFAELPA 423

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
             KN                +SHRA A +
Sbjct: 424 TIKNA---------------ISHRANALQ 437


>gi|254303318|ref|ZP_04970676.1| tRNA nucleotidyltransferase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148323510|gb|EDK88760.1| tRNA nucleotidyltransferase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 434

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 112/215 (52%), Gaps = 27/215 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           I +A+ N  KI E+  +   +  +   +++  + IPE  E G +FE+N+  K++  AK  
Sbjct: 244 IFLATANKHKIDEISDIFSGIKNIKILSIKDGIEIPEVIEDGKTFEDNSKKKAVEIAKFL 303

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            M  ++DDSGL +D L+G+PG++SAR+  S TG+ D     + IEN            R 
Sbjct: 304 NMITIADDSGLCVDALNGEPGVYSARY--SGTGD-DLKNNEKLIENL------KGVENRK 354

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+SV++LA P+G   +F G++ G I+  P+G  GFGYDP F    Y +T  E+ E + 
Sbjct: 355 AKFVSVITLAKPNGETYSFRGEIEGKIIDIPKGNTGFGYDPYFYVEEYQKTLAELPELKN 414

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
                            +SHRA+A +   +N   I
Sbjct: 415 K----------------ISHRAKALEKLKENLKNI 433


>gi|330722153|gb|EGH00055.1| Nucleoside 5-triphosphatase RdgB (dHAPTP2C dITP2C XTP-specific)
           [gamma proteobacterium IMCC2047]
          Length = 203

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 107/215 (49%), Gaps = 29/215 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+AS N  K+ E+  ++  L +      E N+   +ETG SF ENA+IK+  AA+ +
Sbjct: 2   QKIVLASSNQGKLREIQQVLAHLDMQLVPQSEFNVSDADETGLSFVENAIIKARHAARTS 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +D L GKPGI+SAR+A    GE+  D     I+  L      D   RS
Sbjct: 62  GLPALADDSGLEVDALQGKPGIYSARFA----GEKATD--GDNIQKLLSELEGVDSPQRS 115

Query: 127 AHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  VL       H ++ S     G   G I+   RGQ GFGYDP+F    + R   E+
Sbjct: 116 ARFRCVLVYMR---HADDPSPIIAEGSWEGFILDEQRGQNGFGYDPVFYIPEHQRAAAEL 172

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
             E KN                 SHRARA    V+
Sbjct: 173 EPEVKNQH---------------SHRARALAQLVE 192


>gi|260584033|ref|ZP_05851781.1| glutamate racemase [Granulicatella elegans ATCC 700633]
 gi|260158659|gb|EEW93727.1| glutamate racemase [Granulicatella elegans ATCC 700633]
          Length = 480

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 110/219 (50%), Gaps = 34/219 (15%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE-----ETGNSFEENAMIKSL 60
           +  +VIA+ N  K  E  S+  P G    + L+     PE     ETG +FEENA +K+ 
Sbjct: 279 QKELVIATKNAGKAKEFASIFEPKGYSVKTLLDF----PELEDVAETGQTFEENARLKAE 334

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA-LRSKFA 119
           T A+      L+DDSGL +D L+G+PG++SAR+A    G +  D A     NA L ++  
Sbjct: 335 TIAERLQKIVLADDSGLCVDALEGQPGVYSARYA----GNQKSDAA----NNAKLLAELG 386

Query: 120 HDPA-FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
             P+  RSAHF   L +A P+       G   G I   P G+ GFGYDP+F      +TF
Sbjct: 387 ELPSDKRSAHFHCCLVMAAPNHESLVVEGICDGEIAKFPSGEGGFGYDPLFFVPEIQKTF 446

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           G+++ EEKN                +SHRA+A    V+ 
Sbjct: 447 GQLSREEKNQ---------------ISHRAKAVNLLVEQ 470


>gi|228999268|ref|ZP_04158848.1| Nucleoside-triphosphatase [Bacillus mycoides Rock3-17]
 gi|229006823|ref|ZP_04164456.1| Nucleoside-triphosphatase [Bacillus mycoides Rock1-4]
 gi|228754445|gb|EEM03857.1| Nucleoside-triphosphatase [Bacillus mycoides Rock1-4]
 gi|228760465|gb|EEM09431.1| Nucleoside-triphosphatase [Bacillus mycoides Rock3-17]
          Length = 206

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 107/208 (51%), Gaps = 24/208 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNA 66
           ++V+A+ N+ K+ E   L     +   S  +  N+   EETG +FEENA++K+ +  K  
Sbjct: 6   HVVVATKNMGKVREFAELFERFDLEVKSLHDFPNIEEVEETGETFEENALLKADSLCKQL 65

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
               ++DDSGL++D L+G PG+ SAR+A    GE+  D A   I+  L          R+
Sbjct: 66  NSIVIADDSGLIVDALNGNPGVRSARYA----GEQKDDQA--NIDKVLTGLDGVSMEKRT 119

Query: 127 AHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           A F   L++A+P+ + E    +G   G I+   RG+ GFGYDPIF    Y R   E+T +
Sbjct: 120 ARFYCALAVAFPEENKEAVIVNGTCEGKILEQRRGENGFGYDPIFYVEEYKRAMAELTSD 179

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
           EKN                +SHR RA +
Sbjct: 180 EKNE---------------ISHRGRALR 192


>gi|311745421|ref|ZP_07719206.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Algoriphagus sp. PR1]
 gi|311302382|gb|EAZ82191.2| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Algoriphagus sp. PR1]
          Length = 192

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 114/212 (53%), Gaps = 29/212 (13%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLTAAKN 65
            I  A++N  KI E+ + ++   I   S  E+     IPE TG++ E NA  K+    ++
Sbjct: 2   KICFATNNQKKIAEVQAALVDTNISILSLEEIGCKEEIPE-TGDTLEHNAFQKAEYVKEH 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            G+   +DD+GL ++ L+G+PG++S R+A E  + +R+ D+ ++K+          D + 
Sbjct: 61  YGVDCFADDTGLEVEALEGEPGVYSGRYAGEPRSDQRNMDLLLKKL---------GDSSD 111

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F +V++L   DG    F G   G I+    G+ GFGYDPIF P+G+DRTF +++ E
Sbjct: 112 RKAKFKTVIAL-LIDGEKYKFEGVAEGEILKERTGEGGFGYDPIFLPSGFDRTFAQLSME 170

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           EKN                +SHR +A +  ++
Sbjct: 171 EKNE---------------ISHRGKAVRQLIN 187


>gi|329728750|gb|EGG65171.1| non-canonical purine NTP pyrophosphatase RdgB [Staphylococcus
           aureus subsp. aureus 21193]
          Length = 195

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 104/179 (58%), Gaps = 11/179 (6%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IVIAS+N  KI++   +     ++  S L  +  + EETG +FEENA++KS  AAK    
Sbjct: 4   IVIASNNQGKINDFKVIFPDYHVIGISELIPDFDV-EETGLTFEENAILKSEAAAKALNK 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             ++DDSGL +  L+G+PGI+SAR+A E+ + E + +  + K+ N            R A
Sbjct: 63  TVIADDSGLEVFALNGEPGIYSARYAGENKSDEANIEKLLNKLGNTTD---------RRA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ PD   + F G VSG I     G+ GFGYDPIF     D+T  ++++E+K
Sbjct: 114 QFVCVISMSGPDMETKVFKGTVSGEIADGKYGENGFGYDPIFYVPKLDKTMAQLSKEQK 172


>gi|146284285|ref|YP_001174438.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Pseudomonas stutzeri A1501]
 gi|145572490|gb|ABP81596.1| Ham1-like protein [Pseudomonas stutzeri A1501]
 gi|327482668|gb|AEA85978.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Pseudomonas stutzeri DSM 4166]
          Length = 197

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 110/210 (52%), Gaps = 31/210 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + +V+ASHN  K+ E+ +++    +   S  E + + PEETG SF ENA++K+  AA+ +
Sbjct: 5   SELVLASHNAGKLKELQAMLGD-AVRVRSVAEFSTVEPEETGLSFIENAILKARNAARIS 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +D L G PGI+SAR+A+      +    +Q + +   ++       R 
Sbjct: 64  GLPALADDSGLAVDALGGAPGIYSARYADGQGDAANNAKLLQVLRDVPDAE-------RG 116

Query: 127 AHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F+  L+L     H ++       G   G I+  PRG+ GFGYDP+F     D +  E+
Sbjct: 117 AQFVCALALVR---HADDPLPIICEGLWHGRILHAPRGEHGFGYDPLFWVPECDCSSAEL 173

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAF 211
              +KN                LSHRARA 
Sbjct: 174 PAAQKNQ---------------LSHRARAM 188


>gi|299822586|ref|ZP_07054472.1| nucleoside-triphosphatase [Listeria grayi DSM 20601]
 gi|299816115|gb|EFI83353.1| nucleoside-triphosphatase [Listeria grayi DSM 20601]
          Length = 201

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 101/198 (51%), Gaps = 7/198 (3%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +VIA+ N  K  E  +L     +   + L+   I   EETG +F ENA +K+ T A  
Sbjct: 2   KTLVIATANKGKAQEFQALFADYPVTIKTLLDFPEIGEIEETGTTFAENAALKAETVANL 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +P L+DDSGL++D LDG PG++SAR+A    G+   D    K      +   ++   R
Sbjct: 62  LNIPVLADDSGLIVDYLDGAPGVYSARYA----GDGHDDKKNNKKLLKNLTGVPYEQ--R 115

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F   L++A P      +SG+VSG I    RG  GFGYDP+F    Y +T  E+   E
Sbjct: 116 TARFHCTLAIAVPQQQTIFYSGEVSGYITEEERGASGFGYDPLFYLPNYQKTMAEIAASE 175

Query: 186 KNGGIDSATLFSILSTDL 203
           KN     A   + L+ D+
Sbjct: 176 KNKISHRANALAKLAKDI 193


>gi|24114209|ref|NP_708719.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           flexneri 2a str. 301]
 gi|30064270|ref|NP_838441.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           flexneri 2a str. 2457T]
 gi|82545423|ref|YP_409370.1| deoxyribonucleotide triphosphate pyrophosphatase [Shigella boydii
           Sb227]
 gi|110806862|ref|YP_690382.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           flexneri 5 str. 8401]
 gi|157162415|ref|YP_001459733.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli HS]
 gi|170018805|ref|YP_001723759.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli ATCC 8739]
 gi|187730440|ref|YP_001881727.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           boydii CDC 3083-94]
 gi|193067450|ref|ZP_03048418.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli E110019]
 gi|254038004|ref|ZP_04872062.1| non-canonical purine NTP pyrophosphatase [Escherichia sp. 1_1_43]
 gi|256019244|ref|ZP_05433109.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           sp. D9]
 gi|260845624|ref|YP_003223402.1| dITP/XTP pyrophosphatase [Escherichia coli O103:H2 str. 12009]
 gi|301328108|ref|ZP_07221249.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 78-1]
 gi|312972804|ref|ZP_07786977.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 1827-70]
 gi|332280352|ref|ZP_08392765.1| nucleoside-triphosphatase rdgB [Shigella sp. D9]
 gi|62900276|sp|Q83JS0|RDGB_SHIFL RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|24053356|gb|AAN44426.1| putative ribosomal protein [Shigella flexneri 2a str. 301]
 gi|30042527|gb|AAP18251.1| putative ribosomal protein [Shigella flexneri 2a str. 2457T]
 gi|81246834|gb|ABB67542.1| putative ribosomal protein [Shigella boydii Sb227]
 gi|110616410|gb|ABF05077.1| putative ribosomal protein [Shigella flexneri 5 str. 8401]
 gi|157068095|gb|ABV07350.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli HS]
 gi|169753733|gb|ACA76432.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli ATCC 8739]
 gi|187427432|gb|ACD06706.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Shigella boydii CDC 3083-94]
 gi|192959407|gb|EDV89842.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli E110019]
 gi|226839628|gb|EEH71649.1| non-canonical purine NTP pyrophosphatase [Escherichia sp. 1_1_43]
 gi|257760771|dbj|BAI32268.1| dITP/XTP pyrophosphatase [Escherichia coli O103:H2 str. 12009]
 gi|281602290|gb|ADA75274.1| Nucleoside-triphosphatase rdgB [Shigella flexneri 2002017]
 gi|300845412|gb|EFK73172.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 78-1]
 gi|310332746|gb|EFP99959.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 1827-70]
 gi|313648004|gb|EFS12450.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri 2a str. 2457T]
 gi|320174050|gb|EFW49220.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           dysenteriae CDC 74-1112]
 gi|320184301|gb|EFW59113.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           flexneri CDC 796-83]
 gi|323173832|gb|EFZ59461.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli LT-68]
 gi|323941960|gb|EGB38139.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli E482]
 gi|332091347|gb|EGI96435.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella boydii 3594-74]
 gi|332102704|gb|EGJ06050.1| nucleoside-triphosphatase rdgB [Shigella sp. D9]
 gi|332344854|gb|AEE58188.1| non-canonical purine NTP pyrophosphatase RdgB [Escherichia coli
           UMNK88]
 gi|332752997|gb|EGJ83381.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri 4343-70]
 gi|332753798|gb|EGJ84177.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri K-671]
 gi|332754579|gb|EGJ84945.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri 2747-71]
 gi|332765371|gb|EGJ95589.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri 2930-71]
 gi|332999874|gb|EGK19457.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri K-218]
 gi|333000456|gb|EGK20037.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri K-272]
 gi|333015149|gb|EGK34492.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri K-304]
 gi|333015294|gb|EGK34636.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri K-227]
          Length = 197

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQKNLQKLLETLKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|251794009|ref|YP_003008741.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Aggregatibacter aphrophilus NJ8700]
 gi|247535408|gb|ACS98654.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Aggregatibacter aphrophilus NJ8700]
          Length = 223

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 111/213 (52%), Gaps = 23/213 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R  ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  
Sbjct: 22  RAKMKQKIVLATGNKGKVKEMADVLSDFGFEVVAQTDLGIDSPEETGLTFVENAILKARY 81

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+ +G+PA++DDSGLV+D L+G PG++SAR+A       D + A  K    L ++ A+ 
Sbjct: 82  AAEKSGLPAIADDSGLVVDALNGAPGLYSARYAGV-----DGEQADAKNREKLLAELANV 136

Query: 122 PA-FRSAHFISVLSLAW--PDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
           PA  R A F+S + L     D       G+  G+I +  +G  GFGYD +F       TF
Sbjct: 137 PAEQRKAKFVSTIVLLQHPTDPSPIIAQGECHGVIAFEEKGDNGFGYDSLFFSPETGCTF 196

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
            E+   EK                 +SHRARA 
Sbjct: 197 AELETVEKKK---------------ISHRARAL 214


>gi|228923233|ref|ZP_04086523.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228836439|gb|EEM81790.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 205

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 108/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + +K 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIDEVEETGETFEENAILKADSLSKQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKNDQANIDKVLQELNGIEFEK------- 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|116493004|ref|YP_804739.1| xanthosine triphosphate pyrophosphatase [Pediococcus pentosaceus
           ATCC 25745]
 gi|116103154|gb|ABJ68297.1| Xanthosine triphosphate pyrophosphatase [Pediococcus pentosaceus
           ATCC 25745]
          Length = 198

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 101/184 (54%), Gaps = 8/184 (4%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAA 63
           + N I+IA+ N  K+ E   +    GI+  S  ++N  +   E G SFEENA +K+   A
Sbjct: 1   MNNEILIATKNDGKLKEFKQIFEQKGIVVKSLKDINDDVEIVENGLSFEENARLKADGYA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K+ G+P L+DDSGL ID L+G+PGI SAR+A  +    +    + ++      K      
Sbjct: 61  KSIGIPVLADDSGLEIDALNGRPGIFSARYAGDHNDAANNAKVLSELGGIPDEK------ 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F S + +  PDG     +G + G I+  PRG  GFGYDP+F     ++T  EMT 
Sbjct: 115 -RTATFHSTVVVRKPDGSELVANGNLRGRILAVPRGDNGFGYDPLFFVEAKNKTLAEMTR 173

Query: 184 EEKN 187
           EEKN
Sbjct: 174 EEKN 177


>gi|332999701|gb|EGK19286.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri VA-6]
          Length = 197

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQKNLQKLLETLKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITHEPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|15595584|ref|NP_249078.1| deoxyribonucleotide triphosphate pyrophosphatase [Pseudomonas
           aeruginosa PAO1]
 gi|107099372|ref|ZP_01363290.1| hypothetical protein PaerPA_01000384 [Pseudomonas aeruginosa PACS2]
 gi|116054117|ref|YP_788560.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218889128|ref|YP_002437992.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Pseudomonas aeruginosa LESB58]
 gi|254237378|ref|ZP_04930701.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254243486|ref|ZP_04936808.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296386885|ref|ZP_06876384.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Pseudomonas aeruginosa PAb1]
 gi|313111994|ref|ZP_07797781.1| putative Ham1 protein [Pseudomonas aeruginosa 39016]
 gi|22653774|sp|Q9I6A8|NTPA_PSEAE RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|9946240|gb|AAG03776.1|AE004476_6 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115589338|gb|ABJ15353.1| putative Ham1 protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169309|gb|EAZ54820.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126196864|gb|EAZ60927.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218769351|emb|CAW25111.1| putative Ham1 protein [Pseudomonas aeruginosa LESB58]
 gi|310884283|gb|EFQ42877.1| putative Ham1 protein [Pseudomonas aeruginosa 39016]
          Length = 197

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 110/209 (52%), Gaps = 31/209 (14%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V+ASHN  K+ E+ +++    +   S  E + + PEETG SF ENA++K+  AA+ +G
Sbjct: 6   QLVLASHNAGKLKELQAMLGA-SVKVRSIGEFSQVEPEETGLSFVENAILKARNAARLSG 64

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSGL +D L G PGI+SAR+A+      +    ++ +++          A R A
Sbjct: 65  LPALADDSGLAVDFLGGAPGIYSARYADGRGDAANNAKLLEAMKDV-------PDAERGA 117

Query: 128 HFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
            F+SVL+L     H ++       G   G I+   RG  GFGYDP+F     D +  E+ 
Sbjct: 118 QFVSVLALVR---HADDPLPILCEGIWEGRILREARGAHGFGYDPLFWVPERDCSSAELA 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAF 211
            EEKN                LSHRARA 
Sbjct: 175 PEEKN---------------RLSHRARAM 188


>gi|225575047|ref|ZP_03783657.1| hypothetical protein RUMHYD_03129 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037717|gb|EEG47963.1| hypothetical protein RUMHYD_03129 [Blautia hydrogenotrophica DSM
           10507]
          Length = 201

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 109/192 (56%), Gaps = 17/192 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGI----MTTSALELNLIIPEETGNSFEENAMI 57
           R+ +   I+ A+ N  K+ E+  ++  L +    +  + ++ +++   E G+SFEENA+I
Sbjct: 4   RRRLMKRIIFATGNEGKMREIRRIMEDLDVEIFSLKEAGIQADIV---EDGSSFEENAVI 60

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA-LRS 116
           K+ T  +      L+DDSGL ID L+G+PGI+SAR+   +T  R        I+N  L  
Sbjct: 61  KAKTVCELTNEVVLADDSGLEIDYLNGEPGIYSARYMGEDTSYR--------IKNQNLID 112

Query: 117 KFAHDPA-FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYD 175
           + A  P   R+A F+  ++ A+PDG V+   G + GII +  RG+ GFGYDPIF    Y 
Sbjct: 113 RLAGVPQEKRTARFVCAVAAAYPDGTVKTARGTMEGIIGYEERGENGFGYDPIFFLPEYG 172

Query: 176 RTFGEMTEEEKN 187
            +  E++ EEKN
Sbjct: 173 CSSAELSMEEKN 184


>gi|30264549|ref|NP_846926.1| HAM1 protein [Bacillus anthracis str. Ames]
 gi|47530014|ref|YP_021363.1| HAM1 protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|165871479|ref|ZP_02216126.1| HAM1 protein [Bacillus anthracis str. A0488]
 gi|167641653|ref|ZP_02399898.1| HAM1 protein [Bacillus anthracis str. A0193]
 gi|170688227|ref|ZP_02879437.1| HAM1 protein [Bacillus anthracis str. A0465]
 gi|170708322|ref|ZP_02898766.1| HAM1 protein [Bacillus anthracis str. A0389]
 gi|177653115|ref|ZP_02935402.1| HAM1 protein [Bacillus anthracis str. A0174]
 gi|190567018|ref|ZP_03019934.1| HAM1 protein [Bacillus anthracis Tsiankovskii-I]
 gi|196034477|ref|ZP_03101886.1| HAM1 protein [Bacillus cereus W]
 gi|196044744|ref|ZP_03111978.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacillus cereus 03BB108]
 gi|218905682|ref|YP_002453516.1| HAM1 protein [Bacillus cereus AH820]
 gi|225866463|ref|YP_002751841.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacillus cereus 03BB102]
 gi|227817260|ref|YP_002817269.1| HAM1 protein [Bacillus anthracis str. CDC 684]
 gi|229602874|ref|YP_002868763.1| HAM1 protein [Bacillus anthracis str. A0248]
 gi|254687031|ref|ZP_05150889.1| hypothetical protein BantC_24769 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254724593|ref|ZP_05186376.1| hypothetical protein BantA1_19340 [Bacillus anthracis str. A1055]
 gi|254736583|ref|ZP_05194289.1| hypothetical protein BantWNA_15581 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254741621|ref|ZP_05199308.1| hypothetical protein BantKB_11517 [Bacillus anthracis str. Kruger
           B]
 gi|254754781|ref|ZP_05206816.1| hypothetical protein BantV_20032 [Bacillus anthracis str. Vollum]
 gi|254757613|ref|ZP_05209640.1| hypothetical protein BantA9_04821 [Bacillus anthracis str.
           Australia 94]
 gi|62900270|sp|Q81LB0|NTPA_BACAN RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|30259207|gb|AAP28412.1| HAM1 protein [Bacillus anthracis str. Ames]
 gi|47505162|gb|AAT33838.1| HAM1 protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|107124176|gb|ABF83611.1| HAM1 protein [Bacillus thuringiensis serovar kurstaki]
 gi|164712776|gb|EDR18306.1| HAM1 protein [Bacillus anthracis str. A0488]
 gi|167510360|gb|EDR85761.1| HAM1 protein [Bacillus anthracis str. A0193]
 gi|170126697|gb|EDS95580.1| HAM1 protein [Bacillus anthracis str. A0389]
 gi|170667733|gb|EDT18486.1| HAM1 protein [Bacillus anthracis str. A0465]
 gi|172081639|gb|EDT66710.1| HAM1 protein [Bacillus anthracis str. A0174]
 gi|190562009|gb|EDV15978.1| HAM1 protein [Bacillus anthracis Tsiankovskii-I]
 gi|195993019|gb|EDX56978.1| HAM1 protein [Bacillus cereus W]
 gi|196024232|gb|EDX62905.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacillus cereus 03BB108]
 gi|218538680|gb|ACK91078.1| HAM1 protein [Bacillus cereus AH820]
 gi|225790087|gb|ACO30304.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacillus cereus 03BB102]
 gi|227004867|gb|ACP14610.1| HAM1 protein [Bacillus anthracis str. CDC 684]
 gi|229267282|gb|ACQ48919.1| HAM1 protein [Bacillus anthracis str. A0248]
          Length = 202

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 108/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 2   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 62  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEVAFEK------- 114

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 115 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 175 SDEKNA---------------ISHRGRALR 189


>gi|228954762|ref|ZP_04116784.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228804960|gb|EEM51557.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
          Length = 205

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 108/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEVAFEK------- 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|49187371|ref|YP_030623.1| nucleoside-triphosphatase [Bacillus anthracis str. Sterne]
 gi|49481509|ref|YP_038533.1| nucleoside-triphosphatase [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|52141016|ref|YP_085812.1| hypothetical protein BCZK4233 [Bacillus cereus E33L]
 gi|65321847|ref|ZP_00394806.1| COG0127: Xanthosine triphosphate pyrophosphatase [Bacillus
           anthracis str. A2012]
 gi|118479645|ref|YP_896796.1| nucleoside-triphosphatase [Bacillus thuringiensis str. Al Hakam]
 gi|228917118|ref|ZP_04080676.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228929527|ref|ZP_04092546.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935799|ref|ZP_04098611.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228948204|ref|ZP_04110488.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228987731|ref|ZP_04147842.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229093576|ref|ZP_04224677.1| Nucleoside-triphosphatase [Bacillus cereus Rock3-42]
 gi|229124020|ref|ZP_04253212.1| Nucleoside-triphosphatase [Bacillus cereus 95/8201]
 gi|229186722|ref|ZP_04313880.1| Nucleoside-triphosphatase [Bacillus cereus BGSC 6E1]
 gi|62900187|sp|Q633V5|NTPA_BACCZ RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|62900224|sp|Q6HD43|NTPA_BACHK RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|49181298|gb|AAT56674.1| HAM1 protein [Bacillus anthracis str. Sterne]
 gi|49333065|gb|AAT63711.1| conserved hypothetical protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|51974485|gb|AAU16035.1| conserved hypothetical protein [Bacillus cereus E33L]
 gi|118418870|gb|ABK87289.1| conserved hypothetical protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|228596735|gb|EEK54397.1| Nucleoside-triphosphatase [Bacillus cereus BGSC 6E1]
 gi|228659322|gb|EEL14970.1| Nucleoside-triphosphatase [Bacillus cereus 95/8201]
 gi|228689785|gb|EEL43591.1| Nucleoside-triphosphatase [Bacillus cereus Rock3-42]
 gi|228772005|gb|EEM20460.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228811562|gb|EEM57899.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228823856|gb|EEM69676.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830106|gb|EEM75724.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228842536|gb|EEM87626.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 205

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 108/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEVAFEK------- 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|123965547|ref|YP_001010628.1| xanthosine triphosphate pyrophosphatase [Prochlorococcus marinus
           str. MIT 9515]
 gi|123199913|gb|ABM71521.1| Xanthosine triphosphate pyrophosphatase [Prochlorococcus marinus
           str. MIT 9515]
          Length = 191

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 103/214 (48%), Gaps = 29/214 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           + +AS N  KI E   L+  +       L+   I  EE GN+F ENA+ K+   +K  G 
Sbjct: 4   LYLASKNFGKIKEYKKLLSNVNCQLL--LQPESIEVEENGNTFRENAIKKACEVSKKTGN 61

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
            A++DDSG+ ID LDGKPGI+S+R+AE++          ++IE  L+         R A 
Sbjct: 62  YAIADDSGICIDALDGKPGIYSSRYAEND---------QRRIERVLKE--LDGEKNRCAF 110

Query: 129 FISVLSLAWPDGH-VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           FI+ + +  P G  +     K  G I+  PRG  GFGYDPIF+      TF EM  E K 
Sbjct: 111 FIANVCVCSPSGDLILESEAKCFGNIIEKPRGNSGFGYDPIFEEVSSRLTFAEMNNELK- 169

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
                         D  SHR +A K  +   L I
Sbjct: 170 --------------DECSHRGKALKKIIPQLLEI 189


>gi|224584896|ref|YP_002638695.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|224469424|gb|ACN47254.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
          Length = 197

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKMT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E+ T +++ +  +  + +    K       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQQNLEKLLHTLRDVPDDK-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I     G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTLEEKSA---------------ISHRGQALKLLLD 192


>gi|196250188|ref|ZP_03148882.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. G11MC16]
 gi|196210372|gb|EDY05137.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. G11MC16]
          Length = 204

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 102/208 (49%), Gaps = 24/208 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             IVIA+ N  K+ E  ++    GI   S L+  ++   EETG++F ENA +K+    + 
Sbjct: 2   KEIVIATKNAGKVREFAAMFAKRGIEVKSLLDFPDVPDVEETGSTFVENAKLKAEAVCQR 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
              P ++DDSGL +D L G+PG+HSAR+A E     R+    + +++     K       
Sbjct: 62  LQRPVIADDSGLAVDALGGRPGVHSARYAGEDKNDARNIAKLLHELDGVPMEK------- 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P            G I   PRG+ GFGYDP+F      +T  E+T E
Sbjct: 115 RTARFHCALAVAIPGQPTAIVEATCDGYIAEAPRGEGGFGYDPVFYLPERGKTMAELTPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
           EKN                +SHRA+A +
Sbjct: 175 EKNA---------------ISHRAKALE 187


>gi|15603531|ref|NP_246605.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Pasteurella multocida subsp. multocida str. Pm70]
 gi|22653773|sp|Q9CKF5|NTPA_PASMU RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|12722072|gb|AAK03750.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 202

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 111/214 (51%), Gaps = 22/214 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N+ K+ EM  ++   G    +  ELN+  PEETG +F ENA++K+  A+K
Sbjct: 1   MKQKIVLATGNLGKVKEMSDVLADFGFEVIAQTELNIESPEETGLTFVENALLKARYASK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH---- 120
            +G+PA++DDSGLV+  L G PG++SAR+A  +  + D            R+K  H    
Sbjct: 61  MSGLPAIADDSGLVVPALGGAPGLYSARYAGVDGPDADAKN---------RAKLLHVLHH 111

Query: 121 -DPAFRSAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGY 174
             P  R A F+S + +     H  + S     G+  G I +  +G+ GFGYD +F     
Sbjct: 112 IAPTHRQAKFVSCIVMLQ---HEHDPSPIIAEGECYGEIGFAEKGENGFGYDSLFFSPEV 168

Query: 175 DRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRA 208
           + TF E+   EK      A   S+L T L +  A
Sbjct: 169 NCTFAELATSEKKKISHRAKALSVLQTKLATKGA 202


>gi|312199597|ref|YP_004019658.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Frankia
           sp. EuI1c]
 gi|311230933|gb|ADP83788.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Frankia
           sp. EuI1c]
          Length = 215

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 112/216 (51%), Gaps = 31/216 (14%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE-----ETGNSFEENAMIKSLTA 62
            +V+AS N  K+ E+  ++   G+    A+EL + +P+     ETG +F ENA+IK+  A
Sbjct: 10  RLVLASRNEAKLVELRRILAAAGL----AVEL-VGLPDGPEVPETGRTFAENALIKARDA 64

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTG--ERDFDMAMQKIENALRSKFAH 120
           A   G+PA++DDSGL ++ L+G PG+ SARWA S  G    + D A   +   L ++   
Sbjct: 65  AATTGLPAVADDSGLAVEELNGMPGVRSARWAGSPPGRPRAEKDAANNAL---LLAQLDD 121

Query: 121 DPAFRSAHFISVLSLAW-PDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
            P  R        +    P G      G++ G ++  PRG  GFGYDP+F+P+G  RT  
Sbjct: 122 VPVERRGAAFVCAAAFVDPRGTEHVVHGELRGRLLAAPRGAGGFGYDPLFRPDGETRTSA 181

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           E+T +EK               D +SHR +AF+   
Sbjct: 182 ELTAQEK---------------DAISHRGQAFRALA 202


>gi|229071998|ref|ZP_04205208.1| Nucleoside-triphosphatase [Bacillus cereus F65185]
 gi|228711157|gb|EEL63122.1| Nucleoside-triphosphatase [Bacillus cereus F65185]
          Length = 205

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 108/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEVAFEK------- 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|156932604|ref|YP_001436520.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Cronobacter sakazakii ATCC BAA-894]
 gi|156530858|gb|ABU75684.1| hypothetical protein ESA_00386 [Cronobacter sakazakii ATCC BAA-894]
          Length = 197

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 111/215 (51%), Gaps = 29/215 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 2   QKVVLATGNAGKVRELASLLQEFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAQVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G  A++DDSGL +D L G PGI+SAR+A ++  +++    ++K+  AL+         R 
Sbjct: 62  GFAAIADDSGLAVDALGGAPGIYSARYAGNDATDQE---NLEKLLEALKDVPDEQ---RQ 115

Query: 127 AHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  VL       H ++     F G   G+I   P GQ GFGYDPIF      +T  E+
Sbjct: 116 AQFHCVLVYMR---HADDPTPLVFHGAWPGVITRAPAGQGGFGYDPIFFVPSIGKTAAEL 172

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           T EEK+                +SHR +A K  ++
Sbjct: 173 TREEKSA---------------VSHRGQALKLLLE 192


>gi|302341928|ref|YP_003806457.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfarculus baarsii DSM 2075]
 gi|301638541|gb|ADK83863.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfarculus baarsii DSM 2075]
          Length = 199

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 104/206 (50%), Gaps = 22/206 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNA 66
            IV+AS N  K+ EM ++  PLG+   SA EL  +    ETG SF  NA +K+   ++  
Sbjct: 4   RIVLASANQGKLREMMAICRPLGVEVVSAAELGFVDEVAETGESFAANARLKAAAVSQAL 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +PAL+DDSGLV+  L G PG+HSAR+A ++    D      K+  A+       P  R 
Sbjct: 64  HLPALADDSGLVVAALGGAPGVHSARYAGAHG---DDAANCAKLMAAMAGL---PPEKRG 117

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+ V+    PDG      G++ G I   P GQ GFGYDP+F+      T  ++  EEK
Sbjct: 118 AAFVCVMVCRRPDGAEIVAEGRLEGRIALAPAGQNGFGYDPVFELPARGCTVAQLAAEEK 177

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                +SHR +A +
Sbjct: 178 NA---------------ISHRGQALR 188


>gi|261418319|ref|YP_003252001.1| nucleoside-triphosphatase [Geobacillus sp. Y412MC61]
 gi|319767721|ref|YP_004133222.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. Y412MC52]
 gi|261374776|gb|ACX77519.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. Y412MC61]
 gi|317112587|gb|ADU95079.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. Y412MC52]
          Length = 204

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 104/207 (50%), Gaps = 24/207 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             IVIA+ N  K+ E  +L    G+   S L+  +     ETG++F ENA++K+  A++ 
Sbjct: 2   KEIVIATKNAGKVREFAALFAKRGVEVKSLLDFPDAPDVAETGSTFAENAVLKAEAASRR 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
              P ++DDSGLV+D L G+PG+HSAR+A E     R+    +++++     +       
Sbjct: 62  LKRPVIADDSGLVVDALGGRPGVHSARYAGEDKNDARNIAKLLRELDGVPMEQ------- 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P            G I   PRG+ GFGYDP+F    + +T  E+  E
Sbjct: 115 RTARFHCALAVAIPGRPTAVVEATCDGYIAEAPRGEGGFGYDPVFYLPEWGKTMAELAPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAF 211
           EKN                +SHRA+A 
Sbjct: 175 EKN---------------QISHRAKAL 186


>gi|298345214|ref|YP_003717901.1| nucleoside-triphosphatase [Mobiluncus curtisii ATCC 43063]
 gi|298235275|gb|ADI66407.1| nucleoside-triphosphatase [Mobiluncus curtisii ATCC 43063]
          Length = 231

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 107/213 (50%), Gaps = 30/213 (14%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPL-------GIMTTSALELNLIIPEETGNSFEENAMIK 58
           E  +V+A+ N  K+ E++ ++ PL       GI+  +A  L    P E G SF  NA+IK
Sbjct: 23  EAQVVMATGNAHKVREVEEILRPLVPSLRPGGIV--AAGTLGAPEPREDGTSFSANALIK 80

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
           +   A    +P L+DDSGL +D+L G PGI SARW   +  +R     +      +    
Sbjct: 81  ARALASVVDVPILADDSGLSVDILGGSPGIFSARWCGHHGDDRANLELLLNQLQDI---- 136

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
             D  +R+A FI    L  P G     +G + G +V  P+G+ GFGYDPIF  +G + T 
Sbjct: 137 --DDGYRTAAFICAAVLLIPGGGTYLGNGVMGGRLVREPKGKNGFGYDPIFLADGQEVTN 194

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
           GE++++ KN                +SHR +AF
Sbjct: 195 GELSKDAKNA---------------ISHRTKAF 212


>gi|239827936|ref|YP_002950560.1| nucleoside-triphosphatase [Geobacillus sp. WCH70]
 gi|239808229|gb|ACS25294.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. WCH70]
          Length = 202

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 105/207 (50%), Gaps = 24/207 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             ++IA+ NV K  E   L+   GI   S L+  N    EETG++F ENA++K+   A  
Sbjct: 3   KQVIIATKNVGKAREFQELLEKKGIEVKSLLDFPNCPDVEETGSTFAENAVLKAEAMAHY 62

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL ID LDG+PG++SAR+A E    +++    +++++     K       
Sbjct: 63  FHAIVIADDSGLSIDALDGRPGVYSARYAGEEKNDQKNIAKVLEELKGIPFEK------- 115

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P        G   G I   P+G+ GFGYDPIF      +T  E+++E
Sbjct: 116 RTARFHCALAVAAPGRRTTVVEGTCEGYITEVPKGENGFGYDPIFYVPQKGKTMAELSKE 175

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAF 211
           EKN                +SHRA+A 
Sbjct: 176 EKN---------------QISHRAKAL 187


>gi|317129837|ref|YP_004096119.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bacillus cellulosilyticus DSM 2522]
 gi|315474785|gb|ADU31388.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bacillus cellulosilyticus DSM 2522]
          Length = 199

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 101/208 (48%), Gaps = 22/208 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE-ETGNSFEENAMIKSLTAA 63
           +  ++ +A+ N  K+ E  +     GI   S L+L   I   E G++FE+NA+ K+ T  
Sbjct: 1   MSTSLFVATKNEGKVKEFTAFFQERGIEVKSLLDLEEDIDVLEDGDTFEDNAIKKAETIG 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G   +SDDSGL +D LDG+PG++SAR+A    G+   D A       L+        
Sbjct: 61  KKIGQIVISDDSGLEVDALDGRPGVYSARYA----GQEKNDAANNA--KLLKELEGISDN 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+ V+++  P        G   GII   PRG  GFGYDP+F      +T  E++ 
Sbjct: 115 NRTAQFVCVIAVYIPGQETRTIRGTCKGIIATAPRGNSGFGYDPVFYLPHLKKTMAELSR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAF 211
           EEKN                LSHRA A 
Sbjct: 175 EEKNK---------------LSHRANAM 187


>gi|157148504|ref|YP_001455823.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Citrobacter koseri ATCC BAA-895]
 gi|157085709|gb|ABV15387.1| hypothetical protein CKO_04330 [Citrobacter koseri ATCC BAA-895]
          Length = 197

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 108/216 (50%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDVIAQTELGVDSAEETGLTFIENAILKARHAAKAT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR++ E  T +R+ +  +  +      K       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQRNLEKLLHTLREVPDEK-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I     G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYMR---HAEDPTPLVCHGSWPGMITREAAGNGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|26249375|ref|NP_755415.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli CFT073]
 gi|91212336|ref|YP_542322.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli UTI89]
 gi|110643103|ref|YP_670833.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli 536]
 gi|117625181|ref|YP_854169.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli APEC O1]
 gi|191171826|ref|ZP_03033372.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli F11]
 gi|194436702|ref|ZP_03068802.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli 101-1]
 gi|218559945|ref|YP_002392858.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia coli
           S88]
 gi|218691078|ref|YP_002399290.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli ED1a]
 gi|227888509|ref|ZP_04006314.1| nucleoside-triphosphatase [Escherichia coli 83972]
 gi|237706393|ref|ZP_04536874.1| nucleoside-triphosphatase rdgB [Escherichia sp. 3_2_53FAA]
 gi|256024537|ref|ZP_05438402.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia sp. 4_1_40B]
 gi|300925050|ref|ZP_07140968.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 182-1]
 gi|300940764|ref|ZP_07155310.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 21-1]
 gi|300980106|ref|ZP_07174849.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 45-1]
 gi|300995465|ref|ZP_07181113.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 200-1]
 gi|301027295|ref|ZP_07190641.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 69-1]
 gi|301027721|ref|ZP_07191031.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 196-1]
 gi|301049251|ref|ZP_07196224.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 185-1]
 gi|306812142|ref|ZP_07446340.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli NC101]
 gi|331648709|ref|ZP_08349797.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli M605]
 gi|331659089|ref|ZP_08360031.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli TA206]
 gi|34222570|sp|Q8FE27|RDGB_ECOL6 RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|26109783|gb|AAN81988.1|AE016766_76 HAM1 protein homolog [Escherichia coli CFT073]
 gi|91073910|gb|ABE08791.1| HAM1-like protein [Escherichia coli UTI89]
 gi|110344695|gb|ABG70932.1| hypothetical protein YggV [Escherichia coli 536]
 gi|115514305|gb|ABJ02380.1| putative ribosomal protein [Escherichia coli APEC O1]
 gi|190907861|gb|EDV67454.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli F11]
 gi|194424184|gb|EDX40171.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli 101-1]
 gi|218366714|emb|CAR04471.1| dITP/XTP pyrophosphatase [Escherichia coli S88]
 gi|218428642|emb|CAR09571.2| dITP/XTP pyrophosphatase [Escherichia coli ED1a]
 gi|226899433|gb|EEH85692.1| nucleoside-triphosphatase rdgB [Escherichia sp. 3_2_53FAA]
 gi|227834778|gb|EEJ45244.1| nucleoside-triphosphatase [Escherichia coli 83972]
 gi|281179963|dbj|BAI56293.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|294492596|gb|ADE91352.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli IHE3034]
 gi|299879157|gb|EFI87368.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 196-1]
 gi|300298947|gb|EFJ55332.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 185-1]
 gi|300304827|gb|EFJ59347.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 200-1]
 gi|300395101|gb|EFJ78639.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 69-1]
 gi|300409363|gb|EFJ92901.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 45-1]
 gi|300418796|gb|EFK02107.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 182-1]
 gi|300454464|gb|EFK17957.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 21-1]
 gi|305854180|gb|EFM54618.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli NC101]
 gi|307554936|gb|ADN47711.1| non-canonical purine NTP pyrophosphatase [Escherichia coli ABU
           83972]
 gi|307625472|gb|ADN69776.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli UM146]
 gi|315289498|gb|EFU48893.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 110-3]
 gi|315293932|gb|EFU53284.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 153-1]
 gi|315295643|gb|EFU54966.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 16-3]
 gi|320195073|gb|EFW69702.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli WV_060327]
 gi|323188652|gb|EFZ73937.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli RN587/1]
 gi|323951608|gb|EGB47483.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli H252]
 gi|323957322|gb|EGB53044.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli H263]
 gi|323960753|gb|EGB56374.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli H489]
 gi|324011795|gb|EGB81014.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 60-1]
 gi|330908989|gb|EGH37503.1| nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Escherichia coli AA86]
 gi|331042456|gb|EGI14598.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli M605]
 gi|331053671|gb|EGI25700.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli TA206]
          Length = 197

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|168747554|ref|ZP_02772576.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4113]
 gi|168753906|ref|ZP_02778913.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4401]
 gi|168766961|ref|ZP_02791968.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4486]
 gi|168773407|ref|ZP_02798414.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4196]
 gi|168781813|ref|ZP_02806820.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4076]
 gi|195937092|ref|ZP_03082474.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. EC4024]
 gi|208806883|ref|ZP_03249220.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4206]
 gi|208812337|ref|ZP_03253666.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4045]
 gi|208819503|ref|ZP_03259823.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4042]
 gi|209399636|ref|YP_002272434.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4115]
 gi|254794906|ref|YP_003079743.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. TW14359]
 gi|187770849|gb|EDU34693.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4196]
 gi|188017871|gb|EDU55993.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4113]
 gi|189000591|gb|EDU69577.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4076]
 gi|189358429|gb|EDU76848.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4401]
 gi|189363708|gb|EDU82127.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4486]
 gi|208726684|gb|EDZ76285.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4206]
 gi|208733614|gb|EDZ82301.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4045]
 gi|208739626|gb|EDZ87308.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4042]
 gi|209161036|gb|ACI38469.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4115]
 gi|209760026|gb|ACI78325.1| putative ribosomal protein [Escherichia coli]
 gi|254594306|gb|ACT73667.1| dITP/XTP pyrophosphatase [Escherichia coli O157:H7 str. TW14359]
          Length = 197

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SA ++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSACYSGEDATDQKNLQKLLETLKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|300723970|ref|YP_003713284.1| hypothetical protein XNC1_3112 [Xenorhabdus nematophila ATCC 19061]
 gi|297630501|emb|CBJ91166.1| putative protein controls HAP (6-N-hydroxylaminopurine) mutagenesis
           (Ham1) [Xenorhabdus nematophila ATCC 19061]
          Length = 199

 Score =  111 bits (277), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 111/218 (50%), Gaps = 29/218 (13%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           + +  +V+A+ N  K+ E+  L+   G+   +  EL +   +E G +F ENA+IK+  AA
Sbjct: 1   MAKQKVVLATGNAGKVRELADLLADFGLNIVAQTELGVDSADEAGLTFIENAIIKARHAA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
              G+PA++DDSGL +D L G PGI+SAR+A S   ++D    ++K+  A+R        
Sbjct: 61  AVTGLPAIADDSGLSVDALGGAPGIYSARYAGSEASDQD---NLEKLLEAMRDVPDEQ-- 115

Query: 124 FRSAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
            R A F  VL       H E+     F G+ SG+I   P G+ GFGYDPIF       T 
Sbjct: 116 -RQAQFNCVLVFLR---HAEDPTPLVFHGRWSGMITHEPAGEGGFGYDPIFYAPELGCTA 171

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
            +++ E+KN                +SHR +A    ++
Sbjct: 172 AQLSREQKN---------------TVSHRGKALDMLLE 194


>gi|260494952|ref|ZP_05815081.1| ribonuclease PH [Fusobacterium sp. 3_1_33]
 gi|260197395|gb|EEW94913.1| ribonuclease PH [Fusobacterium sp. 3_1_33]
          Length = 434

 Score =  111 bits (277), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 112/211 (53%), Gaps = 37/211 (17%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           I +A+ N  KI E+  +   +  +   +++  + IPE  E G +FE+N+  K++  +K  
Sbjct: 244 IFLATANKHKIDEISDIFSGIENIEILSIKDGIEIPEVIEDGKTFEDNSKKKAVEISKFL 303

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-----RDFDMAMQKIENALRSKFAHD 121
            M A++DDSGL +D L+G+PG++SAR+  S TG+           +Q IEN         
Sbjct: 304 NMIAIADDSGLCVDALNGEPGVYSARY--SGTGDDLKNNEKLINNLQGIEN--------- 352

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F+SV++LA P+G   +F G+++G IV  PRG  GFGYDP F    Y +T  E+
Sbjct: 353 ---RNAKFVSVITLAKPNGETYSFRGEINGKIVDTPRGNTGFGYDPHFYVEEYQKTLAEL 409

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            E                  + +SHRA+A +
Sbjct: 410 PE----------------LKNKISHRAKALE 424


>gi|183984011|ref|YP_001852302.1| Ham1-related NTPase [Mycobacterium marinum M]
 gi|183177337|gb|ACC42447.1| Ham1-related NTPase [Mycobacterium marinum M]
          Length = 203

 Score =  111 bits (277), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 109/214 (50%), Gaps = 28/214 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP----EETGNSFEENAMIKSLTA 62
             +++AS N  K+ E+  ++   G+   + + LN + P     ETG +FEENA+IK+  A
Sbjct: 2   TKLLVASRNAKKLAELRRVLDAAGLSGVTLVSLNDVAPFDEAPETGATFEENALIKAREA 61

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
               G+P+++DDSGL +  L+G PG+ SARW+  N G+   + A+      L ++    P
Sbjct: 62  FAATGLPSVADDSGLTVAALNGMPGVLSARWS-GNHGDDAGNTAL------LLAQLRDVP 114

Query: 123 -AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F+S  +L    G V    G+  G +   PRG  GFGYDP+F  +G +RT  E+
Sbjct: 115 EQRRGAAFVSACALVSGSGEVV-VRGEWPGAVAQEPRGAGGFGYDPVFIADGANRTAAEL 173

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           +  EK               D +SHR RA    +
Sbjct: 174 SPAEK---------------DAVSHRGRALTLLL 192


>gi|312888860|ref|ZP_07748423.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Mucilaginibacter paludis DSM 18603]
 gi|311298735|gb|EFQ75841.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Mucilaginibacter paludis DSM 18603]
          Length = 194

 Score =  111 bits (277), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 110/217 (50%), Gaps = 34/217 (15%)

Query: 5   IENNIVIASHNVDKIHEM-----DSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKS 59
           ++  +V A++N  KI E+     D  I+    ++   +  +  I E TG +F ENA IKS
Sbjct: 1   MQYKLVFATNNRHKIEEVAAKTGDRFIL----LSLHDIHCDAEIAE-TGETFAENASIKS 55

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
                  G+ +  DDSGL +D L  +PG++SAR+A  +    D +  M K+   L+ +  
Sbjct: 56  RFIFNQYGLNSFGDDSGLEVDALQNEPGVYSARYAGKHG---DHEANMDKVLAKLQGQ-- 110

Query: 120 HDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
                R A F +V+SL W +G    F G V G I     G  GFGYDPIFQP+GYD TF 
Sbjct: 111 ---DNRKARFRTVISLLW-NGEEYFFDGTVEGTIRTERSGSKGFGYDPIFQPDGYDITFA 166

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           EM+ EEKN                +SHR RA +  V+
Sbjct: 167 EMSMEEKNS---------------ISHRGRAVEKMVE 188


>gi|296328289|ref|ZP_06870818.1| ribonuclease PH/Ham1 protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296154593|gb|EFG95381.1| ribonuclease PH/Ham1 protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 434

 Score =  111 bits (277), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 111/211 (52%), Gaps = 37/211 (17%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           I +A+ N  KI E+  +   +  +   +++  + IPE  E G++FE N+  K++  +K  
Sbjct: 244 IFLATANKHKIEEISDIFSGIENIEILSIKDGIEIPEVIEDGDTFEANSKKKAVEISKFL 303

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-----RDFDMAMQKIENALRSKFAHD 121
            M  ++DDSGL +D L+G+PG++SAR+  S TG+           +Q IEN         
Sbjct: 304 NMITIADDSGLCVDALNGEPGVYSARY--SGTGDDLKNNEKLINNLQGIEN--------- 352

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F+SV++LA P+G V +F G++ G IV  PRG  GFGYDP F    Y +T  E+
Sbjct: 353 ---RNAKFVSVITLAKPNGEVYSFRGEIQGKIVDTPRGNTGFGYDPHFYVEEYQKTLAEL 409

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            E +                  +SHRA+A +
Sbjct: 410 PELKNK----------------ISHRAKALE 424


>gi|319401536|gb|EFV89746.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Staphylococcus epidermidis FRI909]
          Length = 195

 Score =  111 bits (277), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 104/179 (58%), Gaps = 9/179 (5%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +IVIA++N+ KI++  ++     ++  S L  +  + EETG +FEENA +KS  AA    
Sbjct: 3   DIVIATNNLGKINDFKAIFKNQHVIGISELIEDFDV-EETGATFEENAKLKSEAAAHALN 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
              ++DDSGL +  L+G+PG++SAR+A    G+ D D     IE  L +    D   R A
Sbjct: 62  KRVIADDSGLEVFALNGEPGVYSARYA--GLGKNDED----NIEKLLTN--LEDVQDRRA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ P+   + F G VSG+I     G+ GFGYDPIF     ++T  E+T EEK
Sbjct: 114 QFVCVISMSAPNEKTKTFKGTVSGVITTERHGKNGFGYDPIFFVPELNKTMAEITNEEK 172


>gi|297529172|ref|YP_003670447.1| ribonuclease PH [Geobacillus sp. C56-T3]
 gi|297252424|gb|ADI25870.1| ribonuclease PH [Geobacillus sp. C56-T3]
          Length = 460

 Score =  111 bits (277), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 102/206 (49%), Gaps = 22/206 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             IVIA+ N  K+ E  +L    G+   S L+  +     ETG++F ENA++K+  A++ 
Sbjct: 258 KEIVIATKNAGKVREFAALFAKRGVEVKSLLDFPDAPDVAETGSTFAENAVLKAEAASRR 317

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
              P ++DDSGLV+D L G+PG+HSAR+A    GE   D   + I   LR         R
Sbjct: 318 LKRPVIADDSGLVVDALGGRPGVHSARYA----GEDKND--ARNIAKLLRELDGVPMEQR 371

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F   L++A P            G I   PRG+ GFGYDP+F    + +T  E+  EE
Sbjct: 372 TARFHCALAVAIPGRPTAVVEATCDGYIAEAPRGEGGFGYDPVFYLPEWGKTMAELAPEE 431

Query: 186 KNGGIDSATLFSILSTDLLSHRARAF 211
           KN                +SHRA+A 
Sbjct: 432 KN---------------QISHRAKAL 442


>gi|16761878|ref|NP_457495.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Typhi str. CT18]
 gi|29143365|ref|NP_806707.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|213051777|ref|ZP_03344655.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E00-7866]
 gi|213422842|ref|ZP_03355880.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E01-6750]
 gi|213580618|ref|ZP_03362444.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-0664]
 gi|213609098|ref|ZP_03368924.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-2068]
 gi|213648209|ref|ZP_03378262.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           J185]
 gi|213850157|ref|ZP_03381055.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           M223]
 gi|289811235|ref|ZP_06541864.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           AG3]
 gi|289825937|ref|ZP_06545096.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-3139]
 gi|22653760|sp|Q8Z3U6|RDGB_SALTI RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|25323166|pir||AG0878 conserved hypothetical protein STY3256 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504180|emb|CAD02927.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138999|gb|AAO70567.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 197

 Score =  111 bits (277), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDVVAQTKLGVDSAEETGLTFIENAILKARHAAKMT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E+ T +++ +  +  + +    K       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQQNLEKLLHTLRDVPDDK-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I     G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|325107121|ref|YP_004268189.1| nucleoside-triphosphatase rdgB [Planctomyces brasiliensis DSM 5305]
 gi|324967389|gb|ADY58167.1| Nucleoside-triphosphatase rdgB [Planctomyces brasiliensis DSM 5305]
          Length = 209

 Score =  111 bits (277), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 110/216 (50%), Gaps = 25/216 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +++AS N  K  E+ + +   GI      E  N     E G+SF  NA  K+   AK  G
Sbjct: 7   VILASRNAKKAAEIQTQLADTGIQIRCMAEFPNAPEVVEDGDSFAANAAKKASQTAKALG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
             A+ +DSG+ +D LDG PGI+SAR++ E  T E++  +  +K+ +    K       R 
Sbjct: 67  HWAIGEDSGICVDALDGAPGIYSARFSGEDATDEKNNALLQEKLSDVSDEK-------RG 119

Query: 127 AHFISVLSLAWPDGHVENFSGK-VSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           AH++  ++LA P G +   + +  +G I+  PRG+ GFGYDP F    YDRTFGE+    
Sbjct: 120 AHYVCHVALADPSGEIRATAERTCNGRIIRNPRGENGFGYDPYFLIPEYDRTFGELPGVV 179

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           K                 +SHRARAF+ F+   + I
Sbjct: 180 KKS---------------ISHRARAFQQFLPQLVAI 200


>gi|154505103|ref|ZP_02041841.1| hypothetical protein RUMGNA_02615 [Ruminococcus gnavus ATCC 29149]
 gi|153794582|gb|EDN77002.1| hypothetical protein RUMGNA_02615 [Ruminococcus gnavus ATCC 29149]
          Length = 202

 Score =  111 bits (277), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 115/217 (52%), Gaps = 33/217 (15%)

Query: 5   IENNIVIASHNVDKIHEMDSLI----MPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           +E  I+ A+ N +K+ E+  ++    MP+  M  + ++++++   E G +FEENA IK+ 
Sbjct: 1   MEKRIIFATGNQNKMKEIHMILADLGMPIYSMKEAGIDIDIV---EDGTTFEENAQIKAK 57

Query: 61  TAAKNAGMP---ALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSK 117
             AK   +P    L+DDSGL ID L+ +PGI+SAR+A  +T    +D+  Q + + L+  
Sbjct: 58  AIAKY--LPDDIILADDSGLEIDYLNKEPGIYSARYAGVDTS---YDIKNQMLLDRLKGV 112

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                  R+A F+  ++ A+PDG VE   G + G+I +   G+ GFGYDPIF    Y  T
Sbjct: 113 PDEK---RTARFVCAIAAAFPDGTVETVRGTIEGMIGYEIAGEHGFGYDPIFYVPEYGCT 169

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
             EM   +KN                LSHR RA +  
Sbjct: 170 TAEMDPVQKNE---------------LSHRGRALRAM 191


>gi|313884064|ref|ZP_07817830.1| non-canonical purine NTP pyrophosphatase RdgB [Eremococcus
           coleocola ACS-139-V-Col8]
 gi|312620511|gb|EFR31934.1| non-canonical purine NTP pyrophosphatase RdgB [Eremococcus
           coleocola ACS-139-V-Col8]
          Length = 208

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 83/213 (38%), Positives = 110/213 (51%), Gaps = 31/213 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           +VIASHN  K+ E+ +L+   G+  TS  +   I   EETG +FE NA +K+   A + G
Sbjct: 3   LVIASHNQHKVVEIKNLLKNFGLEVTSLADYPEIGDIEETGTTFEANARLKAEPMAAHFG 62

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQ-KIENALRSKFAHDPAFRS 126
              L+DDSGLV+D LDG PG++SAR+A    GE   D A   K+ +AL+    +D   RS
Sbjct: 63  TIVLADDSGLVVDALDGAPGVYSARYA----GESHDDHANNLKLLDALKDVHGND---RS 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGII----VWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           AHF+S L LA+P        G+  G I    V  P     FGYDPIF       TF ++ 
Sbjct: 116 AHFVSCLVLAYPGVESLVVQGQAQGQILEDYVADPE---AFGYDPIFYVPEEGATFAQLP 172

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            E KN                +SHRA AF+  V
Sbjct: 173 IERKNQ---------------ISHRAHAFQNLV 190


>gi|257869443|ref|ZP_05649096.1| ribonuclease PH/Ham1 [Enterococcus gallinarum EG2]
 gi|257803607|gb|EEV32429.1| ribonuclease PH/Ham1 [Enterococcus gallinarum EG2]
          Length = 450

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/186 (41%), Positives = 100/186 (53%), Gaps = 13/186 (6%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP--EETGNSFEENAMIKSLTAA 63
           E  IVIA+ N  K  E  ++    G      L+    +P  EETG +FEENA +K+ T A
Sbjct: 249 EKTIVIATGNPGKAREFTAVFGAAG-YDVRTLKDYPALPDVEETGTTFEENARLKAETIA 307

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA-LRSKFAHDP 122
           K  G P L+DDSGL +D L G+PG++SAR+A    GE+  D A     NA L  +    P
Sbjct: 308 KILGRPVLADDSGLKVDALGGRPGVYSARFA----GEQKSDAA----NNAKLLYELTDIP 359

Query: 123 -AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F   L  A PD      +    G I   PRG+ GFGYDP+F P G D+T  EM
Sbjct: 360 DEQRTAQFHCTLVFAAPDKESLVVAADWPGRIGRIPRGENGFGYDPLFIPVGSDKTAAEM 419

Query: 182 TEEEKN 187
           + EEKN
Sbjct: 420 SGEEKN 425


>gi|295094142|emb|CBK83233.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Coprococcus sp. ART55/1]
          Length = 200

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 111/214 (51%), Gaps = 28/214 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGI----MTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           + ++ A+ N  K+ E+  ++  LG     M  + ++++++   E G +FEENA+IK+   
Sbjct: 2   DKLIFATGNEGKMKEVRMILADLGFEIQSMKEAGIDIDIV---EDGQTFEENALIKARAI 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           +K +G   L+DDSGL +D +D  PGI+SAR+   +T  R   +  Q I + L      DP
Sbjct: 59  SKESGCLVLADDSGLEVDYMDKAPGIYSARFLGEDTSYR---IKNQYIIDKLAG--VPDP 113

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F+  ++  +PDG      G + GII +  RG+ GFGYDPIF   G  +T  E+ 
Sbjct: 114 E-RTARFVCAIAAVFPDGSEYTTRGTIEGIIGYEERGENGFGYDPIFFLPGKGKTTAELD 172

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
            EEKN                +SHR  A +   D
Sbjct: 173 PEEKN---------------EISHRGNALRLMKD 191


>gi|118619116|ref|YP_907448.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Mycobacterium ulcerans Agy99]
 gi|118571226|gb|ABL05977.1| Ham1-related NTPase [Mycobacterium ulcerans Agy99]
          Length = 204

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 109/214 (50%), Gaps = 28/214 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP----EETGNSFEENAMIKSLTA 62
             +++AS N  K+ E+  ++   G+   + + LN + P     ETG +FEENA+IK+  A
Sbjct: 3   TKLLVASRNAKKLAELRRVLDAAGLSGVTLVSLNDVAPFDEAPETGATFEENALIKAREA 62

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
               G+P+++DDSGL +  L+G PG+ SARW+  N G+   + A+      L ++    P
Sbjct: 63  FSATGLPSVADDSGLTVAALNGMPGVLSARWS-GNHGDDAGNTAL------LLAQLRDVP 115

Query: 123 -AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F+S  +L    G V    G+  G +   PRG  GFGYDP+F  +G +RT  E+
Sbjct: 116 EQRRGAAFVSACALVSGSGEVV-VRGEWPGAVAQEPRGAGGFGYDPVFIADGANRTAAEL 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           +  EK               D +SHR RA    +
Sbjct: 175 SPAEK---------------DAVSHRGRALTLLL 193


>gi|310778904|ref|YP_003967237.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ilyobacter polytropus DSM 2926]
 gi|309748227|gb|ADO82889.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ilyobacter polytropus DSM 2926]
          Length = 193

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 97/185 (52%), Gaps = 34/185 (18%)

Query: 43  IPE--ETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESN--- 97
           IPE  E G++FE N++ K+L  A+   MP+++DDSGL +D L G PG++SAR++  N   
Sbjct: 36  IPEVIEDGDTFEVNSVKKALEIAEYLNMPSIADDSGLCVDALKGAPGVYSARYSGENATD 95

Query: 98  -TGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWP 156
            T  +     +  IEN            R A F+SV++ A P G   +F G++ G I+  
Sbjct: 96  ETNNKKLVRELYGIEN------------RKAKFVSVITFAKPTGETYSFRGEIEGEIIDE 143

Query: 157 PRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           PRG+ GFGYDP F    Y+ T  E+ E                  + +SHRA+A + F +
Sbjct: 144 PRGKDGFGYDPYFYVKEYESTLAEIPE----------------IKNKISHRAKALEKFKE 187

Query: 217 NCLRI 221
           N  +I
Sbjct: 188 NFKKI 192


>gi|159036644|ref|YP_001535897.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Salinispora arenicola CNS-205]
 gi|157915479|gb|ABV96906.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Salinispora arenicola CNS-205]
          Length = 204

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 112/212 (52%), Gaps = 28/212 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLI--IPE--ETGNSFEENAMIKSLT 61
           N +++A+ N  K+ E+  ++   LG    + + L+ +   PE  ETG +F ENA+IK+  
Sbjct: 2   NKVLLATRNRKKLVELQRILDGALGAHRIALIGLDDVEAYPELPETGLTFGENALIKARE 61

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
             +  G+P ++DDSGL ++ L+G PG+ SARWA  +    D +  +Q + +    + A  
Sbjct: 62  GCRRTGLPTVADDSGLAVEALNGMPGVFSARWAGRHG---DDNANLQLVLD----QIADL 114

Query: 122 P-AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           P   R A F+  ++L  P G      G+  G ++  PRG  GFGYDPIF+ +G DRT  E
Sbjct: 115 PDEHRGASFVCTVALVLPGGKEHLVDGRQPGQLLREPRGDGGFGYDPIFRGDGQDRTNAE 174

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           +T  EK               D +SHR +A +
Sbjct: 175 LTPTEK---------------DAISHRGKALR 191


>gi|23200232|pdb|1K7K|A Chain A, Crystal Structure Of Rdgb- Inosine Triphosphate
           Pyrophosphatase From E. Coli
          Length = 221

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 24  QKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 83

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            +PA++DDSGL +DVL G PGI+SAR++ E  T +++    ++  ++    +       R
Sbjct: 84  ALPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETXKDVPDDQ-------R 136

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 137 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 193

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 194 LTREEKSA---------------ISHRGQALKLLLD 214


>gi|148260662|ref|YP_001234789.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Acidiphilium cryptum JF-5]
 gi|146402343|gb|ABQ30870.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Acidiphilium cryptum JF-5]
          Length = 195

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 99/215 (46%), Gaps = 25/215 (11%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR      +VIA+HN  K+ E   L+ P G+   S+  L L  P E    F  NA IK+L
Sbjct: 1   MRLERGQRVVIATHNAGKLAEFALLLAPHGLDCVSSGALGLKEPVEDAPDFAGNARIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA  +G+ A++DDSGL +  L G PG+ SAR+A+   G       +     A       
Sbjct: 61  AAATTSGLAAIADDSGLEVAALGGAPGVRSARFAQEAGGYAAAMANIIAASRADDRAAF- 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
                     + + LA P+G    + G   G I   PRG  GFGYDP+F P G  R+F E
Sbjct: 120 ---------AAAICLATPEGRTFTYLGWCRGRIAPAPRGDGGFGYDPVFVPLGETRSFAE 170

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           + + EK+                +SHR RA + F 
Sbjct: 171 LDKAEKSA---------------ISHRYRALRQFA 190


>gi|75760746|ref|ZP_00740768.1| Xanthosine triphosphate pyrophosphatase [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|228903009|ref|ZP_04067148.1| Nucleoside-triphosphatase [Bacillus thuringiensis IBL 4222]
 gi|74491774|gb|EAO54968.1| Xanthosine triphosphate pyrophosphatase [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|228856602|gb|EEN01123.1| Nucleoside-triphosphatase [Bacillus thuringiensis IBL 4222]
          Length = 205

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 108/208 (51%), Gaps = 24/208 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNA 66
            +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++  
Sbjct: 6   QVVVATKNMGKVREFAELFERFNLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQL 65

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
               ++DDSGL++D L+GKPG++SAR+A    GE   D A   I+  L+     D   R 
Sbjct: 66  NSIVIADDSGLIVDALNGKPGVYSARFA----GEPKNDQA--NIDKVLQELNGIDFEKRK 119

Query: 127 AHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++ +
Sbjct: 120 ARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELSSD 179

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFK 212
           EKN                +SHR RA +
Sbjct: 180 EKNA---------------ISHRGRALR 192


>gi|226307365|ref|YP_002767325.1| nucleoside-triphosphatase [Rhodococcus erythropolis PR4]
 gi|226186482|dbj|BAH34586.1| nucleoside-triphosphatase [Rhodococcus erythropolis PR4]
          Length = 202

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 102/211 (48%), Gaps = 25/211 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP----EETGNSFEENAMIKSLTAAK 64
           +++AS N  K+ E+  ++   G+     + L+ + P     E G +FEENA+ K+   A 
Sbjct: 5   VLVASRNAKKLKELHRVLDAAGVNGIELVGLDEVPPFPEAPEAGATFEENALAKARDGAA 64

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             GMP ++DDSG+ ID L+G PG+ SARW    +G    D A   +  A       +   
Sbjct: 65  ATGMPCIADDSGVEIDALNGMPGVLSARW----SGTHGNDGANTALVLAQLGDVPDE--R 118

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F+S  +L  P G      G+  G+I   P G  GFGYDPIF+P+G  R+  E+T  
Sbjct: 119 RGAAFVSACALVIPGGDETVVRGEWRGVIGREPAGDGGFGYDPIFRPDGDTRSAAELTPA 178

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           EK               D  SHR RA    V
Sbjct: 179 EK---------------DAASHRGRALVQLV 194


>gi|254491919|ref|ZP_05105098.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylophaga thiooxidans DMS010]
 gi|224463397|gb|EEF79667.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylophaga thiooxydans DMS010]
          Length = 201

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 111/215 (51%), Gaps = 31/215 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           +NIV+AS N  K+ E   L+ PL I      EL+++  EETG SF ENA++K+  A    
Sbjct: 2   SNIVLASGNKGKLREFAQLLAPLNIEIVPQSELHVVEAEETGLSFVENAILKARNACMQT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD-FDMAMQKIENALRSKFAHDPAFR 125
           G+PA+SDDSG+ +D L G PGI+S+R+A  N  ++D  D  +  I++   ++       R
Sbjct: 62  GLPAISDDSGIEVDALQGAPGIYSSRYAGPNASDQDNIDTLLAAIKDVPEAE-------R 114

Query: 126 SAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           SA F  V+       H ++       G   G I+  P G  GFGYDPIF     + +  E
Sbjct: 115 SARFQCVVVYMR---HAKDPTPLICQGTWHGQIMLQPSGDGGFGYDPIFFVAETETSAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           ++ E+K+                +SHR +A + F+
Sbjct: 172 LSPEQKHA---------------VSHRGQAMRRFI 191


>gi|294056561|ref|YP_003550219.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Coraliomargarita akajimensis DSM 45221]
 gi|293615894|gb|ADE56049.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Coraliomargarita akajimensis DSM 45221]
          Length = 200

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 110/210 (52%), Gaps = 28/210 (13%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKN 65
            ++IA+ N  K+ E + L+  LG    SA ++   +PE  E G++F  NA +K+    K 
Sbjct: 3   QLIIATGNPHKVEEFEGLLEGLGFDVVSA-KVCGGMPEVDENGDTFAANAQLKAEALRKL 61

Query: 66  AGMPA--LSDDSGLVIDVLDGKPGIHSARWAESN-TGERDFDMAMQKIENALRSKFAHDP 122
           A + A  L+DDSGL +D L G PGI+SAR+A  N + E +    ++ I++    +     
Sbjct: 62  APVDAWVLADDSGLEVDALQGAPGIYSARYAGPNASDEANLAKLLEAIKDVPEGE----- 116

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F  VL L  PDG + ++ G   G +     G  GFGYDP F P+GYD+TFGE+ 
Sbjct: 117 --RAARFRCVLCLIDPDGFISHYDGSCEGRMAQEGSGAEGFGYDPAFLPDGYDQTFGELG 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           E  K                 LSHRARA +
Sbjct: 175 EVVKR---------------ELSHRARACQ 189


>gi|254162864|ref|YP_003045972.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli B str. REL606]
 gi|297520256|ref|ZP_06938642.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli OP50]
 gi|222034649|emb|CAP77391.1| HAM1 protein homolog [Escherichia coli LF82]
 gi|242378480|emb|CAQ33264.1| dITP/XTP pyrophosphatase [Escherichia coli BL21(DE3)]
 gi|253974765|gb|ACT40436.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli B str. REL606]
 gi|253978931|gb|ACT44601.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli BL21(DE3)]
 gi|312947485|gb|ADR28312.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O83:H1 str. NRG 857C]
 gi|323971759|gb|EGB66986.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli TA007]
 gi|324005510|gb|EGB74729.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 57-2]
          Length = 197

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVLSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|332289356|ref|YP_004420208.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Gallibacterium anatis UMN179]
 gi|330432252|gb|AEC17311.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Gallibacterium anatis UMN179]
          Length = 198

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 112/213 (52%), Gaps = 33/213 (15%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
           +  I++A+ N  K++EM +++   G    +   L +  PEETG +F ENA+IK+  AAK 
Sbjct: 4   KQKIILATGNQGKVNEMANVLAEFGFEVVAQTALGIESPEETGLTFVENALIKARHAAKI 63

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH----- 120
           +G+PA++DDSGL +D L+G+PG++SAR+A  +  + D            R+K  H     
Sbjct: 64  SGLPAIADDSGLAVDYLNGQPGLYSARFAGEHASDADN-----------RAKLLHLLEGV 112

Query: 121 DPAFRSAHFIS-VLSLAWPDGHVENFS-GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
             A R A F+S ++ L   D  V   + G+  G+I     G+ GFGYD +F       TF
Sbjct: 113 PAAQRKAKFVSCIVLLRSADDPVPIIAQGECEGVITEQEIGENGFGYDALFFYADKQATF 172

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
            ++++EEK                 +SHRARA 
Sbjct: 173 AQLSKEEKQQ---------------ISHRARAL 190


>gi|218701664|ref|YP_002409293.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli IAI39]
 gi|218706469|ref|YP_002413988.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli UMN026]
 gi|293406461|ref|ZP_06650387.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia coli
           FVEC1412]
 gi|298382198|ref|ZP_06991795.1| nucleoside-triphosphatase rdgB [Escherichia coli FVEC1302]
 gi|300900229|ref|ZP_07118413.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 198-1]
 gi|218371650|emb|CAR19489.1| dITP/XTP pyrophosphatase [Escherichia coli IAI39]
 gi|218433566|emb|CAR14469.1| dITP/XTP pyrophosphatase [Escherichia coli UMN026]
 gi|291426467|gb|EFE99499.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia coli
           FVEC1412]
 gi|298277338|gb|EFI18854.1| nucleoside-triphosphatase rdgB [Escherichia coli FVEC1302]
 gi|300356245|gb|EFJ72115.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 198-1]
          Length = 197

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQKNLQKLLETLKDVPDEQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGMITREPAGTGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|255038125|ref|YP_003088746.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dyadobacter fermentans DSM 18053]
 gi|254950881|gb|ACT95581.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dyadobacter fermentans DSM 18053]
          Length = 223

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 111/209 (53%), Gaps = 28/209 (13%)

Query: 9   IVIASHNVDKIHEMDSLIM-PLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +  A++N  K+ E+ +L+     ++T S +  +  IPE   ++  EN+  K+    ++ G
Sbjct: 35  LCFATNNRHKLEEIQALLGDQFELVTLSDIGCDTDIPEPF-DTIAENSRGKAHYVHEHFG 93

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           +   +DD+GLV+  L+G+PG+ SAR+A E      + D+ ++ +          D   RS
Sbjct: 94  IDCFADDTGLVVGALNGEPGVKSARYAGEQRDSNDNIDLLVKSLA---------DKPDRS 144

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           AHF++V++L+  DG    F G V G I+   RG  GFGYDP+F P G+ RTF EMT +EK
Sbjct: 145 AHFLTVITLSL-DGEYYQFEGTVEGTIINEKRGSNGFGYDPVFVPKGHSRTFAEMTMQEK 203

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFV 215
           +                LSHR RAF   V
Sbjct: 204 SD---------------LSHRGRAFAKLV 217


>gi|254389820|ref|ZP_05005044.1| ribonuclease PH/Ham1 protein [Streptomyces clavuligerus ATCC 27064]
 gi|197703531|gb|EDY49343.1| ribonuclease PH/Ham1 protein [Streptomyces clavuligerus ATCC 27064]
          Length = 337

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 113/213 (53%), Gaps = 26/213 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLI----MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
             IV+A+ N  KI E+  ++    +P  ++ T A   ++   +ETG +F ENA++K+ T 
Sbjct: 139 TRIVLATRNAGKITELRQILADARLPHELVGTDAYP-DIPDVKETGVTFAENALLKAHTL 197

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A+  G+PA++DDSGL +DVL G PGI SARWA    G    D A   +  A  S  A  P
Sbjct: 198 ARATGLPAIADDSGLCVDVLGGAPGIFSARWA----GAHGDDAANLALLLAQLSDIA--P 251

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F    +LA PDG      G++ G +   P G  GFGYDPI QP G  RT  E++
Sbjct: 252 EHRAAQFFCAAALALPDGTERVAEGRLLGTLRTTPTGTGGFGYDPILQPEGEARTAAELS 311

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            EEKN                +SHR +AF+  V
Sbjct: 312 PEEKNA---------------ISHRGKAFRALV 329


>gi|167552005|ref|ZP_02345758.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205323301|gb|EDZ11140.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
          Length = 197

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 110/216 (50%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKMT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E+ T +++ +  +  + +    K       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQQNLEKLLHTLRDVPDDK-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I     G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +  EEK+                +SHR +A K  +D
Sbjct: 172 LAREEKSA---------------ISHRGQALKLLLD 192


>gi|163791539|ref|ZP_02185943.1| ribonuclease PH/Ham1 protein [Carnobacterium sp. AT7]
 gi|159873175|gb|EDP67275.1| ribonuclease PH/Ham1 protein [Carnobacterium sp. AT7]
          Length = 432

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 100/188 (53%), Gaps = 17/188 (9%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAK 64
           ++ I+IA++N  K  E ++L    G    +  +   I   EETG +FEENA +K+ T A+
Sbjct: 255 KDEILIATNNAGKAKEFEALFAKKGFKVKTLRDFPEIPEVEETGVTFEENARLKAETIAR 314

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD--- 121
              M  L+DDSGL +D LDG PG+ SAR+A    GE   D A         +K  H+   
Sbjct: 315 RLNMLVLADDSGLKVDALDGAPGVFSARYA----GEFKSDAANN-------AKLMHELTG 363

Query: 122 --PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
                R+A F   L+LA P        G+V GII+  P+G  GFGYDP+F      +T  
Sbjct: 364 VSKEERTAQFHCTLALALPGKDSLVVEGEVEGIILTIPKGDNGFGYDPLFFVESKGKTMA 423

Query: 180 EMTEEEKN 187
           E+T+E+KN
Sbjct: 424 ELTQEDKN 431


>gi|114777662|ref|ZP_01452622.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family protein
           [Mariprofundus ferrooxydans PV-1]
 gi|114551878|gb|EAU54412.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family protein
           [Mariprofundus ferrooxydans PV-1]
          Length = 193

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 103/216 (47%), Gaps = 40/216 (18%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +V+AS+N  K  E+ +++  LGI    A E   +   E  +SF  NA  K+   A   G+
Sbjct: 3   LVVASNNQKKRKEIAAILGSLGIELVPAEETISVDVIEDADSFAGNARKKAEAFASANGL 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFD--------MAMQKIENALRSKFAH 120
           PAL+DDSGL +D L G PGI+S+R+A    GE   D         A+  I+N        
Sbjct: 63  PALADDSGLCVDALGGAPGIYSSRYA----GEDGSDAANNAKLLQALAGIDN-------- 110

Query: 121 DPAFRSAHFISVLSLAWPDGHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
               RSAHF   + LA+PDG       G V G+I+  P G  GFGYDP+F     D+ F 
Sbjct: 111 ----RSAHFSCAIHLAYPDGRAPVTAEGHVDGMILSQPAGSSGFGYDPLFYCPELDKVFA 166

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           E + EEK                 +SHR RA +   
Sbjct: 167 EASAEEKAS---------------VSHRGRALRALA 187


>gi|307132434|ref|YP_003884450.1| dITP/XTP pyrophosphatase [Dickeya dadantii 3937]
 gi|306529963|gb|ADM99893.1| dITP/XTP pyrophosphatase [Dickeya dadantii 3937]
          Length = 197

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 109/216 (50%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
            N+V+A+ N  K+ E+  L+   G+   +   L +   EETG +F ENA++K+  AA+  
Sbjct: 2   QNVVLATGNAGKVRELAGLLADFGLDVVAQTALGVDSAEETGLTFIENAILKARHAARET 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL ++ L G PGI+SAR+A  +  +R + D  +  ++N    +       R
Sbjct: 62  GLPAIADDSGLAVNALGGAPGIYSARYAGEDASDRQNLDKLLAALDNVPDEQ-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H ++ +     G   G+I   P G  GFGYDP+F      +T  E
Sbjct: 115 QASFHCVLVYLR---HADDPTPLVCHGSWQGVIARTPVGAGGFGYDPVFFVPSIGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           ++ EEKN                LSHR +A +  +D
Sbjct: 172 LSREEKNA---------------LSHRGQALRQLLD 192


>gi|229192692|ref|ZP_04319651.1| Nucleoside-triphosphatase [Bacillus cereus ATCC 10876]
 gi|228590782|gb|EEK48642.1| Nucleoside-triphosphatase [Bacillus cereus ATCC 10876]
          Length = 205

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 108/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + +K 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSKQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEIPFDK------- 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEGDKKPVIVNGTCEGYILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|204928158|ref|ZP_03219358.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|204322480|gb|EDZ07677.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
          Length = 197

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKMT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR++ E+ T +++ +  +  + +    K       R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQQNLEKLLHTLRDVPDDK-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I     G  GFGYDPIF      +T  E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPIVCHGSWPGVINRQAVGNGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|299535539|ref|ZP_07048860.1| HAM1-like protein [Lysinibacillus fusiformis ZC1]
 gi|298728739|gb|EFI69293.1| HAM1-like protein [Lysinibacillus fusiformis ZC1]
          Length = 197

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 96/180 (53%), Gaps = 8/180 (4%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNA 66
            +VIA+ N  K  + ++L  PLG    +  E+   +  EETG +FEENA++K+   AK  
Sbjct: 3   QVVIATKNKGKAKDFEALFGPLGYEVVTMFEVAPDMEIEETGTTFEENAILKAEALAKEL 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
               ++DDSGL +D L+G+PG++SAR+A  +  E +    ++ ++     K       R+
Sbjct: 63  NTIVIADDSGLAVDALNGEPGVYSARYAGDHDDEANMIKLLENLQGVEDDK-------RT 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F   +++A PD       G   G+I    RG  GFGYDPIF     +R   E++ EEK
Sbjct: 116 ARFCCCIAIAGPDFATTTVFGTCEGVIAHEKRGTNGFGYDPIFFVPSLNRMMAELSPEEK 175


>gi|56421200|ref|YP_148518.1| nucleoside-triphosphatase [Geobacillus kaustophilus HTA426]
 gi|62900155|sp|Q5KWI6|NTPA_GEOKA RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|56381042|dbj|BAD76950.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
          Length = 204

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 103/207 (49%), Gaps = 24/207 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             IVIA+ N  K+ E  +L    G+   S L+  +     ETG++F ENA++K+  A++ 
Sbjct: 2   KEIVIATKNAGKVREFAALFAKRGVEVKSLLDFPDAPDVAETGSTFAENAVLKAEAASRR 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
              P ++DDSGLV+D L G+PG+HSAR+A E     R+    +++++     +       
Sbjct: 62  LKRPVIADDSGLVVDALGGRPGVHSARYAGEDKNDARNIAKLLRELDGVPMEQ------- 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P            G I   PRG+ GFGYDP+F      +T  E+  E
Sbjct: 115 RTARFHCALAVAIPGRPTAVVEATCDGYIAEAPRGEGGFGYDPVFYLPERGKTMAELAPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAF 211
           EKN                +SHRA+A 
Sbjct: 175 EKN---------------QISHRAKAL 186


>gi|251777755|ref|ZP_04820675.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|243082070|gb|EES47960.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 205

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/229 (33%), Positives = 116/229 (50%), Gaps = 35/229 (15%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKS 59
           M+KLI     +AS+N+ KI EM  L+  L I   S  E N+ I  EE G++FEENA  K+
Sbjct: 1   MKKLI-----LASNNIKKIKEMKELLKDLNIEIKSLNEENINIDVEEDGSTFEENAKKKA 55

Query: 60  ------LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIEN 112
                 L          LSDDSGL +D L+G PGI+SAR+A E    E++ +  + ++ N
Sbjct: 56  KEIYDFLKLRNEKNFLVLSDDSGLEVDYLNGAPGIYSARYAGEHGNDEKNNEKLLMELSN 115

Query: 113 ALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPN 172
              +K       R+A F+  +++   +G   + +G+ +G ++   +G  GFGYDP+F   
Sbjct: 116 VPTNK-------RTAKFVCQIAMFDEEGRYYSITGEANGFVLEKRQGNDGFGYDPLFLYR 168

Query: 173 GYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
             ++TF E+T EEKN                +SHR  A K      L +
Sbjct: 169 PLNKTFAELTLEEKNN---------------ISHRGVALKKLKKTILNL 202


>gi|229918349|ref|YP_002886995.1| nucleoside-triphosphatase [Exiguobacterium sp. AT1b]
 gi|259514633|sp|C4L4I7|NTPA_EXISA RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|229469778|gb|ACQ71550.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Exiguobacterium sp. AT1b]
          Length = 196

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 108/206 (52%), Gaps = 24/206 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNA 66
            ++IA+HN  K+ E++ ++ PLG    S L+  +    +ETG +FEENA +K+  AA   
Sbjct: 2   KLIIATHNPGKVKELEGMLTPLGFEVESLLDYPDAPETDETGTTFEENAALKATEAAAYF 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G   L+DDSGL +D LDG PG++SAR+A    G    D A     NAL  +  +    R+
Sbjct: 62  GHAVLADDSGLEVDALDGAPGVYSARFA----GPEKSDEA----NNALLLEKLNGETNRT 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+  L LA P G      G + G I + P+G+ GFGYDP+F      +T  E+  +EK
Sbjct: 114 ARFVCALCLAKPSGETLTVRGTIEGTIGYSPQGENGFGYDPLFIVPSLHKTAAELERDEK 173

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
                           ++SHR +A +
Sbjct: 174 A---------------VVSHRGQALR 184


>gi|257056883|ref|YP_003134715.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Saccharomonospora viridis DSM 43017]
 gi|256586755|gb|ACU97888.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Saccharomonospora viridis DSM 43017]
          Length = 206

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 114/228 (50%), Gaps = 30/228 (13%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP----EETGNSFEENAMIKSL 60
           +   +++A+ N  K+ E+  ++   G+     + ++ + P     ETG +FEENA+ K+ 
Sbjct: 1   MSTRVLLATRNASKLKELRRILAEAGVDGLEVVGMSDVEPFDEAPETGATFEENALAKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+ A++DDSGL +D L+G PG+ SARW    +G    D A  ++   L  + A 
Sbjct: 61  DAAKATGLAAVADDSGLTVDALNGMPGVLSARW----SGAHGDDAANLRL---LLGQLAD 113

Query: 121 DP-AFRSAHFISVLSLAWPD--GHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
            P   R A F+  ++L  P   G  E     +  G +   PRG+ GFGYDPIF P G  R
Sbjct: 114 VPDERRGAAFVCAVALVVPGDAGPREVVLRREWRGTLARQPRGENGFGYDPIFVPEGGSR 173

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           T  E+  EEK               D +SHR +A +  V +   + ++
Sbjct: 174 TAAELAPEEK---------------DAVSHRGQALRALVSHLRELAQQ 206


>gi|229111952|ref|ZP_04241496.1| Nucleoside-triphosphatase [Bacillus cereus Rock1-15]
 gi|228671516|gb|EEL26816.1| Nucleoside-triphosphatase [Bacillus cereus Rock1-15]
          Length = 205

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 110/217 (50%), Gaps = 26/217 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEIPFDK------- 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            +EKN                +SHR RA +   +  L
Sbjct: 178 SDEKNA---------------ISHRGRALRKLEEKTL 199


>gi|229019706|ref|ZP_04176513.1| Nucleoside-triphosphatase [Bacillus cereus AH1273]
 gi|229027353|ref|ZP_04183608.1| Nucleoside-triphosphatase [Bacillus cereus AH1272]
 gi|228733961|gb|EEL84700.1| Nucleoside-triphosphatase [Bacillus cereus AH1272]
 gi|228741613|gb|EEL91806.1| Nucleoside-triphosphatase [Bacillus cereus AH1273]
          Length = 205

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 109/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNLGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++ +        D   
Sbjct: 65  LNSIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELTDI-------DLEK 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R+A F   L++A+P+   E    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RTARFYCALAVAFPEADKEPVIVNGTCEGKILEQRRGENGFGYDPIFYVEKYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|294501439|ref|YP_003565139.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacillus megaterium QM B1551]
 gi|294351376|gb|ADE71705.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacillus megaterium QM B1551]
          Length = 197

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 105/206 (50%), Gaps = 24/206 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           I+IA+ N  K+ + ++L  P G    S L+   I   EETG +F ENA +K+   +    
Sbjct: 4   IIIATKNAGKVKDFETLFSPKGFKVKSLLDFPEIEDVEETGVTFAENATLKAEAISSALN 63

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-DFDMAMQKIENALRSKFAHDPAFRS 126
            P ++DDSGL ID L+G+PG++SAR+A  N  +  + +  +QK+ +    K       R+
Sbjct: 64  KPVIADDSGLAIDALNGEPGVYSARYAGENKDDNANIEKVLQKLNDVPFEK-------RT 116

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F   L++A P    E   G   G I+   RG+ GFGYDPIF    +  +  E+T+ +K
Sbjct: 117 ARFHCALAIAVPGKRTEIVEGTCEGHILEEKRGENGFGYDPIFFVEKWRCSMAELTKGQK 176

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                +SHRA A K
Sbjct: 177 NQ---------------ISHRANALK 187


>gi|301055991|ref|YP_003794202.1| HAM1 protein-like protein [Bacillus anthracis CI]
 gi|300378160|gb|ADK07064.1| HAM1 protein-like protein [Bacillus cereus biovar anthracis str.
           CI]
          Length = 202

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 111/212 (52%), Gaps = 30/212 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 2   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++         ++ AF
Sbjct: 62  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQEL---------NEVAF 112

Query: 125 --RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E
Sbjct: 113 ENRKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAE 172

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
           ++ +EKN                +SHR RA +
Sbjct: 173 LSSDEKNA---------------ISHRGRALR 189


>gi|188587875|ref|YP_001919837.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Clostridium botulinum E3 str. Alaska E43]
 gi|188498156|gb|ACD51292.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Clostridium botulinum E3 str. Alaska E43]
          Length = 205

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/229 (33%), Positives = 116/229 (50%), Gaps = 35/229 (15%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKS 59
           M+KLI     +AS+N+ KI EM  L+  L I   S  E N+ I  EE G++FEENA  K+
Sbjct: 1   MKKLI-----LASNNIKKIKEMKELLKDLNIEIKSLNEENINIDVEEDGSTFEENAKKKA 55

Query: 60  ------LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIEN 112
                 L          LSDDSGL +D L+G PGI+SAR+A E    E++ +  + ++ N
Sbjct: 56  KEIYDFLNLRNERNFLVLSDDSGLEVDYLNGAPGIYSARYAGEHGNDEKNNEKLLMELSN 115

Query: 113 ALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPN 172
              +K       R+A F+  +++   +G   + +G+ +G ++   +G  GFGYDP+F   
Sbjct: 116 VPTNK-------RTAKFVCQIAMFDEEGRYYSITGEANGFVLEKRQGNDGFGYDPLFLYR 168

Query: 173 GYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
             ++TF E+T EEKN                +SHR  A K      L +
Sbjct: 169 PLNKTFAELTLEEKNN---------------ISHRGVALKKLKKTILNL 202


>gi|224370807|ref|YP_002604971.1| nucleoside-triphosphatase [Desulfobacterium autotrophicum HRM2]
 gi|223693524|gb|ACN16807.1| Ham [Desulfobacterium autotrophicum HRM2]
          Length = 217

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/187 (34%), Positives = 105/187 (56%), Gaps = 9/187 (4%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKS 59
           M+++    +VIA+ N  K  E+ +L+    +   +  +   I   EE G +F++NA  K+
Sbjct: 1   MQEIQVTILVIATRNKGKTREIRALLKGFPVEIKNLDDFGPIPEIEEDGETFDDNAYKKA 60

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
             AA+  G PA++DDSGLV+D LDG PG+ SAR+A  N  +R+     +K+   ++ K  
Sbjct: 61  AFAARVLGYPAMADDSGLVVDALDGAPGVRSARYAGENATDRE---NWEKLLEQMKGK-- 115

Query: 120 HDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
                R A F  V+S+A P G    + G+  G I+  P G+ GFGYDP+F     ++TF 
Sbjct: 116 ---TNRKAAFQCVISIAVPTGAALTYEGQCQGTILEQPSGENGFGYDPLFFYPELNKTFA 172

Query: 180 EMTEEEK 186
           +++ +EK
Sbjct: 173 QISMDEK 179


>gi|186684581|ref|YP_001867777.1| deoxyribonucleotide triphosphate pyrophosphatase [Nostoc
           punctiforme PCC 73102]
 gi|186467033|gb|ACC82834.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Nostoc
           punctiforme PCC 73102]
          Length = 194

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 110/218 (50%), Gaps = 31/218 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGI-MTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +V+A+ N  K+ EM + +   G  +T    EL++   EETG +F  NA +K+   AK  G
Sbjct: 5   LVVATGNPGKLREMQAYLKNSGWELTLKPEELDI---EETGETFAANACLKASQIAKATG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             A++DDSGL +D L+G PG++SAR+A++++         ++I   L  K   +   R A
Sbjct: 62  NWAIADDSGLQVDALNGAPGVYSARYAKTDS---------ERIARLL--KELGNEVNRQA 110

Query: 128 HFISVLSLAWPDGH-VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+  +++A PDG  V    G   G I+  PRG  GFGYDPIF       TF EMT E K
Sbjct: 111 QFVCAVAIARPDGAIVLESEGICRGEILHAPRGDSGFGYDPIFYVQELQLTFAEMTRELK 170

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
                            +SHR +AF   +    RI  +
Sbjct: 171 GS---------------ISHRGKAFTALLPQLERIKRR 193


>gi|228941668|ref|ZP_04104215.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228974595|ref|ZP_04135161.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228981190|ref|ZP_04141490.1| Nucleoside-triphosphatase [Bacillus thuringiensis Bt407]
 gi|228778390|gb|EEM26657.1| Nucleoside-triphosphatase [Bacillus thuringiensis Bt407]
 gi|228784998|gb|EEM33011.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228817880|gb|EEM63958.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar berliner
           ATCC 10792]
          Length = 205

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 108/209 (51%), Gaps = 24/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                ++DDSGL++D L+GKPG++SAR+A    GE   D A   I+  L+     D   R
Sbjct: 65  LNSIVIADDSGLIVDALNGKPGVYSARFA----GEPKNDQA--NIDKVLQELNGVDFEKR 118

Query: 126 SAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++ 
Sbjct: 119 KARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELSS 178

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
           +EKN                +SHR RA +
Sbjct: 179 DEKNA---------------ISHRGRALR 192


>gi|217961975|ref|YP_002340545.1| HAM1 protein [Bacillus cereus AH187]
 gi|222097943|ref|YP_002532000.1| nucleoside-triphosphatase [Bacillus cereus Q1]
 gi|217065400|gb|ACJ79650.1| HAM1 protein [Bacillus cereus AH187]
 gi|221242001|gb|ACM14711.1| Nucleoside-triphosphatase [Bacillus cereus Q1]
          Length = 202

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 109/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 2   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 62  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEIPFDK------- 114

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y ++  E++
Sbjct: 115 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKSMAELS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 175 SDEKNA---------------ISHRGRALR 189


>gi|326942276|gb|AEA18172.1| nucleoside-triphosphatase [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 202

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 108/209 (51%), Gaps = 24/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 2   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                ++DDSGL++D L+GKPG++SAR+A    GE   D A   I+  L+     D   R
Sbjct: 62  LNSIVIADDSGLIVDALNGKPGVYSARFA----GEPKNDQA--NIDKVLQELNGVDFEKR 115

Query: 126 SAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++ 
Sbjct: 116 KARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELSS 175

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
           +EKN                +SHR RA +
Sbjct: 176 DEKNA---------------ISHRGRALR 189


>gi|258645722|ref|ZP_05733191.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Dialister invisus DSM 15470]
 gi|260403091|gb|EEW96638.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Dialister invisus DSM 15470]
          Length = 197

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 100/181 (55%), Gaps = 7/181 (3%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNA 66
            +V+A+ N  KI E       +G       ++ ++  PEETG +F ENA+ K+   A+  
Sbjct: 2   KVVLATRNQGKIREFQKHFSEIGWEVIPIADIADIPEPEETGTTFRENALQKARYYAEAV 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +P LSDDSG++ DVL  +PG++SAR+A  +  +   +   QK+   LR    +    R 
Sbjct: 62  NLPVLSDDSGIIADVLGNEPGVYSARYAGVHGND---EANNQKLVEVLRP---YRGEARR 115

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            H++ V+++ WPDG      G+ +GII    +G  GFGYDP+F    + +T  E++ EEK
Sbjct: 116 GHYMCVIAVVWPDGREITAEGRCNGIIRDFYKGTGGFGYDPLFYLPEFGKTMAELSMEEK 175

Query: 187 N 187
           N
Sbjct: 176 N 176


>gi|261368255|ref|ZP_05981138.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Subdoligranulum variabile DSM 15176]
 gi|282569770|gb|EFB75305.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Subdoligranulum variabile DSM 15176]
          Length = 211

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/219 (34%), Positives = 108/219 (49%), Gaps = 38/219 (17%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAKNAG 67
           I  AS+N  K+ E+  ++  +G    S  EL + + PEETG +F ENA IK+    K +G
Sbjct: 3   ICAASNNAGKLKELRRILERMGHEVKSLRELGIALDPEETGTTFAENARIKAEAFCKASG 62

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA-LRSKFAHDPA-FR 125
           +P ++DDSGL +D L G PG++SAR+A    G    D A     NA L  + A  PA  R
Sbjct: 63  LPTVADDSGLCVDALHGAPGVYSARYA----GHHGDDAA----NNAKLLREMADVPAEQR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQP------------NG 173
           +A F+S +    PDG      G+  G + +   G  GFGYDP+F P            N 
Sbjct: 115 TARFVSAVCFLLPDGRELLVEGECPGSVAFTETGTNGFGYDPLFIPDRVGLPDGTTIENT 174

Query: 174 YDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
             R++ E+ + EK               D +SHR RA +
Sbjct: 175 ARRSYAELADGEK---------------DAISHRGRAME 198


>gi|229141222|ref|ZP_04269761.1| Nucleoside-triphosphatase [Bacillus cereus BDRD-ST26]
 gi|228642263|gb|EEK98555.1| Nucleoside-triphosphatase [Bacillus cereus BDRD-ST26]
          Length = 205

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 109/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEIPFDK------- 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y ++  E++
Sbjct: 118 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKSMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|228967583|ref|ZP_04128607.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228792107|gb|EEM39685.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar sotto
           str. T04001]
          Length = 205

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 108/209 (51%), Gaps = 24/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                ++DDSGL++D L+GKPG++SAR+A    GE   D A   I+  L+     D   R
Sbjct: 65  LNSIVIADDSGLIVDALNGKPGVYSARFA----GEPKNDQA--NIDKVLQELNGIDFEKR 118

Query: 126 SAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++ 
Sbjct: 119 KARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELSS 178

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
           +EKN                +SHR RA +
Sbjct: 179 DEKNA---------------ISHRGRALR 192


>gi|149176461|ref|ZP_01855075.1| xanthosine triphosphate pyrophosphatase [Planctomyces maris DSM
           8797]
 gi|148844813|gb|EDL59162.1| xanthosine triphosphate pyrophosphatase [Planctomyces maris DSM
           8797]
          Length = 216

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 113/220 (51%), Gaps = 33/220 (15%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE-----ETGNSFEENAMIKSLTAA 63
           IV+AS N  K  E+  L+ P GI   S  +     PE     E G++F ENA  K+   A
Sbjct: 17  IVLASRNQKKAGEISELLAPHGIQVQSVADF----PEAEEVVEDGSTFGENAAKKAAQTA 72

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDP 122
           +      + +DSGL+IDVLDG PGI+SAR++ E+ T E++ +  +Q++      K     
Sbjct: 73  RTLSHWTIGEDSGLMIDVLDGAPGIYSARFSGENATDEKNNEKMLQELSGVPLEK----- 127

Query: 123 AFRSAHFISVLSLAWPDGHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
             R+A ++  ++L+ P G +      +  G +   PRGQ GFGYDP F+     +TFGE+
Sbjct: 128 --RTAAYVCNVALSDPTGEICLQVEARCRGRMTQAPRGQNGFGYDPYFEIIELHKTFGEL 185

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
                          + +    LSHRARAF+ F+   +R+
Sbjct: 186 ---------------APIVKQHLSHRARAFERFIPQLVRL 210


>gi|218899647|ref|YP_002448058.1| HAM1 protein [Bacillus cereus G9842]
 gi|218545896|gb|ACK98290.1| HAM1 protein [Bacillus cereus G9842]
          Length = 202

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 108/209 (51%), Gaps = 24/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 2   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                ++DDSGL++D L+GKPG++SAR+A    GE   D A   I+  L+     D   R
Sbjct: 62  LNSIVIADDSGLIVDALNGKPGVYSARFA----GEPKNDQA--NIDKVLQELNGIDFEKR 115

Query: 126 SAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++ 
Sbjct: 116 KARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELSS 175

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
           +EKN                +SHR RA +
Sbjct: 176 DEKNA---------------ISHRGRALR 189


>gi|237739457|ref|ZP_04569938.1| nucleoside-triphosphatase [Fusobacterium sp. 2_1_31]
 gi|229423065|gb|EEO38112.1| nucleoside-triphosphatase [Fusobacterium sp. 2_1_31]
          Length = 262

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 109/206 (52%), Gaps = 27/206 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           I +A+ N  KI E+  +   +  +   +++  + IPE  E G +FEEN+  K++  AK  
Sbjct: 71  IFLATGNKHKIEEISDIFSDIENVEILSIKDGVEIPEVIEDGTTFEENSKKKAVEIAKFL 130

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            M  ++DDSGL +D L+G+PG++SAR+  S TG+ D     + IEN            R 
Sbjct: 131 NMITIADDSGLCVDALNGEPGVYSARY--SGTGD-DLKNNEKLIENL------KGLENRK 181

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+SV++LA P+G   +F G++ G IV  PRG  GFGYDP F    Y +T  E+ E   
Sbjct: 182 AKFVSVITLAKPNGETFSFEGEILGEIVDNPRGNTGFGYDPHFYVEEYQKTLAELPE--- 238

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
                          + +SHRA+A +
Sbjct: 239 -------------LKNKISHRAKALE 251


>gi|229013695|ref|ZP_04170824.1| Nucleoside-triphosphatase [Bacillus mycoides DSM 2048]
 gi|229169221|ref|ZP_04296935.1| Nucleoside-triphosphatase [Bacillus cereus AH621]
 gi|228614287|gb|EEK71398.1| Nucleoside-triphosphatase [Bacillus cereus AH621]
 gi|228747617|gb|EEL97491.1| Nucleoside-triphosphatase [Bacillus mycoides DSM 2048]
          Length = 205

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 109/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNLGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++ +        D   
Sbjct: 65  LNSIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELTDI-------DLEK 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R+A F   L++A+P+   E    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RTARFYCALAVAFPEADKEPVIVNGTCEGKILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|255693147|ref|ZP_05416822.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides finegoldii DSM 17565]
 gi|260621102|gb|EEX43973.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides finegoldii DSM 17565]
          Length = 194

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 109/186 (58%), Gaps = 12/186 (6%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIM-PLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           +++  +V A++N  K+ E+ +++   + +++ + ++ +  IPE T ++ E NA++KS   
Sbjct: 1   MMKRKLVFATNNAHKLEEVAAILGDQIELLSLNDIDCHTDIPE-TADTLEGNALLKSSFI 59

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFAHD 121
             N G+   +DD+GL ++ LDG PG++SAR+A    GE  D    M K+ + L  K    
Sbjct: 60  YNNYGLNCFADDTGLEVEALDGAPGVYSARYA---GGEGHDAQANMLKLLHELEGKENRK 116

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
             FR+A  IS++     DG    F G + G I+   RG+ GFGYDP+FQP GYD+TF E+
Sbjct: 117 AQFRTA--ISLI----LDGKNYLFEGIIKGEIIKEKRGESGFGYDPVFQPEGYDKTFAEL 170

Query: 182 TEEEKN 187
             + KN
Sbjct: 171 GNDIKN 176


>gi|113953334|ref|YP_729508.1| deoxyribonucleotide triphosphate pyrophosphatase [Synechococcus sp.
           CC9311]
 gi|122945846|sp|Q0IDG4|NTPA_SYNS3 RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|113880685|gb|ABI45643.1| non-canonical purine NTP pyrophosphatase [Synechococcus sp. CC9311]
          Length = 206

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 97/179 (54%), Gaps = 14/179 (7%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +VIAS N  KI E  +L+  L +      + + I  EETG +F +NA++K+   A+  G 
Sbjct: 6   LVIASGNAGKIREFSNLLQELPLQVNP--QPDGIQVEETGITFRDNALLKARAVAEATGH 63

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
            AL+DDSGL +D L G PG++SAR+A S+          ++IE  L  K   D   R A 
Sbjct: 64  WALADDSGLSVDALGGAPGVYSARYANSDP---------ERIERLL--KELGDRTDRQAR 112

Query: 129 FISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           F + L +A PDG V     G   G I +  RG  GFGYDP+F+      TF EMT++ K
Sbjct: 113 FSAALCIAAPDGSVLAAVEGYCEGSITFSARGTQGFGYDPVFEVKNSGLTFAEMTQDHK 171


>gi|33864770|ref|NP_896329.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Synechococcus sp. WH 8102]
 gi|62900258|sp|Q7U9M0|NTPA_SYNPX RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|33632293|emb|CAE06749.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 195

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 107/209 (51%), Gaps = 21/209 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
             +VIAS N  KI E   L+  +PL +      +      EETG++F  NA IK+   A 
Sbjct: 2   RTLVIASGNAGKIREFQGLLQHLPLNVQA----QPQGFDVEETGSTFAANARIKATAVAA 57

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            AG  AL+DDSGL ++ L G PG+HSAR+A ++  ER     ++K+  AL      + + 
Sbjct: 58  MAGSWALADDSGLSVNALGGAPGVHSARYAPTDP-ER-----IEKLLGAL-----SNASE 106

Query: 125 RSAHFISVLSLAWPDGHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           R A F + L +A PDG V     G+  G I   PRG  GFGYDPIF+ +    TF +M  
Sbjct: 107 RHAQFCAALCVAAPDGSVLIEVEGRCDGWITTTPRGDGGFGYDPIFEVSCTGLTFAQMPL 166

Query: 184 EEKNGGIDSATLFSILS---TDLLSHRAR 209
            EK         F++L     DLLS   R
Sbjct: 167 TEKKSHGHRGKAFALLEPQLQDLLSAEPR 195


>gi|229163444|ref|ZP_04291395.1| Nucleoside-triphosphatase [Bacillus cereus R309803]
 gi|228620013|gb|EEK76888.1| Nucleoside-triphosphatase [Bacillus cereus R309803]
          Length = 205

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 108/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNLGKVREFAELFGRFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++ +        D   
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNDV-------DFEK 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+   E    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEADKEPVIVNGTCEGYILEQRRGENGFGYDPIFYVKEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|255282107|ref|ZP_05346662.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bryantella formatexigens DSM 14469]
 gi|255267426|gb|EET60631.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bryantella formatexigens DSM 14469]
          Length = 211

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 104/209 (49%), Gaps = 22/209 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAA 63
           +E  I+ A+ N  K+ E+  ++  LG+   S  E  +    EE G SF ENAMIK+    
Sbjct: 1   MEGKIIFATGNEGKMKEVRMILADLGVPVLSQKEAGITADVEENGASFAENAMIKACAVK 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K      L+DDSGL ID LDG PGI+SAR+    T    +++  + I   L       P 
Sbjct: 61  KLTDAVVLADDSGLEIDYLDGAPGIYSARYMGEQT---PYEVKNRHILELLADV---PPK 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+ V++ A PDG V    G + G I +   G+ GFGYDP+F    Y  T  E++ 
Sbjct: 115 KRTARFVCVIAAALPDGTVLTSEGVMEGEIGYASAGENGFGYDPVFYLPQYGCTSAEISP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
           E+KN                +SHR +A +
Sbjct: 175 EQKNE---------------ISHRGKALR 188


>gi|189460216|ref|ZP_03009001.1| hypothetical protein BACCOP_00853 [Bacteroides coprocola DSM 17136]
 gi|189433077|gb|EDV02062.1| hypothetical protein BACCOP_00853 [Bacteroides coprocola DSM 17136]
          Length = 194

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 111/215 (51%), Gaps = 29/215 (13%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMP-LGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           ++  +V A++N  K+ E+ +++   + +++   +     IPE T ++ E NA +K+    
Sbjct: 1   MKKKLVFATNNAHKLDEIRAILGDRVEVLSLKDIHCEADIPE-TADTLEGNAALKAEYIY 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFAHDP 122
           KN G+   +DD+GL ++VL G PG++SAR+A    GE  D +  M+K+   L  K     
Sbjct: 60  KNYGLDCFADDTGLEVEVLGGAPGVYSARYA---GGEGHDSEANMKKLLVELEGKTNRKA 116

Query: 123 AFRSAHFISVLSLAWPDGHVEN-FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            FR+A       +   +G  E+ F G V G I+   RG  GFGYDP+F P GY  TF EM
Sbjct: 117 QFRTA-------ICLIEGGTEHLFEGVVKGEIIEKKRGCSGFGYDPVFVPEGYTETFAEM 169

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
             EEKN                +SHRARA +   D
Sbjct: 170 GNEEKNK---------------ISHRARATQKLCD 189


>gi|282889897|ref|ZP_06298435.1| hypothetical protein pah_c005o032 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281500220|gb|EFB42501.1| hypothetical protein pah_c005o032 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 197

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 110/209 (52%), Gaps = 28/209 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNL---IIPEETGNSFEENAMIKSLTAAKN 65
           IV+AS N+ KI E   +   L  +   +L LN      P E G +F+ENA +K++ AAK 
Sbjct: 3   IVLASSNLHKIREFREMFKSLPRIDVLSL-LNFPQYKSPVEEGKTFQENAQLKAVDAAKV 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            G   L+DDSGLV+  LDG PGI+S R+A E  T   +    +Q +++    +       
Sbjct: 62  LGKWVLADDSGLVVPALDGAPGIYSRRYAGEDATDAENRQKLLQNLQHLSEIQ------- 114

Query: 125 RSAHFISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           RSA+F   L LA P G V ++ +G   G ++   +G+ GFGYD +F  + YD+TF E+ +
Sbjct: 115 RSAYFQCSLVLALPTGEVKKSVTGICEGFLLKEEKGRYGFGYDSLFVKHDYDKTFAELDD 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
             KN                +SHR +AF+
Sbjct: 175 STKNR---------------ISHRYKAFE 188


>gi|256026996|ref|ZP_05440830.1| ribonuclease PH [Fusobacterium sp. D11]
 gi|289764980|ref|ZP_06524358.1| ribonuclease ph [Fusobacterium sp. D11]
 gi|289716535|gb|EFD80547.1| ribonuclease ph [Fusobacterium sp. D11]
          Length = 428

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 111/206 (53%), Gaps = 27/206 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           I +A+ N  KI E+  +   +  +   +++  + IPE  E G +FE+N+  K++  +K  
Sbjct: 244 IFLATANKHKIDEISDIFSGIENIEILSIKDGIEIPEVIEDGKTFEDNSKKKAVEISKFL 303

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            M  ++DDSGL +D L+G+PG++SAR+  S TG+ D     + IEN            R+
Sbjct: 304 NMITIADDSGLCVDALNGEPGVYSARY--SGTGD-DLKNNEKLIENL------KGIENRN 354

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+SV++LA P+G   +F G+++G IV  PRG  GFGYDP F    Y +T  E+ E   
Sbjct: 355 AKFVSVITLARPNGETYSFRGEINGKIVDTPRGNTGFGYDPHFYVEEYQKTLAELPE--- 411

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
                          + +SHRA+A +
Sbjct: 412 -------------LKNKISHRAKALE 424


>gi|238855623|ref|ZP_04645924.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Lactobacillus jensenii 269-3]
 gi|282933003|ref|ZP_06338397.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Lactobacillus jensenii 208-1]
 gi|238831767|gb|EEQ24103.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Lactobacillus jensenii 269-3]
 gi|281302857|gb|EFA95065.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Lactobacillus jensenii 208-1]
          Length = 205

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 113/216 (52%), Gaps = 32/216 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMPLG----IMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++ A++N +K+ E+ +     G    + T + LE    +  E G++FEENA +K+   A+
Sbjct: 5   LLFATNNKNKVKELKAAFRKAGLDIEVKTNADLEAAPHV-NENGSTFEENATLKAHALAE 63

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARW-AESNTGERDFDMAMQKIENALRSKFAHDPA 123
            + MP LSDDSGLV+D L+G PG+HSAR+  E++   R+    +  +      +      
Sbjct: 64  FSKMPTLSDDSGLVVDKLNGAPGVHSARYGGEAHNDARNNAKLLASLGGIPEEE------ 117

Query: 124 FRSAHFISVLSLAWPDGHVEN---FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            RSA F S   L+ P GH +     +G+  G+++  PRG  GFGYDP+F      +TF E
Sbjct: 118 -RSAKFCSTFVLSMP-GHFDKDLVVTGECEGVVLAIPRGHDGFGYDPLFYVPEKGKTFAE 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           MT +EKN                +SHR +A K  V+
Sbjct: 176 MTTDEKNE---------------ISHRGKALKQLVE 196


>gi|150003715|ref|YP_001298459.1| putative deoxyribonucleoside-triphosphatase [Bacteroides vulgatus
           ATCC 8482]
 gi|254881055|ref|ZP_05253765.1| nucleoside triphosphate phosphohydrolase [Bacteroides sp.
           4_3_47FAA]
 gi|294777463|ref|ZP_06742914.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides vulgatus PC510]
 gi|319640062|ref|ZP_07994789.1| nucleoside-triphosphatase [Bacteroides sp. 3_1_40A]
 gi|149932139|gb|ABR38837.1| putative xanthosine triphosphate pyrophosphatase [Bacteroides
           vulgatus ATCC 8482]
 gi|254833848|gb|EET14157.1| nucleoside triphosphate phosphohydrolase [Bacteroides sp.
           4_3_47FAA]
 gi|294448531|gb|EFG17080.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides vulgatus PC510]
 gi|317388340|gb|EFV69192.1| nucleoside-triphosphatase [Bacteroides sp. 3_1_40A]
          Length = 193

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/186 (33%), Positives = 102/186 (54%), Gaps = 14/186 (7%)

Query: 5   IENNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           ++  +V A++N  K+ E+ S++   + +++   +  ++ IPE T ++ E NAM+K+    
Sbjct: 1   MKKKLVFATNNAHKLDEISSILGEKVELLSLKDIHCHVDIPE-TADTLEGNAMLKAEYIY 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWA--ESNTGERDFDMAMQKIENALRSKFAHD 121
           KN G+   +DD+GL ++ L+G PG++SAR+A  E +  E +    +Q ++          
Sbjct: 60  KNYGLDCFADDTGLEVEALNGAPGVYSARYAGGEGHNAEANMQKLLQNMQGVQN------ 113

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F + + L   DG    F G V G I+   RG  GFGYDPIF P GY +TF E+
Sbjct: 114 ---RKAQFRTAICLIL-DGKKHLFEGIVKGEIIKEKRGSSGFGYDPIFVPEGYTKTFAEL 169

Query: 182 TEEEKN 187
             E KN
Sbjct: 170 GNETKN 175


>gi|229495398|ref|ZP_04389133.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Porphyromonas endodontalis ATCC 35406]
 gi|229317841|gb|EEN83739.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Porphyromonas endodontalis ATCC 35406]
          Length = 196

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 106/208 (50%), Gaps = 24/208 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            ++ A++N  K+ E+  ++     + + A       P E   + E NA+IK   A + + 
Sbjct: 3   KLLFATNNTHKLAEVRQILQERCTLISLAEAGVQSNPVEDAPTLEGNALIKVRDAHRLSQ 62

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAFRS 126
           +P ++DD+GL ++ L G PG+HSAR+A    GE   D A  QK+   LRS     P ++ 
Sbjct: 63  LPTIADDTGLEVNCLGGAPGVHSARYA----GEAHNDAANRQKLVEDLRS---FSPPYK- 114

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F +V++     G    F G V G I+   RG+ GFGYD +F P G +RTF +MTE EK
Sbjct: 115 ARFRTVVAYIDAAGAEHLFEGCVEGTIILEERGEAGFGYDALFVPEGEERTFAQMTEHEK 174

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCF 214
           N                +SHRARA   F
Sbjct: 175 NA---------------MSHRARAITAF 187


>gi|218437365|ref|YP_002375694.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Cyanothece sp. PCC 7424]
 gi|218170093|gb|ACK68826.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Cyanothece sp. PCC 7424]
          Length = 191

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 108/211 (51%), Gaps = 31/211 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGI-MTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             +++A+ N  K+ E+   +  +   +     EL +   EETG +F +NA +K+   AK 
Sbjct: 2   KTLIVATSNPGKLRELQDYLTEIDWELQLKPKELEI---EETGATFLDNACLKASQVAKT 58

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  A++DDSGL +D L G PGI+SAR+   NT +   D  +++I          +P  R
Sbjct: 59  MGQWAIADDSGLAVDALGGAPGIYSARYG--NTDQERIDRLLKEI--------GSNPN-R 107

Query: 126 SAHFISVLSLAWPDGHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
            A FI V+++A PDG +  N  G   G I+  PRG  GFGYDPIF      +TF EM+ E
Sbjct: 108 KAQFICVIAIARPDGSIALNAKGVCQGEILIAPRGTKGFGYDPIFYVPTQQQTFAEMSPE 167

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            K+                +SHR +AF+  +
Sbjct: 168 VKHK---------------ISHRGKAFEILL 183


>gi|184155008|ref|YP_001843348.1| xanthosine triphosphate pyrophosphatase [Lactobacillus fermentum
           IFO 3956]
 gi|183226352|dbj|BAG26868.1| xanthosine triphosphate pyrophosphatase [Lactobacillus fermentum
           IFO 3956]
          Length = 197

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 109/208 (52%), Gaps = 24/208 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +V+A++N  K  E   ++ P+GI   +  +       E GN FEENA+ K+  A     +
Sbjct: 4   LVVATNNPGKSREFQEMLAPMGIEVKTLADFPPFPIVEDGNGFEENALKKAQAAVSALNL 63

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-AFRSA 127
           P ++DDSGL++D LDG+PGIHSAR+A    G+ +     QK    L +K A  P   R+A
Sbjct: 64  PVVADDSGLMVDALDGEPGIHSARYA----GDHNDAANNQK----LLAKLAGVPDEERTA 115

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           HF + +    P+G     +G+V+G I+    G  GFGYDP+F  +    + G +T+E+KN
Sbjct: 116 HFHTTIVGLKPNGAKLVANGQVNGHILHELTGTNGFGYDPLFYVDELATSMGNLTDEQKN 175

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFV 215
                           +SHR RA +  +
Sbjct: 176 A---------------ISHRGRALRALM 188


>gi|317493546|ref|ZP_07951967.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918489|gb|EFV39827.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 197

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 112/215 (52%), Gaps = 29/215 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 2   QKIVLATGNAGKVRELASLLADFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAQIT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSGL +DVL G PGI+SAR+A     +R     ++K+ +AL+   A     R 
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARYAGEEASDR---QNLEKLLDALKDVPADQ---RQ 115

Query: 127 AHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  VL       H E+ +     G  +G I + P G  GFGYDPIF       +  ++
Sbjct: 116 AKFHCVLVYLR---HAEDPTPLVCHGSWAGEISFAPSGDGGFGYDPIFHVPELGCSAAQL 172

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           T+E+K                 +SHR +A K  ++
Sbjct: 173 TKEQKIA---------------VSHRGQALKLLLE 192


>gi|218233220|ref|YP_002369287.1| HAM1 protein [Bacillus cereus B4264]
 gi|296504968|ref|YP_003666668.1| nucleoside-triphosphatase [Bacillus thuringiensis BMB171]
 gi|218161177|gb|ACK61169.1| HAM1 protein [Bacillus cereus B4264]
 gi|296326020|gb|ADH08948.1| nucleoside-triphosphatase [Bacillus thuringiensis BMB171]
          Length = 202

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 108/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 2   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 62  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEIPFDK------- 114

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 115 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 175 SDEKNA---------------ISHRGRALR 189


>gi|82778274|ref|YP_404623.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           dysenteriae Sd197]
 gi|309785218|ref|ZP_07679849.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella dysenteriae 1617]
 gi|81242422|gb|ABB63132.1| putative ribosomal protein [Shigella dysenteriae Sd197]
 gi|308926338|gb|EFP71814.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella dysenteriae 1617]
          Length = 197

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-MQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +DVL G PGI+SAR+    +GE   D+  +QK+   L+     D   R
Sbjct: 62  GLPAIADDSGLAVDVLGGAPGIYSARY----SGEDATDLKNLQKLLETLKD-VPDDQ--R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +   E
Sbjct: 115 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKNAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTHEEKSA---------------ISHRGQALKLLLD 192


>gi|227510207|ref|ZP_03940256.1| nucleoside-triphosphatase [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227190412|gb|EEI70479.1| nucleoside-triphosphatase [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 199

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 103/208 (49%), Gaps = 25/208 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNAG 67
           IVIAS N +K+ E D       I   S     N+   EETG +FEENA +K+        
Sbjct: 7   IVIASKNANKVKEFDEAFKGTDIKIESLKTFSNVPDVEETGQTFEENAFLKASAIMAFTK 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +P ++DDSGLV+  L+G+PG+HSAR+A    G+ D D    K+   +++K       R A
Sbjct: 67  LPVIADDSGLVVHALNGQPGVHSARYA----GDHDDDANNAKLLKEMQNK-----TNRDA 117

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           +F SVL    P+G      G+V+G I+   RG   FGYDP+F       T  EM+  +KN
Sbjct: 118 YFESVLIYLTPEGDKVISKGRVNGQILRARRGSNNFGYDPLFYVPEQQLTLAEMSTHDKN 177

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFV 215
                           +SHR RA +  +
Sbjct: 178 A---------------ISHRGRAIRQLI 190


>gi|258545699|ref|ZP_05705933.1| non-canonical purine NTP pyrophosphatase RdgB [Cardiobacterium
           hominis ATCC 15826]
 gi|258519069|gb|EEV87928.1| non-canonical purine NTP pyrophosphatase RdgB [Cardiobacterium
           hominis ATCC 15826]
          Length = 194

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 113/220 (51%), Gaps = 31/220 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             I++AS+N  KI E+ +++   GI   +  +  +    ETG +F ENA+IK+  AA+ +
Sbjct: 2   QTILLASNNGKKIAELSAILASFGIEIKAQRDYGIEDVPETGLTFVENALIKARHAARQS 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTG-ERDFDMAMQKIENALRSKFAHDPAF 124
           G+PA++DDSGL +  L G PGI+SAR++ E + G  R    A++ +++            
Sbjct: 62  GLPAIADDSGLCVPALGGAPGIYSARYSGEGDAGNNRKLLAALENVQD------------ 109

Query: 125 RSAHFIS-VLSLAWPDGHVENFS-GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A+++  ++ L   D  +   + G   G I    RG  GFGYDP+F P G  RT  E +
Sbjct: 110 RRAYYVCLIVYLRHADDPLPIIAQGLWHGTIALEARGDGGFGYDPLFVPAGDSRTAAEYS 169

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
             EKN                +SHRARA   F +  L +D
Sbjct: 170 AAEKNS---------------ISHRARALAAFTELYLDLD 194


>gi|217076533|ref|YP_002334249.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Thermosipho africanus TCF52B]
 gi|217036386|gb|ACJ74908.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Thermosipho africanus TCF52B]
          Length = 192

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 112/220 (50%), Gaps = 35/220 (15%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALEL----NLIIPEETGNSFEENAMIKSLTAAK 64
           I +A+ N  K+HE+      + I++   LEL      +  EE G SF EN++ K+     
Sbjct: 2   IYVATTNEHKVHEI------MDILSDFNLELLKSPKKVDVEEDGKSFFENSVKKAYYYGM 55

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P +SDDSGLVI+ L G PG+ SAR+ E  + E      +++++N       +D   
Sbjct: 56  ELNNPVISDDSGLVINALGGMPGVESARFMEGYSYEEKMKELLRRLQN------FND--- 106

Query: 125 RSAHFISVLSLAWPD-GHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +SA F+ V +   P+ G + +  G VSG I    RG+ GFGYDP F P GYD+TFGE+ E
Sbjct: 107 KSASFVCVATYFNPNSGVLISAQGVVSGTISENIRGEFGFGYDPFFIPEGYDKTFGELGE 166

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
             K                 +SHR+RAF+   +   ++ E
Sbjct: 167 SVKRQ---------------ISHRSRAFRKLFELLKKVGE 191


>gi|30022572|ref|NP_834203.1| nucleoside-triphosphatase [Bacillus cereus ATCC 14579]
 gi|228960756|ref|ZP_04122395.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|229048197|ref|ZP_04193766.1| Nucleoside-triphosphatase [Bacillus cereus AH676]
 gi|229129776|ref|ZP_04258743.1| Nucleoside-triphosphatase [Bacillus cereus BDRD-Cer4]
 gi|229152683|ref|ZP_04280871.1| Nucleoside-triphosphatase [Bacillus cereus m1550]
 gi|229180759|ref|ZP_04308097.1| Nucleoside-triphosphatase [Bacillus cereus 172560W]
 gi|62900269|sp|Q817P4|NTPA_BACCR RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|29898130|gb|AAP11404.1| Nucleoside-triphosphatase [Bacillus cereus ATCC 14579]
 gi|228602737|gb|EEK60220.1| Nucleoside-triphosphatase [Bacillus cereus 172560W]
 gi|228630829|gb|EEK87470.1| Nucleoside-triphosphatase [Bacillus cereus m1550]
 gi|228653692|gb|EEL09563.1| Nucleoside-triphosphatase [Bacillus cereus BDRD-Cer4]
 gi|228723184|gb|EEL74560.1| Nucleoside-triphosphatase [Bacillus cereus AH676]
 gi|228798972|gb|EEM45947.1| Nucleoside-triphosphatase [Bacillus thuringiensis serovar pakistani
           str. T13001]
          Length = 205

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 108/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEIPFDK------- 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|300868575|ref|ZP_07113191.1| Nucleoside-triphosphatase [Oscillatoria sp. PCC 6506]
 gi|300333416|emb|CBN58383.1| Nucleoside-triphosphatase [Oscillatoria sp. PCC 6506]
          Length = 210

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 112/215 (52%), Gaps = 31/215 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGI-MTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +++A+ N  K+ EM   +   G  +     EL +   EETG++F  NA +K+   AK  G
Sbjct: 22  LLVATSNPGKVTEMLEYLADFGWELQLKPDELEI---EETGDTFIANACLKASEVAKATG 78

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             A++DDSGL +D L+G+PGI+SAR+     G+ D D  +Q++   L ++       R A
Sbjct: 79  KWAIADDSGLTVDALNGRPGIYSARY-----GKTDSDR-IQRLLTELGNE-----QNRKA 127

Query: 128 HFISVLSLAWPDGHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+  +++A PDG +     GK  G I++ P+G  GFGYDPIF      +TF EMT ++K
Sbjct: 128 QFVCAIAIASPDGAIAIQVEGKCDGEILYNPKGSGGFGYDPIFYVPTQQKTFAEMTPQQK 187

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
                             SHR +AF+  +    RI
Sbjct: 188 RSH---------------SHRGQAFQILLPQLERI 207


>gi|332686498|ref|YP_004456272.1| ribonuclease PH [Melissococcus plutonius ATCC 35311]
 gi|332370507|dbj|BAK21463.1| ribonuclease PH [Melissococcus plutonius ATCC 35311]
          Length = 453

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/189 (40%), Positives = 101/189 (53%), Gaps = 11/189 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSL 60
           +K+  N IVIA+ N+ K +E   +    G    + L+   L   EETG +FEENA +K+ 
Sbjct: 246 KKVNGNTIVIATSNLGKANEFKKIFEQKGYQVKTLLDYPELPKIEETGKTFEENARLKAE 305

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA-LRSKFA 119
           T A     P L+DDSGL++  LDG PGI+SAR+A    GE   D A     NA L  +  
Sbjct: 306 TIASILNQPVLADDSGLIVKALDGMPGIYSARFA----GEPTNDAA----NNARLLYEMT 357

Query: 120 HDPAF-RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
           + P   R A F   L LA P       SG+  G I   PRG+ GFGYDP+F    + +T 
Sbjct: 358 NVPKEDRQATFHCTLVLAAPKMESLVVSGEWQGEIATIPRGEHGFGYDPLFYVPEFHKTS 417

Query: 179 GEMTEEEKN 187
            EM+ EEKN
Sbjct: 418 AEMSNEEKN 426


>gi|310826564|ref|YP_003958921.1| ribonuclease Ph [Eubacterium limosum KIST612]
 gi|308738298|gb|ADO35958.1| ribonuclease Ph [Eubacterium limosum KIST612]
          Length = 199

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 107/210 (50%), Gaps = 30/210 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLI---MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA- 62
             IV+A+ N DK  E+ +++     +  M    ++  +I   E G +FE+NA+IK     
Sbjct: 2   KTIVLATGNKDKAREIKAMLDHKFEVKTMKDMGIDTQII---EDGETFEDNALIKVRAIQ 58

Query: 63  --AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
              K+A M  + DDSGL +D LDG PGI+SAR+A  +   RD +   +K+ NA++     
Sbjct: 59  PFVKDAEMIIMGDDSGLSVDALDGAPGIYSARYAGEDVSYRDNN---EKLLNAMKDVPEE 115

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R A F+SV+++  PDG      G V G I +   G  GFGYDP+F      +++ +
Sbjct: 116 K---RGAEFVSVIAMILPDGQELTVRGTVRGRIAYDFMGDEGFGYDPLFIVEETGKSYAQ 172

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARA 210
           M  EEKN                +SHRARA
Sbjct: 173 MAPEEKNA---------------VSHRARA 187


>gi|307700328|ref|ZP_07637368.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Mobiluncus mulieris FB024-16]
 gi|307614539|gb|EFN93768.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Mobiluncus mulieris FB024-16]
          Length = 236

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 113/228 (49%), Gaps = 34/228 (14%)

Query: 8   NIVIASHNVDKIHEMDSLIMPL-------GIMTTSALELNLIIPEETGNSFEENAMIKSL 60
            +V+A+ N  K+ E+  ++ PL       GI+ +   EL +  P E G SF  NA+IK+ 
Sbjct: 25  QVVMATGNAHKVKEVAEILRPLVPSLQPDGIVASG--ELGIPSPIENGTSFSANALIKAR 82

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             A+   +P L+DDSGL +++L G PGI SARWA    G    D A  ++     S    
Sbjct: 83  ALAEYVKLPILADDSGLTVEILGGAPGIFSARWA----GAHGDDQANLQLLLNQLSDVP- 137

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPN---GYD-R 176
           DP  R A F+ V  L  P G     +G + G +   PRG+ GFGYDPIF P+   G D R
Sbjct: 138 DP-HRGAAFVCVAVLLLPSGKTYLGNGVMGGRLTTRPRGKNGFGYDPIFMPDAQIGEDKR 196

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           T  +++ ++KN                +SHRA AF+        I E+
Sbjct: 197 TNAQLSAKDKNA---------------ISHRASAFRQIAPQLEAILER 229


>gi|296170283|ref|ZP_06851874.1| ribonuclease PH/Ham1 protein [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295895006|gb|EFG74725.1| ribonuclease PH/Ham1 protein [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 200

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 108/214 (50%), Gaps = 28/214 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP----EETGNSFEENAMIKSLTA 62
             +++AS N  K+ E+  ++   G+   +   L  + P     ETG +FE+NA+ K+  A
Sbjct: 2   TELLVASRNPKKLRELRRVLDAAGLTRLALRSLRDVPPFEEAPETGATFEDNALAKARDA 61

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
               GM +++DDSGL +  L+G PG+ SARW    +G    D A   +   L ++    P
Sbjct: 62  FAATGMASVADDSGLEVAALNGMPGVLSARW----SGTHGDDAANTAL---LLAQLRDVP 114

Query: 123 -AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F+S  +LA P G V    G+ +G I   PRG  GFGYDP+F P+G DRT  ++
Sbjct: 115 DERRGAAFVSACALAGPFGEV-VVRGEWTGSIAHEPRGDGGFGYDPVFVPDGSDRTAAQL 173

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           + EEK               D +SHR RA    V
Sbjct: 174 SPEEK---------------DAVSHRGRALAQLV 192


>gi|157364707|ref|YP_001471474.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Thermotoga lettingae TMO]
 gi|157315311|gb|ABV34410.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermotoga lettingae TMO]
          Length = 195

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 102/205 (49%), Gaps = 28/205 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE-ETGNSFEENAMIKSLTAAKNAG 67
           ++IA+ N  KI E+   + P G+   +  +LN+ +   E G++F ENA+ K+   A    
Sbjct: 2   LLIATRNGHKIEEIKKFV-PDGVEVLTLKDLNIALEAVENGDTFMENAIRKATFYANLTK 60

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
              ++DDSGLVID LDG PG+HSAR+ ++ + +      +Q +E             R A
Sbjct: 61  KKTIADDSGLVIDSLDGFPGVHSARFMKNASYKEKMQFILQMLETKQE---------RVA 111

Query: 128 HFISVLSLAWP-DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V +   P +  +      V G I    RG  GFGYDPIF PNGY  TFGEM EE+ 
Sbjct: 112 RFVCVAAYYDPIEKTIVCCEESVEGTISREIRGTSGFGYDPIFIPNGYSTTFGEMGEEKH 171

Query: 187 NGGIDSATLFSILSTDLLSHRARAF 211
                            LSHR +AF
Sbjct: 172 K----------------LSHRYKAF 180


>gi|88859170|ref|ZP_01133811.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Pseudoalteromonas tunicata D2]
 gi|88819396|gb|EAR29210.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Pseudoalteromonas tunicata D2]
          Length = 198

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 104/188 (55%), Gaps = 16/188 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+ S++ PL I   +  E N+    ETG +F ENA+IK+  AAK  
Sbjct: 2   QKIVLATSNKGKVAELASMLSPLNIEIIAQSEFNVSEVAETGTTFIENAIIKARHAAKVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-AFR 125
           G+ A++DDSGL +D L G PGI+SAR+A  N  ++D    + K+ N L+    H P   R
Sbjct: 62  GLAAIADDSGLEVDALKGAPGIYSARFAGENATDKD---NIIKLLNELK----HVPHEQR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVS-----GIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           SA F  VL L     H ++ +  V      G I   P G+ GFGYDP+F       T  E
Sbjct: 115 SARFWCVLVLM---RHADDPTPLVCQANWEGFITEQPSGEAGFGYDPVFYVPSLTITSAE 171

Query: 181 MTEEEKNG 188
           +++E+KN 
Sbjct: 172 LSKEQKNA 179


>gi|260910753|ref|ZP_05917408.1| non-canonical purine NTP pyrophosphatase RdgB [Prevotella sp. oral
           taxon 472 str. F0295]
 gi|260635127|gb|EEX53162.1| non-canonical purine NTP pyrophosphatase RdgB [Prevotella sp. oral
           taxon 472 str. F0295]
          Length = 200

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 114/215 (53%), Gaps = 32/215 (14%)

Query: 9   IVIASHNVDKIHEMDSLIMP--LGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           IV A++N  K+ E+   IMP  L +++   +  ++ IPE TG++ +ENA+IK+    ++ 
Sbjct: 5   IVFATNNAHKLEEIRQ-IMPSNLQVLSLKDIGCDVDIPE-TGSTLQENALIKAQYVLEHY 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           GM   +DD+GL +  L+ +PG++SAR+A  +  + + +MA       L S+ A D   R 
Sbjct: 63  GMACFADDTGLEVYALNNEPGVYSARYAGGDGHDSEANMA------KLLSRLA-DNTHRE 115

Query: 127 AHFISVLSLAWPDGHVEN------FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           A F +V++L  P  +         F G V G I     G  GFGYDP+F PNGY++TF E
Sbjct: 116 ARFRTVIALVAPSDNTLGVNEPMFFEGIVEGHIATERHGTEGFGYDPLFVPNGYEKTFAE 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           +  + KN                +SHRARA    V
Sbjct: 176 LGADIKN---------------QISHRARAVGKLV 195


>gi|332305442|ref|YP_004433293.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172771|gb|AEE22025.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 201

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 106/214 (49%), Gaps = 31/214 (14%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   IV+A+ N  K+ E+  L+ PL +      E ++    ETG +F ENA+IK+  AAK
Sbjct: 1   MTRKIVLATGNQGKVSELSQLLTPLAVNIVPQSEFDVPEVPETGTTFVENAIIKARHAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD----FDMAMQKIENALRSKFAH 120
             G+PA++DDSGL +D L G PG++SAR+A SN  + D       A+Q+IE         
Sbjct: 61  ITGLPAIADDSGLAVDALGGAPGVYSARYAGSNATDSDNIDKLLGALQEIE--------- 111

Query: 121 DPAFRSAHFISVLSL--AWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
            PA R A F+ VL    +  D       G+  G I     G  GFGYDPIF       T 
Sbjct: 112 -PARRQARFLCVLVYMRSSEDPTPIICQGEWHGTITHERSGDSGFGYDPIFWVEQKQCTS 170

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            ++++ +KN                LSHR +A +
Sbjct: 171 AQLSKAQKNA---------------LSHRGQALQ 189


>gi|183596317|ref|ZP_02958345.1| hypothetical protein PROSTU_00052 [Providencia stuartii ATCC 25827]
 gi|188023921|gb|EDU61961.1| hypothetical protein PROSTU_00052 [Providencia stuartii ATCC 25827]
          Length = 197

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 113/216 (52%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K++E+  L+   G+   +   L +   EETG +F ENA++K+  A++  
Sbjct: 2   QKVVLATGNPGKVNELADLLRDFGMDIVAQTSLGVESAEETGLTFIENAILKARHASQQT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSG+ +D L G PGI+SAR+A E  T E++    + K+ +A++S    +   R
Sbjct: 62  GLPAIADDSGISVDALGGAPGIYSARYAGEEATDEQN----LHKLLDAMKSVPDGE---R 114

Query: 126 SAHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+     F G+  GII   P GQ GFGYDPIF     + T  E
Sbjct: 115 QAQFNCVLVYLR---HAEDPTPLVFHGRWHGIITHEPSGQGGFGYDPIFYVPELNCTSAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T+ EK                 +SHR +A    +D
Sbjct: 172 LTKSEKQA---------------ISHRGKALAMLLD 192


>gi|301154954|emb|CBW14417.1| dITP/XTP pyrophosphatase [Haemophilus parainfluenzae T3T1]
          Length = 199

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 110/205 (53%), Gaps = 14/205 (6%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLADFGFEVIAQTDLGIESPEETGLTFVENAILKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA- 123
            +G+PA++DDSGLV+D L+G PG++SAR+A       D D A  K    L ++ A  P  
Sbjct: 61  KSGLPAIADDSGLVVDALNGAPGLYSARYAGV-----DGDEADAKNREKLLAELADVPTE 115

Query: 124 FRSAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
            R A F+S + L     H  + S     G+  G I++  +G+ GFGYD +F       TF
Sbjct: 116 CRQAKFVSTIVLLQ---HPSDPSPIIAQGECDGQIIYEEKGENGFGYDSLFFSPEKGCTF 172

Query: 179 GEMTEEEKNGGIDSATLFSILSTDL 203
            E+   EK      A   ++L + L
Sbjct: 173 AELETVEKKKISHRAKALAVLKSKL 197


>gi|293374132|ref|ZP_06620466.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Turicibacter sanguinis PC909]
 gi|325837439|ref|ZP_08166421.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Turicibacter sp. HGF1]
 gi|292647235|gb|EFF65211.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Turicibacter sanguinis PC909]
 gi|325490971|gb|EGC93269.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Turicibacter sp. HGF1]
          Length = 197

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 103/206 (50%), Gaps = 24/206 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           ++IA+ N  K  E + +     I   S L+L  +   EE G +FEENA+IK+   AK   
Sbjct: 4   VIIATQNSGKAKEFEHIFNRYNIQVKSLLDLGDVTEIEENGETFEENALIKAREIAKKYK 63

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
              ++DDSGL +D L+ +PG++SAR+A E     ++ D  + ++E         +   RS
Sbjct: 64  KLVIADDSGLEVDALNKRPGVYSARYAGEDRDDAKNIDKVLTELEGI-------EEKNRS 116

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+  L+L   +G      G+  G I+   +G  GFGYDPIF      +T  E+ + EK
Sbjct: 117 ARFVCALALVTENGEEYVVRGECEGQILTHRQGNEGFGYDPIFYLPSIQKTMAEIPKSEK 176

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N               +LSHRA AFK
Sbjct: 177 N---------------VLSHRADAFK 187


>gi|19553700|ref|NP_601702.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Corynebacterium glutamicum ATCC 13032]
 gi|62391340|ref|YP_226742.1| deoxyribonucleotide triphosphate pyrophosphatase [Corynebacterium
           glutamicum ATCC 13032]
 gi|34222604|sp|Q8NMR5|NTPA_CORGL RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|21325271|dbj|BAB99893.1| Xanthosine triphosphate pyrophosphatase [Corynebacterium glutamicum
           ATCC 13032]
 gi|41326681|emb|CAF21163.1| Xanthosine triphosphate pyrophosphatase [Corynebacterium glutamicum
           ATCC 13032]
          Length = 206

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 115/222 (51%), Gaps = 31/222 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII----PEETGNSFEENAMIKSLTAAK 64
           +++AS+N  K+ E+  ++   G+ +   L L  +     P E G +F +NA IK+     
Sbjct: 3   LLLASNNAKKLKELQRILDQAGLDSVELLALRDVEAYDEPIEDGRTFADNAQIKARAGVT 62

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-A 123
           + G+  ++DDSG+ ++ L+G PG+ SARW    +G    D A  ++   L ++  H P  
Sbjct: 63  HTGIATIADDSGIAVEELNGMPGVLSARW----SGAHGNDTANNEL---LLAQMEHVPDE 115

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQP----NGYDRTFG 179
            R+A F+SV  LA PDG      G+  G ++  P+G+ GFGYDP+F P    +G  R+  
Sbjct: 116 RRNAAFVSVCVLALPDGQEFVQEGRWEGQLLRGPKGENGFGYDPLFIPAEEIDGQGRSSA 175

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           E++ EEK               D LSHR +A +  V+   ++
Sbjct: 176 ELSAEEK---------------DALSHRGQALRGLVEKIAQV 202


>gi|323669737|emb|CBJ94861.1| conserved hypothetical protein [Salmonella bongori]
 gi|327412907|emb|CAX67921.1| conserved hypothetical protein [Salmonella bongori]
          Length = 197

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 110/216 (50%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+  
Sbjct: 2   QKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAQIT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR++ E+ T +++ +  +  + +    K       R
Sbjct: 62  GLPAIADDSGLAVDALGGAPGIYSARYSGENATDQQNLEKLLHTLHDVPDDK-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I     G  GFGYDPIF      +T  E
Sbjct: 115 QAQFHCVLVYLR---HAEDPTPVVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 172 LTREEKSA---------------ISHRGQALKLLLD 192


>gi|304385229|ref|ZP_07367574.1| nucleoside-triphosphatase [Pediococcus acidilactici DSM 20284]
 gi|304328436|gb|EFL95657.1| nucleoside-triphosphatase [Pediococcus acidilactici DSM 20284]
          Length = 197

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/184 (35%), Positives = 100/184 (54%), Gaps = 8/184 (4%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAA 63
           + N I+IA+ N  K+ E   +    GI   S  +++  +  +E G +FEENA +K+ + A
Sbjct: 1   MSNQILIATKNEGKLKEFKQIFTAKGIEVLSLKDVDEDVDVQENGLTFEENARLKADSYA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G+P L+DDSGL ID L+G+PGI SAR+A  +    +    + ++      K      
Sbjct: 61  KTIGIPVLADDSGLEIDALNGRPGIFSARYAGDHNDAANNAKVLTELGGVSDEK------ 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F + + +  PDG     +G + G I+  PRG  GFGYDP+F      +T  +MT 
Sbjct: 115 -RTATFHTTVVVRKPDGTELVANGNLRGRILSVPRGDNGFGYDPLFYVEEKQKTLAQMTR 173

Query: 184 EEKN 187
           EEKN
Sbjct: 174 EEKN 177


>gi|253995546|ref|YP_003047610.1| non-canonical purine NTP pyrophosphatase [Methylotenera mobilis
           JLW8]
 gi|253982225|gb|ACT47083.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylotenera mobilis JLW8]
          Length = 207

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 100/179 (55%), Gaps = 9/179 (5%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           N +VIA+ N  K+ E++ L+ PL +  T    LN+   EE   +F ENA+ K+  A+K+ 
Sbjct: 6   NQLVIATGNKGKLREIEHLLSPLALTITPQSALNVPECEEPYCTFIENALAKARHASKHT 65

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAM--QKIENALRSKFAHDPAF 124
           G+PAL+DDSGL +D L G PG+ SAR+AE++        A   QK+ NAL+ +     A 
Sbjct: 66  GLPALADDSGLCVDALLGAPGVRSARYAEADPASSLSQDARNNQKLLNALQGE-----AN 120

Query: 125 RSAHFISVLSLAWPDGHVENF--SGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           R AHF  V+ L   +   E     G+  G I+   RG  GFGYDP+F     D+T  E+
Sbjct: 121 RHAHFYCVMVLVRHEHDPEPIIAEGQWVGEILNELRGTDGFGYDPLFLDAKTDKTVAEL 179


>gi|223043795|ref|ZP_03613838.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus capitis SK14]
 gi|222442892|gb|EEE48994.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus capitis SK14]
          Length = 195

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 101/182 (55%), Gaps = 11/182 (6%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           ++IVIAS+N  KI++   +     ++  S L  N  + EETG +F+ENA +KS  AAK  
Sbjct: 2   SDIVIASNNKGKINDFKVIFKEDNVIGISELLPNFDV-EETGTTFDENAKLKSEAAAKVL 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAE-SNTGERDFDMAMQKIENALRSKFAHDPAFR 125
               ++DDSGL +  L G+PG++SAR+A    + + + D  +  +EN          + R
Sbjct: 61  NKRVIADDSGLEVFALKGEPGVYSARYAGLDKSDDANIDKLLANLEN---------ESDR 111

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F+ V+S++ P    + F G VSG I    +G  GFGYDPIF      RT  E+T EE
Sbjct: 112 RAQFVCVISMSAPGEETKTFKGTVSGEITHARQGTHGFGYDPIFFVPDKKRTMAELTNEE 171

Query: 186 KN 187
           K+
Sbjct: 172 KS 173


>gi|82701202|ref|YP_410768.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Nitrosospira multiformis ATCC 25196]
 gi|82409267|gb|ABB73376.1| Ham1-like protein [Nitrosospira multiformis ATCC 25196]
          Length = 197

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 110/214 (51%), Gaps = 33/214 (15%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +VIAS+N  K+ E+  L+ PLGI        +    EE   +F ENA+ K+  A+KN G+
Sbjct: 4   LVIASNNAGKLREIRLLLEPLGIEVLPQSAFDFPEAEEPHCTFVENALAKARHASKNTGL 63

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           PAL+DDSG+ +++L GKPGI SAR+A E  + ER+    ++ ++N          + R A
Sbjct: 64  PALADDSGICVNILGGKPGILSARYAGEPKSDERNNQRLVEALQNQ---------SDRRA 114

Query: 128 HFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           ++  V++L     H E+       G   G I+  PRG  GFGYDP F     D+T  E+ 
Sbjct: 115 YYYCVIALLR---HPEDPRPIIADGSWHGEILLNPRGNGGFGYDPYFFLANLDKTAAELP 171

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
            E+KN                +SHR +A    V+
Sbjct: 172 MEQKN---------------RISHRGKALAQLVE 190


>gi|73662953|ref|YP_301734.1| nucleoside-triphosphatase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|72495468|dbj|BAE18789.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 194

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 102/180 (56%), Gaps = 9/180 (5%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +IVIAS N  KI++   +     ++  + +  +  + EETG++FE NA +KS  AAK   
Sbjct: 3   DIVIASTNKGKINDFKVIFPDFNVIGIAEIIEDFDV-EETGDTFEANAKLKSEAAAKALN 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
              ++DDSGL +  LDG+PG++SAR+A ++   +D D  + K+   L      D   RSA
Sbjct: 62  KRVIADDSGLEVFALDGEPGVYSARYAGTD---KDDDANIDKLLTQL-----GDETDRSA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+ V+S++ P      F G V G I     G+ GFGYDPIF  +  ++T  +++ EEK+
Sbjct: 114 QFVCVISMSTPGEETVQFKGTVQGEITLSKIGEHGFGYDPIFYLDDKNKTMAQLSAEEKS 173


>gi|237743440|ref|ZP_04573921.1| ribonuclease ph [Fusobacterium sp. 7_1]
 gi|229433219|gb|EEO43431.1| ribonuclease ph [Fusobacterium sp. 7_1]
          Length = 434

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 111/206 (53%), Gaps = 27/206 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           I +A+ N  KI E+  +   +  +   +++  + IPE  E G +FE+N+  K++  +K  
Sbjct: 244 IFLATANKHKIDEISDIFSGIENIEILSIKDGIEIPEVIEDGKTFEDNSKKKAVEISKFL 303

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            M  ++DDSGL +D L+G+PG++SAR+  S TG+ D     + +EN            R+
Sbjct: 304 NMITIADDSGLCVDALNGEPGVYSARY--SGTGD-DLKNNEKLVENL------KGIENRN 354

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+SV++LA P+G   +F G+++G IV  PRG  GFGYDP F    Y +T  E+ E   
Sbjct: 355 AKFVSVITLAKPNGETYSFRGEINGKIVDTPRGNTGFGYDPHFYVEEYQKTLAELPE--- 411

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
                          + +SHRA+A +
Sbjct: 412 -------------LKNKISHRAKALE 424


>gi|78223082|ref|YP_384829.1| nucleoside-triphosphatase [Geobacter metallireducens GS-15]
 gi|78194337|gb|ABB32104.1| Ham1-like protein [Geobacter metallireducens GS-15]
          Length = 196

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 108/207 (52%), Gaps = 22/207 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
            ++++A+ N  K+ E+  ++  +     S  +  +L   EE G +FE+NA+ K+   A+ 
Sbjct: 2   TDLIVATRNKGKLLEIGKILEGVHCRIYSLADFPDLPEIEEDGVTFEQNAIKKASAIAQL 61

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PAL+DDSGLV+D L G+PG+ SAR+A   TG  D +    K+   LR      P  R
Sbjct: 62  TGLPALADDSGLVVDALGGRPGVFSARYA--GTGATD-ETNNAKLLEELRGT---PPERR 115

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F  V++L  PDG    FSG++ G I+  P+G  GFGYDP+F       +  E+  E 
Sbjct: 116 GAAFHCVIALCLPDGSCTTFSGELRGSILEVPQGGGGFGYDPLFFVEEEGSSLAELPLER 175

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFK 212
           KN                LSHR +A +
Sbjct: 176 KN---------------RLSHRGKALE 187


>gi|304317495|ref|YP_003852640.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778997|gb|ADL69556.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 198

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 107/206 (51%), Gaps = 26/206 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           IV+A+HN  K+ E+            SA ++      EETG++ EENA++K+ + A    
Sbjct: 3   IVVATHNKHKVDEIREFFKD-DFEVLSADDIGSYDEIEETGDTIEENALLKARSLANLTD 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQK-IENALRSKFAHDPAFRS 126
              ++DD+GL +D LDGKPG++SAR+A SN    D +  + + +E     K       R 
Sbjct: 62  YIVIADDTGLFVDYLDGKPGVYSARFAGSNATYEDNNRKLLRLLEGVPIEK-------RK 114

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F +V++L +  G      GKV G I+  PRGQ GFGYDP+F  +   +T  E+T EEK
Sbjct: 115 ATFRTVVALIYK-GKETIIEGKVEGTILDSPRGQFGFGYDPVFFVDKVGKTLAELTLEEK 173

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                +SHRA A K
Sbjct: 174 NE---------------VSHRANALK 184


>gi|57866661|ref|YP_188317.1| Ham1 family protein [Staphylococcus epidermidis RP62A]
 gi|242242451|ref|ZP_04796896.1| nucleoside-triphosphatase [Staphylococcus epidermidis W23144]
 gi|62900151|sp|Q5HQ23|NTPA_STAEQ RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|57637319|gb|AAW54107.1| Ham1 family protein [Staphylococcus epidermidis RP62A]
 gi|242234101|gb|EES36413.1| nucleoside-triphosphatase [Staphylococcus epidermidis W23144]
          Length = 195

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 103/179 (57%), Gaps = 9/179 (5%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +IVIA++N  KI++  ++     ++  S L  +  + EETG +FEENA +KS  AA    
Sbjct: 3   DIVIATNNQGKINDFKAIFKNQNVIGISELIEDFDV-EETGATFEENAKLKSEAAAHALN 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
              ++DDSGL +  L+G+PG++SAR+A    G+ D D     IE  L +    D   R A
Sbjct: 62  KRVIADDSGLEVFALNGEPGVYSARYA--GLGKNDED----NIEKLLTN--LEDVQDRRA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ P+   + F G VSG+I     G+ GFGYDPIF     ++T  E+T +EK
Sbjct: 114 QFVCVISMSAPNEKTKTFKGTVSGVITTERHGKNGFGYDPIFFVPELNKTMAEITNDEK 172


>gi|229105116|ref|ZP_04235767.1| Nucleoside-triphosphatase [Bacillus cereus Rock3-28]
 gi|228678297|gb|EEL32523.1| Nucleoside-triphosphatase [Bacillus cereus Rock3-28]
          Length = 205

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 109/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL+ID L+GKPG++SAR+A E    + + D  +Q++ N +      D   
Sbjct: 65  LDSIVIADDSGLIIDALNGKPGVYSARFAGEPKDDQANMDKVLQEL-NGI------DFEK 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+   E    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEADKEPVIVNGTCEGYILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|19705156|ref|NP_602651.1| ribonuclease PH [Fusobacterium nucleatum subsp. nucleatum ATCC
           25586]
 gi|19713093|gb|AAL93950.1| Ribonuclease PH [Fusobacterium nucleatum subsp. nucleatum ATCC
           25586]
          Length = 434

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 110/211 (52%), Gaps = 37/211 (17%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNA 66
           I +A+ N  KI E+  +   +  +   +++  + IPE  E G +FE N+  K++  +K  
Sbjct: 244 IFLATANKHKIEEISDIFSGIENIEILSIKDGIEIPEVIEDGETFEVNSKKKAVEISKFL 303

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-----RDFDMAMQKIENALRSKFAHD 121
            M  ++DDSGL +D L+G+PG++SAR+  S TG+           +Q IEN         
Sbjct: 304 NMITIADDSGLCVDALNGEPGVYSARY--SGTGDDLKNNEKLVNNLQGIEN--------- 352

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F+SV++LA P+G V +F G++ G I+  PRG  GFGYDP F    Y +T  E+
Sbjct: 353 ---RNAKFVSVITLAKPNGEVYSFRGEIQGKIIDTPRGNTGFGYDPHFYVEEYQKTLAEL 409

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            E                  + +SHRA+A +
Sbjct: 410 PE----------------LKNKISHRAKALE 424


>gi|227875769|ref|ZP_03993897.1| nucleoside-triphosphatase [Mobiluncus mulieris ATCC 35243]
 gi|306819042|ref|ZP_07452759.1| nucleoside-triphosphatase [Mobiluncus mulieris ATCC 35239]
 gi|227843711|gb|EEJ53892.1| nucleoside-triphosphatase [Mobiluncus mulieris ATCC 35243]
 gi|304648235|gb|EFM45543.1| nucleoside-triphosphatase [Mobiluncus mulieris ATCC 35239]
          Length = 236

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 113/228 (49%), Gaps = 34/228 (14%)

Query: 8   NIVIASHNVDKIHEMDSLIMPL-------GIMTTSALELNLIIPEETGNSFEENAMIKSL 60
            +V+A+ N  K+ E+  ++ PL       GI+ +   EL +  P E G SF  NA+IK+ 
Sbjct: 25  QVVMATGNAHKVKEVAEILRPLVPSLQPDGIVASG--ELGIPSPIENGTSFSANALIKAR 82

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             A+   +P L+DDSGL +++L G PGI SARWA    G    D A  ++     S    
Sbjct: 83  ALAEYVKLPILADDSGLTVEILGGAPGIFSARWA----GAHGDDQANLQLLLNQLSDVP- 137

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPN---GYD-R 176
           DP  R A F+ V  L  P G     +G + G +   PRG+ GFGYDPIF P+   G D R
Sbjct: 138 DP-HRGAAFVCVAVLLLPSGKTYLGNGVMGGRLTTKPRGKNGFGYDPIFIPDAQIGEDKR 196

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           T  +++ ++KN                +SHRA AF+        I E+
Sbjct: 197 TNAQLSAKDKNA---------------ISHRASAFRQIAPQLEAILER 229


>gi|126658666|ref|ZP_01729812.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Cyanothece sp. CCY0110]
 gi|126620103|gb|EAZ90826.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Cyanothece sp. CCY0110]
          Length = 191

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 110/212 (51%), Gaps = 29/212 (13%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +++A+ N  K+ EM   +  +G      L+ + I  EETG +F ENA++K+   AK
Sbjct: 1   MNKQLIVATSNPGKLQEMQDYL--IGFDWNLQLKPSEIDIEETGQTFMENAILKASQTAK 58

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           + G  A++DDSGL ++ L+G PG++SAR+  S+          ++IE  L     +D   
Sbjct: 59  HLGKWAIADDSGLAVEALNGSPGLYSARYGNSD---------QERIERLLNELGNNDN-- 107

Query: 125 RSAHFISVLSLAWPDGHVENFS-GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           R A F+  +++A PDG +   S G   G I+  P+G  GFGYDPIF    Y +TF +MT 
Sbjct: 108 RKAQFVCAIAIARPDGSIALQSEGICQGEILKTPQGTQGFGYDPIFYVPPYQQTFAQMTP 167

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           E K                 +SHR +AF   +
Sbjct: 168 ELKRD---------------VSHRGQAFALLL 184


>gi|57642046|ref|YP_184524.1| nucleoside triphosphate phosphohydrolase, Ham1p-like protein
           [Thermococcus kodakarensis KOD1]
 gi|62900154|sp|Q5JEX8|NTPA_PYRKO RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|57160370|dbj|BAD86300.1| nucleoside triphosphate phosphohydrolase, Ham1p homolog
           [Thermococcus kodakarensis KOD1]
          Length = 184

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 99/209 (47%), Gaps = 33/209 (15%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +   + N  K+ E      PLG+      +L +  PE   ++ EE A   +   A+   
Sbjct: 2   RLAFVTSNPGKVEEARKYFEPLGV---EVYQLKVSYPEIQADTLEEVAEYGAKWLAQRVD 58

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
            P   DDSGL ++ L G PG++SA +     G +     +Q  +N            R A
Sbjct: 59  GPFFLDDSGLFVEALKGFPGVYSA-YVYKTIGYQGILKLLQGEKN------------RKA 105

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           HF SV+  A+ DG +  F+G+V G I   PRG  GFG+DPIF P G+DRTF EMT EEKN
Sbjct: 106 HFKSVI--AYWDGELHIFTGRVDGKIATEPRGSGGFGFDPIFIPEGFDRTFAEMTTEEKN 163

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVD 216
                           +SHR RA + F +
Sbjct: 164 ---------------RISHRGRALREFAN 177


>gi|210611719|ref|ZP_03288989.1| hypothetical protein CLONEX_01180 [Clostridium nexile DSM 1787]
 gi|210151883|gb|EEA82890.1| hypothetical protein CLONEX_01180 [Clostridium nexile DSM 1787]
          Length = 199

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 114/216 (52%), Gaps = 31/216 (14%)

Query: 5   IENNIVIASHNVDKIHE----MDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           +E  I+ A+ N +K+ E    +  L MP+  M  + ++++++   E G++FEENA+IK+ 
Sbjct: 1   MEPKIIFATGNENKMKEIRMILSDLGMPIQSMKEAGIDVDVV---EDGSTFEENALIKAT 57

Query: 61  TAAKNAG-MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
             AK AG    L+DDSGL ID L+ +PGI+SAR+A  +T    +D+      N L  +  
Sbjct: 58  EIAKIAGNCIVLADDSGLEIDYLNKEPGIYSARYAGVDT---SYDIK----NNMLLDRLK 110

Query: 120 HDP-AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
             P   R+A F+  ++ A+PDG  E   G + G I +   G+ GFGYDPIF    Y  T 
Sbjct: 111 GVPDEKRTARFVCAVAAAFPDGTTEVVRGTIEGRIGYEIAGEHGFGYDPIFYLPEYGCTT 170

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
            E+  E+KN                LSHR +A +  
Sbjct: 171 AELDPEKKNE---------------LSHRGKALRAM 191


>gi|299144136|ref|ZP_07037216.1| ribonuclease PH/Ham1 protein [Peptoniphilus sp. oral taxon 386 str.
           F0131]
 gi|298518621|gb|EFI42360.1| ribonuclease PH/Ham1 protein [Peptoniphilus sp. oral taxon 386 str.
           F0131]
          Length = 438

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 108/211 (51%), Gaps = 28/211 (13%)

Query: 9   IVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           IV++S N  KI E+  ++  +P+ I++   + L+ I  +E  ++ E NA +K+       
Sbjct: 241 IVLSSDNEHKITEIKEILKDLPVEIISKKDVNLSNINVDENLDTLEGNAHLKASAIKDKC 300

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIEN-ALRSKFAHDPAFR 125
               ++DD+GL ++ L+G+PG+HSAR+A+S+            +EN  L  K   D   R
Sbjct: 301 AYSVIADDTGLFVNALNGEPGVHSARYAKSH----------DDVENRKLLIKNLRDEKDR 350

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A+F +V+      G    F G   G I     G  GFGYD IF P G++RTFGEM+ +E
Sbjct: 351 RAYFKTVIVYIDSIGEEHIFEGICKGEITEKEIGNGGFGYDSIFLPKGFNRTFGEMSSDE 410

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           KN               L+SHR+ A K F D
Sbjct: 411 KN---------------LISHRSEAIKKFKD 426


>gi|330984662|gb|EGH82765.1| dITP/XTP pyrophosphatase [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 197

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 73/210 (34%), Positives = 110/210 (52%), Gaps = 31/210 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+ASHN  K+ E+ +++    +   S  E +L+ PEETG SF ENA++K+  AA+ +
Sbjct: 4   TQLVLASHNGGKLKELQAMLGG-SVTLRSVSEFSLVEPEETGLSFVENAILKARNAARLS 62

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +D LDG PGI+SAR+AE      +    ++ +++    +       R 
Sbjct: 63  GLPALADDSGLAVDFLDGAPGIYSARYAEGKGDAANNAKLLEALKDVPDEQ-------RG 115

Query: 127 AHFISVLSLAWPDGHVEN-----FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F+ VL+L     H ++       G   G I+    G+ GFGYDP+F     + +  E+
Sbjct: 116 AQFVCVLALVR---HADDPLPILCEGLWHGRILHAASGEHGFGYDPLFWVPERNCSSAEL 172

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAF 211
              EKN                LSHRARA 
Sbjct: 173 GPSEKNQ---------------LSHRARAM 187


>gi|170292256|pdb|2PYU|A Chain A, Structure Of The E. Coli Inosine Triphosphate
           Pyrophosphatase Rgdb In Complex With Imp
          Length = 219

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 22  QKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 81

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            +PA++D SGL +DVL G PGI+SAR++ E  T +++    ++ +++    +       R
Sbjct: 82  ALPAIADASGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQ-------R 134

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 135 QARFHCVLVYLR---HAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 191

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 192 LTREEKSA---------------ISHRGQALKLLLD 212


>gi|229147050|ref|ZP_04275410.1| Nucleoside-triphosphatase [Bacillus cereus BDRD-ST24]
 gi|228636438|gb|EEK92908.1| Nucleoside-triphosphatase [Bacillus cereus BDRD-ST24]
          Length = 205

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 107/210 (50%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K  + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKVDSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++      K       
Sbjct: 65  LNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANIDKVLQELNEIPFDK------- 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|282881261|ref|ZP_06289947.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella timonensis CRIS 5C-B1]
 gi|281304851|gb|EFA96925.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella timonensis CRIS 5C-B1]
          Length = 186

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 100/187 (53%), Gaps = 35/187 (18%)

Query: 43  IPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERD 102
           IPE TG + +ENA++K+   A++ G+   +DD+GL ++ L G PG+HSAR+AE    + +
Sbjct: 12  IPE-TGETLQENALLKAKYVAEHYGLDCFADDTGLEVEALHGAPGVHSARYAEGT--DHN 68

Query: 103 FDMAMQKIENALRSKFAHDPAFRSAHFISVL-------------SLAWPDGHVENFSGKV 149
            +  MQK+ + L+ K      FR+   I++L             + A P+ H   F G++
Sbjct: 69  SEANMQKLLHELQDKENRKARFRTV--IALLQHPKNQLKENVENAFAAPEIHY--FEGRI 124

Query: 150 SGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRAR 209
            GII    RG  GFGYDPIF PNGY ++F E+ E  KN                +SHRA+
Sbjct: 125 DGIIAKEKRGNAGFGYDPIFIPNGYQQSFAELGETIKNH---------------ISHRAQ 169

Query: 210 AFKCFVD 216
           A +   +
Sbjct: 170 AVEKLAE 176


>gi|145296502|ref|YP_001139323.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Corynebacterium glutamicum R]
 gi|167016361|sp|A4QGQ5|NTPA_CORGB RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|140846422|dbj|BAF55421.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 206

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 114/222 (51%), Gaps = 31/222 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII----PEETGNSFEENAMIKSLTAAK 64
           +++AS+N  K+ E+  ++   G+ +   L L  +     P E G +F +NA IK+     
Sbjct: 3   LLLASNNAKKLKELQRILDQAGLDSVELLALRDVEAYDEPIEDGRTFADNAQIKARAGVA 62

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP-A 123
           + G+  ++DDSG+ ++ L+G PG+ SARW    +G    D A  ++   L ++  H P  
Sbjct: 63  HTGIATIADDSGIAVEELNGMPGVLSARW----SGAHGNDTANNEL---LLAQMEHVPDE 115

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQP----NGYDRTFG 179
            R+A F+SV  LA PDG      G+  G ++  P+G+ GFGYDP+F P     G  R+  
Sbjct: 116 RRNAAFVSVCVLALPDGQEFVQEGRWEGQLLRGPKGENGFGYDPLFIPAEEIGGQGRSSA 175

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           E++ EEK               D LSHR +A +  V+   ++
Sbjct: 176 ELSAEEK---------------DALSHRGQALRGLVEKIAQV 202


>gi|308177069|ref|YP_003916475.1| nucleoside-triphosphatase [Arthrobacter arilaitensis Re117]
 gi|307744532|emb|CBT75504.1| nucleoside-triphosphatase [Arthrobacter arilaitensis Re117]
          Length = 210

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 107/216 (49%), Gaps = 33/216 (15%)

Query: 9   IVIASHNVDKIHEMDSLI------MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           +V+AS N  K+ E+  L+      + +      A       P E   +F+ NA+ K+   
Sbjct: 6   LVLASRNQGKLRELRELLRGQVPGLDVDTQVVDAATAGAGDPVEDQVTFQGNALKKAREI 65

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTG-ERDFDMAMQKIENALRSKFAHD 121
           + + G+ AL+DDSGL +DVL G PGI SARW+  +   E + D+ + ++ +         
Sbjct: 66  SASTGLVALADDSGLSVDVLGGAPGIFSARWSGVHGNDEANIDLLLGQLGDIAAE----- 120

Query: 122 PAFRSAHFISVLSLAWPDG--HVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
              R A F+   +LA P G  HVE   GKV G++     G+ GFGYDPIF+P G  +T  
Sbjct: 121 --HRGAQFVCAAALATPQGEEHVE--LGKVQGVLRTERSGEHGFGYDPIFEPAGAGKTMA 176

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           E T EEKN                +SHRARAF   +
Sbjct: 177 EHTAEEKNA---------------ISHRARAFAALL 197


>gi|293401527|ref|ZP_06645670.1| HAM1 protein [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305165|gb|EFE46411.1| HAM1 protein [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 752

 Score =  108 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 106/204 (51%), Gaps = 24/204 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           ++IA+ N  K+ E  +++ PLG    S L+LN  I  EETG +F+ENA+IK+    +   
Sbjct: 561 MMIATSNAHKVEEFKAMLEPLGYHIKSLLDLNEPIDIEETGTTFQENALIKAKAIYEQYH 620

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +  ++DDSGL ++ + G+PG++SAR+   +T    +D+  Q I +  +       A +  
Sbjct: 621 IAVIADDSGLAVNAMHGEPGVYSARFMGRDT---SYDVKNQYIIDQCKHV-----ADKGC 672

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+  ++    DG  + F+G V G++     G  GFGYDPIF    Y  T   ++EE+KN
Sbjct: 673 QFVCAIAYVDEDGKEQVFTGIVEGLVADHMEGAKGFGYDPIFYYPPYQTTLANVSEEKKN 732

Query: 188 GGIDSATLFSILSTDLLSHRARAF 211
                           +SHR RA 
Sbjct: 733 A---------------VSHRGRAL 741


>gi|86133178|ref|ZP_01051760.1| Ham1 family protein [Polaribacter sp. MED152]
 gi|85820041|gb|EAQ41188.1| Ham1 family protein [Polaribacter sp. MED152]
          Length = 191

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 71/210 (33%), Positives = 113/210 (53%), Gaps = 28/210 (13%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           +V A++N++K+ E+  + +P  I   S  ++N     +ET N+ + NA +K+    KN G
Sbjct: 3   LVFATNNLNKLKEVQEM-LPSSIELLSLKDINCNEEVDETENTLQGNAKLKADYITKNYG 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
               +DD+GL ++ LDGKPG++SAR+A E  + ER+    MQK+ + L++K     + R+
Sbjct: 62  YNCFADDTGLEVEALDGKPGVYSARFAGEPRSAERN----MQKLLDELKNK-----SNRN 112

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F + + L   D     F G  +G I+   +G  GFGYDPIF+P  Y+ +F  M+  EK
Sbjct: 113 AQFRTAICLNLDDKQFL-FEGICTGEILHSKQGDKGFGYDPIFKPTNYNESFSTMSAAEK 171

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           N                +SHR  A +  VD
Sbjct: 172 NK---------------ISHRGIAVQKLVD 186


>gi|225027841|ref|ZP_03717033.1| hypothetical protein EUBHAL_02101 [Eubacterium hallii DSM 3353]
 gi|224954788|gb|EEG35997.1| hypothetical protein EUBHAL_02101 [Eubacterium hallii DSM 3353]
          Length = 199

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 111/215 (51%), Gaps = 32/215 (14%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGI----MTTSALELNLIIPEETGNSFEENAMIKS 59
           +++  ++ A+ N  K+ E+  ++  L      M  + ++++++   E G +FEENA+IK+
Sbjct: 5   ILKKKLIFATGNKGKMKEIREILGDLDYEILSMKEAGVDVDIV---EDGTTFEENAIIKA 61

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
            T  +  G   L+DDSGL +D L+ +PG++SAR+   NT  R        I+N +     
Sbjct: 62  KTVMEATGSLVLADDSGLEVDYLNKEPGVYSARYMGENTSYR--------IKNQIILDRL 113

Query: 120 HD--PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
           H      RSA F+ V++ A+PDG VE     + G I   P G+ GFGYDPIF      +T
Sbjct: 114 HGVPDIVRSARFVCVIAAAFPDGRVETRRATIEGRIAQEPAGENGFGYDPIFYLPEKGKT 173

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
             +++ EEKN                +SHR +A +
Sbjct: 174 TAQLSAEEKNE---------------ISHRGKALR 193


>gi|323701931|ref|ZP_08113600.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfotomaculum nigrificans DSM 574]
 gi|323533017|gb|EGB22887.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfotomaculum nigrificans DSM 574]
          Length = 201

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 109/211 (51%), Gaps = 32/211 (15%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNA 66
            +V+A+ N  K+ E+ +++  +     SA +       EE G++F+ NA+ K+  AA+  
Sbjct: 2   KLVLATSNQGKVKELAAMLKDMDFEVVSARDYPGFPEVEEDGDTFKANAIKKARAAAQFT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMA-----MQKIENALRSKFAHD 121
           G  +L+DDSGL +D L+G PG++SAR+A    GE   D A     ++ +EN         
Sbjct: 62  GELSLADDSGLEVDALNGAPGVYSARFA----GEPKDDAANNRKLLKLMENV-------P 110

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           PA R+  F  V+++A PDG +    G   GII+   +G  GFGYDP+F    Y +TF E+
Sbjct: 111 PARRTGRFRCVIAIARPDGEIYTVDGTCEGIILEELKGDGGFGYDPLFYVPAYQKTFAEL 170

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFK 212
              EKN                +SHR +A +
Sbjct: 171 DLAEKN---------------TISHRGKALE 186


>gi|293394480|ref|ZP_06638776.1| non-canonical purine NTP pyrophosphatase RdgB [Serratia odorifera
           DSM 4582]
 gi|291422945|gb|EFE96178.1| non-canonical purine NTP pyrophosphatase RdgB [Serratia odorifera
           DSM 4582]
          Length = 200

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 111/216 (51%), Gaps = 31/216 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+  L+   G+   +  EL +   EETG +F ENA++K+  AAK  
Sbjct: 4   QKVVLATGNPGKVRELADLLADFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKIT 63

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           G+PA++DDSGL +D L G PGI+SAR+A E  + +++ D  +  +++  + +       R
Sbjct: 64  GLPAIADDSGLAVDALGGAPGIYSARYAGEDASDQQNLDKLLVALKDLPQGQ-------R 116

Query: 126 SAHFISVLSLAWPDGHVENFS-----GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            A F  VL       H E+ +     G  SG I +   GQ GFGYDPIF      RT  E
Sbjct: 117 GAQFHCVLVYLR---HAEDPTPLVCHGSWSGEITFASAGQGGFGYDPIFYVPALSRTAAE 173

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           ++ +EK+                +SHR +A    ++
Sbjct: 174 LSRDEKSA---------------VSHRGQALTLLLE 194


>gi|229543642|ref|ZP_04432702.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bacillus coagulans 36D1]
 gi|229328062|gb|EEN93737.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bacillus coagulans 36D1]
          Length = 202

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 109/216 (50%), Gaps = 27/216 (12%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           ++IA+ N  K  E  +L     +   + L++      EETG +FEENA++K+  AA   G
Sbjct: 4   VLIATKNKGKAKEFAALFSRFELEVKTFLDMEGAPDVEETGKTFEENAILKAEAAANAYG 63

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           M A++DDSGL+ID L G+PG++SAR+A +    E + D  + ++E     K       R+
Sbjct: 64  MMAIADDSGLMIDALGGRPGVYSARYAGKEKNDEANIDKVLSELEGVPDEK-------RT 116

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQ-PNGYDRTFGEMTEEE 185
           A F   L++A P       SG + G I     G+ GFGYDPIF  P+G  +T  +++ EE
Sbjct: 117 ASFYCALAVARPGKETFTVSGTLQGRITRERIGENGFGYDPIFMLPSG--KTLAQLSAEE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           KN                +SHRA A     D    I
Sbjct: 175 KNK---------------ISHRAHALAKLSDALYSI 195


>gi|95929459|ref|ZP_01312202.1| Ham1-like protein [Desulfuromonas acetoxidans DSM 684]
 gi|95134575|gb|EAT16231.1| Ham1-like protein [Desulfuromonas acetoxidans DSM 684]
          Length = 195

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 100/182 (54%), Gaps = 9/182 (4%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNA 66
            +V+A+ N  K+ E+  ++   GI          ++P +E G +F +NA  K+L  A+  
Sbjct: 2   QLVVATQNQGKLKEIRRVLADCGIEVVGMDSFADLVPAQEDGETFADNAHKKALAIARQT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           GM  L+DDSGL +  LDG+PG++SAR+A E +T  ++  + ++++      +       R
Sbjct: 62  GMLCLADDSGLTVAALDGRPGVYSARYAGEGSTDAQNNALLIEELAGVPEPR-------R 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F  V++L  PD   + F G++ G I+   +GQ GFGYDP+F    +  T  E+  +E
Sbjct: 115 QAAFWCVMALCTPDDDCQLFEGRIEGRILDQAQGQGGFGYDPLFFVESHGCTMAELPLDE 174

Query: 186 KN 187
           KN
Sbjct: 175 KN 176


>gi|229098952|ref|ZP_04229887.1| Nucleoside-triphosphatase [Bacillus cereus Rock3-29]
 gi|229117981|ref|ZP_04247341.1| Nucleoside-triphosphatase [Bacillus cereus Rock1-3]
 gi|228665430|gb|EEL20912.1| Nucleoside-triphosphatase [Bacillus cereus Rock1-3]
 gi|228684450|gb|EEL38393.1| Nucleoside-triphosphatase [Bacillus cereus Rock3-29]
          Length = 205

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 109/210 (51%), Gaps = 26/210 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                ++DDSGL++D L+GKPG++SAR+A E    + + D  +Q++ N +      D   
Sbjct: 65  LDSIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQANMDKVLQEL-NGI------DFEK 117

Query: 125 RSAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+   E    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEADKEPVIVNGTCEGYILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFK 212
            +EKN                +SHR RA +
Sbjct: 178 SDEKNA---------------ISHRGRALR 192


>gi|87123049|ref|ZP_01078900.1| Ham1-like protein [Synechococcus sp. RS9917]
 gi|86168769|gb|EAQ70025.1| Ham1-like protein [Synechococcus sp. RS9917]
          Length = 195

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 70/186 (37%), Positives = 100/186 (53%), Gaps = 16/186 (8%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALE-LNLIIPEETGNSFEENAMIKSLTA 62
           + +  +VIAS N  KI E   L+  + +      E L++   EE+G++F  NA +K+   
Sbjct: 1   MSQRTLVIASGNAGKIREFARLLSAVPLEVKPQPEGLDV---EESGSTFAANARLKACAV 57

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A   G  AL+DDSGL +D L G PG+ SAR+A ++          ++I   L+ +   +P
Sbjct: 58  AVATGAWALADDSGLSVDALQGAPGVFSARYAATDP---------ERIARLLQ-ELGDNP 107

Query: 123 AFRSAHFISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
             R AHF + L +A PDG V     G+  G+I   PRG  GFGYDPIF+      TF EM
Sbjct: 108 N-RDAHFSAALCIAAPDGSVLAEVEGQCHGLITTAPRGDQGFGYDPIFEVANTGLTFAEM 166

Query: 182 TEEEKN 187
           + EEK 
Sbjct: 167 SLEEKK 172


>gi|269977415|ref|ZP_06184387.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Mobiluncus mulieris 28-1]
 gi|269934331|gb|EEZ90893.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Mobiluncus mulieris 28-1]
          Length = 236

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 113/228 (49%), Gaps = 34/228 (14%)

Query: 8   NIVIASHNVDKIHEMDSLIMPL-------GIMTTSALELNLIIPEETGNSFEENAMIKSL 60
            +V+A+ N  K+ E+  ++ PL       GI+ +   EL +  P E G SF  NA+IK+ 
Sbjct: 25  QVVMATGNAHKVKEVAEILRPLVPSLQPDGIVASG--ELGIPSPIENGTSFSANALIKAR 82

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             A+   +P L+DDSGL +++L G PGI SARWA    G    D A  ++     S    
Sbjct: 83  ALAEYVKLPILADDSGLTVEILGGAPGIFSARWA----GAHGDDQANLQLLLNQLSDVP- 137

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPN---GYD-R 176
           DP  R A F+ V  L  P G     +G + G +   PRG+ GFGYDPIF P+   G D R
Sbjct: 138 DP-HRGAAFVCVAVLLLPSGKTYLGNGVMGGRLTTRPRGKNGFGYDPIFIPDAQIGEDKR 196

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           T  +++ ++KN                +SHRA AF+        I E+
Sbjct: 197 TNAQLSAKDKNA---------------ISHRASAFRQIAPQLEAILER 229


>gi|253569098|ref|ZP_04846508.1| nucleoside-triphosphatase [Bacteroides sp. 1_1_6]
 gi|251841117|gb|EES69198.1| nucleoside-triphosphatase [Bacteroides sp. 1_1_6]
          Length = 193

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 106/184 (57%), Gaps = 10/184 (5%)

Query: 5   IENNIVIASHNVDKIHEMDSLIM-PLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           ++  +V A++N  K+ E+ +++   + +++ + ++ +  IPE T  + E NA++KS    
Sbjct: 1   MKRKLVFATNNAHKLEEVAAILGDKVELLSLNDIDCHTDIPE-TAETLEGNALLKSSFIY 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +N  +   +DD+GL ++ L+G PG++SAR+AE      D    M+K+ + L  K      
Sbjct: 60  RNYQLDCFADDTGLEVEALNGAPGVYSARYAEGEG--HDAQANMRKLLHELEGKENRKAQ 117

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           FR+A  IS++     DG    F G + G I+   RG  GFGYDPIF+P GY++TF E+  
Sbjct: 118 FRTA--ISLI----LDGKEYLFEGVIKGEIIKEKRGDSGFGYDPIFKPEGYEQTFAELGN 171

Query: 184 EEKN 187
           E KN
Sbjct: 172 ETKN 175


>gi|29348537|ref|NP_812040.1| putative deoxyribonucleoside-triphosphatase [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|62900284|sp|Q8A327|NTPA_BACTN RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|29340442|gb|AAO78234.1| putative xanthosine triphosphate pyrophosphatase [Bacteroides
           thetaiotaomicron VPI-5482]
          Length = 193

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 106/184 (57%), Gaps = 10/184 (5%)

Query: 5   IENNIVIASHNVDKIHEMDSLIM-PLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           ++  +V A++N  K+ E+ +++   + +++ + ++ +  IPE T  + E NA++KS    
Sbjct: 1   MKRKLVFATNNAHKLEEIAAILGDKVELLSLNDIDCHTDIPE-TAETLEGNALLKSSFIY 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +N  +   +DD+GL ++ L+G PG++SAR+AE      D    M+K+ + L  K      
Sbjct: 60  RNYQLDCFADDTGLEVEALNGAPGVYSARYAEGEG--HDAQANMRKLLHELEGKENRKAQ 117

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           FR+A  IS++     DG    F G + G I+   RG  GFGYDPIF+P GY++TF E+  
Sbjct: 118 FRTA--ISLI----LDGKEYLFEGVIKGEIIKEKRGDSGFGYDPIFKPEGYEQTFAELGN 171

Query: 184 EEKN 187
           E KN
Sbjct: 172 ETKN 175


>gi|228910314|ref|ZP_04074131.1| Nucleoside-triphosphatase [Bacillus thuringiensis IBL 200]
 gi|228849374|gb|EEM94211.1| Nucleoside-triphosphatase [Bacillus thuringiensis IBL 200]
          Length = 205

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 108/209 (51%), Gaps = 24/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKN 65
             +V+A+ N+ K+ E   L     +   S  +   I   EETG +FEENA++K+ + ++ 
Sbjct: 5   KQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSRQ 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                ++DDSGL++D L+GKPG++SAR+A    GE   D A   I+  L+     D   R
Sbjct: 65  LNSIVIADDSGLIVDALNGKPGVYSARFA----GEPKNDQA--NIDKVLQELNGIDFEKR 118

Query: 126 SAHFISVLSLAWPDGHVEN--FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F   L++A+P+G  +    +G   G I+   RG+ GFGYDPIF    Y +   E++ 
Sbjct: 119 KARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKAMAELSS 178

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFK 212
           ++KN                +SHR RA +
Sbjct: 179 DKKNA---------------ISHRGRALR 192


>gi|253579969|ref|ZP_04857237.1| Ham1 family protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848968|gb|EES76930.1| Ham1 family protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 194

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 111/215 (51%), Gaps = 30/215 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL---IIPEETGNSFEENAMIKSLTAA 63
             I+ A+ N DK+ E+  ++  + +   S  E  +   I+  E G++FEENA+IK+ T  
Sbjct: 2   KKIIFATGNQDKMREIREILADMDVEVVSMKEAGIHADIV--EDGSTFEENAVIKAKTIC 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA-LRSKFAHDP 122
           +  G   L+DDSGL ID L+ +PGI+SAR+   +T           I+NA L  +    P
Sbjct: 60  ELTGEITLADDSGLEIDYLNKEPGIYSARYMGEDTS--------YHIKNASLIERLNGVP 111

Query: 123 -AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F+  ++ A+PDG V+   G + G I +  +G+ GFGYDPIF    Y  T  E+
Sbjct: 112 DEKRTARFVCAVAAAFPDGSVKTVRGTMEGRIGYEEKGENGFGYDPIFYLPEYGCTSAEL 171

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           + EEKN                +SHR +A +   D
Sbjct: 172 SGEEKNK---------------ISHRGKALRAIKD 191


>gi|217967719|ref|YP_002353225.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dictyoglomus turgidum DSM 6724]
 gi|217336818|gb|ACK42611.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dictyoglomus turgidum DSM 6724]
          Length = 204

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 101/186 (54%), Gaps = 18/186 (9%)

Query: 9   IVIASHNVDKIHEMDSLIMPLG--IMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           I++A+ N  KI E+  ++      I T   L L++ +PEE G S+EENA IK+   A+  
Sbjct: 5   IILATKNEGKIREILDILSEYRSWIKTLKDLNLDIELPEELGESYEENAFIKARYIAELT 64

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA----LRSKFAHDP 122
           G P +++DSGL ID L G+ GIHSAR+  S   +    + ++K+++      +++F    
Sbjct: 65  GYPVIAEDSGLEIDALKGELGIHSARFGGSVGYKEKIRLVLEKMKDIPWEDRKARFVCKA 124

Query: 123 AFR-SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            F      I +++            GKV G I + PRG+ GFGYDPIF      +TFGE+
Sbjct: 125 VFYDEKEDIKIIT-----------GGKVEGYIAYEPRGERGFGYDPIFYFPPLGKTFGEI 173

Query: 182 TEEEKN 187
            E EKN
Sbjct: 174 NEFEKN 179


>gi|289551044|ref|YP_003471948.1| Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Staphylococcus lugdunensis HKU09-01]
 gi|315658540|ref|ZP_07911412.1| nucleoside-triphosphatase [Staphylococcus lugdunensis M23590]
 gi|289180576|gb|ADC87821.1| Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Staphylococcus lugdunensis HKU09-01]
 gi|315496869|gb|EFU85192.1| nucleoside-triphosphatase [Staphylococcus lugdunensis M23590]
          Length = 193

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 105/205 (51%), Gaps = 24/205 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +IVIA++N  KI++  ++     ++  S L  +  + EETG +FEENA++KS  AAK   
Sbjct: 3   DIVIATNNQGKINDFKAIFPNDNVIGISELLKDFDV-EETGTTFEENAILKSEAAAKRLN 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
              ++DDSGL +  L+G+PG++SAR+A         D       + L SK   D   R A
Sbjct: 62  KRVIADDSGLEVFALNGEPGVYSARYA-------GLDKNDDDNIDKLLSKLT-DITQREA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+ V+S++ PD     F G VSG I    RG  GFGYDP+F      RT  E++  EK+
Sbjct: 114 QFVCVISMSEPDQPTRTFKGTVSGRITDERRGDNGFGYDPVFYVPEKGRTMAELSATEKS 173

Query: 188 GGIDSATLFSILSTDLLSHRARAFK 212
                           +SHR  A K
Sbjct: 174 ---------------QISHRGEAIK 183


>gi|283853645|ref|ZP_06370879.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfovibrio sp. FW1012B]
 gi|283570978|gb|EFC19004.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfovibrio sp. FW1012B]
          Length = 209

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 71/210 (33%), Positives = 104/210 (49%), Gaps = 24/210 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLTAAKN 65
            +V+A+ N  KI E+ +L+ PLG+      +   I  IPE TG++F ENA IK+    + 
Sbjct: 12  KVVLATRNQGKIRELSALLAPLGVTVVGLADFPDIGEIPE-TGDTFLENARIKARAVCQA 70

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ +L+DDSGL +D L G PG++SAR+A  N  +     A    +         DPA R
Sbjct: 71  TGLVSLADDSGLCVDALAGAPGVYSARYAGENASD-----AANNAKLLAALAHVPDPA-R 124

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +  F+SV+  A PDG      G   G +   P G+ GFGYDP+F    +D T G+   E 
Sbjct: 125 TCRFVSVVVAAGPDGRELTAEGAWEGRVAASPSGEGGFGYDPLF----FDPTAGQTAAE- 179

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFV 215
                      +  + +  SHR +A    V
Sbjct: 180 ----------LAPAAKNARSHRGKALAGLV 199


>gi|153807055|ref|ZP_01959723.1| hypothetical protein BACCAC_01332 [Bacteroides caccae ATCC 43185]
 gi|149130175|gb|EDM21385.1| hypothetical protein BACCAC_01332 [Bacteroides caccae ATCC 43185]
          Length = 194

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 107/186 (57%), Gaps = 12/186 (6%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIM-PLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           +++  +V A++N  K+ E+ +++   + +++ + +  +  IPE T  + E NA++KS   
Sbjct: 1   MMKRKLVFATNNAHKLEEVAAILGDQIELLSLNDIGCHTDIPE-TAETLEGNALLKSSFI 59

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE-RDFDMAMQKIENALRSKFAHD 121
            KN G+   +DD+GL ++ LDG PG++SAR+A    GE  D    M K+ + L  K    
Sbjct: 60  FKNYGLDCFADDTGLEVEALDGAPGVYSARYA---GGEGHDAQANMLKLLHELEGKENRK 116

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
             FR+A  IS++     DG    F G + G I+   RG  GFGYDP+F+P GY+RTF E+
Sbjct: 117 AQFRTA--ISLI----LDGKEYLFEGVIKGEIIREKRGDSGFGYDPVFKPEGYERTFAEL 170

Query: 182 TEEEKN 187
             + KN
Sbjct: 171 GNDVKN 176


>gi|170725688|ref|YP_001759714.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella woodyi ATCC 51908]
 gi|169811035|gb|ACA85619.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella woodyi ATCC 51908]
          Length = 200

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 74/219 (33%), Positives = 110/219 (50%), Gaps = 30/219 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           +  V+AS N  K+ E   +    G+      + N+    ETG +F ENA+IK+  AA+  
Sbjct: 2   DKFVLASGNKGKLKEFSEIFSEYGVEVFPQSQFNVAEVPETGTTFVENAIIKARHAAQVT 61

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           GM A++DDSGL +D+L+G PGI+SAR+A    GE D  +   K+ +AL+ K    P  R+
Sbjct: 62  GMAAIADDSGLEVDLLEGAPGIYSARYAGEGAGETDNYI---KLLDALKDK----PQART 114

Query: 127 AHFISVLSLAWPDGHVENFSGKVS-----GIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           A F  +L       H ++ +  +      G I +  +G  G GYDPIF PN +  +  E+
Sbjct: 115 ARFQCILVYMR---HAKDPTPIICQAAWEGKISFEAKGDNGHGYDPIFIPNEHSCSAAEL 171

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           + EEKN                LSHR +A    +D   R
Sbjct: 172 SSEEKN---------------RLSHRGKAMTLLIDAMRR 195


>gi|313835877|gb|EFS73591.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Propionibacterium acnes HL037PA2]
 gi|314927123|gb|EFS90954.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Propionibacterium acnes HL044PA1]
 gi|314970766|gb|EFT14864.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Propionibacterium acnes HL037PA3]
 gi|328906031|gb|EGG25806.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Propionibacterium sp. P08]
          Length = 204

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 108/215 (50%), Gaps = 28/215 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLG--IMTTSALEL-NLIIPEETGNSFEENAMIKSLTAA 63
           + IV+AS+NV K+ E+       G  +   S  E+ +   PEETG +F ENA+IK+  AA
Sbjct: 2   SRIVLASNNVKKLVELRRTFEAAGTDVEIVSLAEVSDAPAPEETGRTFVENALIKARAAA 61

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWA-ESNTGERDFDMAMQKIENALRSKFAHDP 122
            + G+PAL+DDSGL +D L+  PGI SARW+    T  R+  + + +  +       HD 
Sbjct: 62  CDTGLPALADDSGLEVDALNRMPGIRSARWSGPKATDARNLQLLLDQTFD-----LPHD- 115

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGY--DRTFGE 180
             R   F+  ++    DG        + G I+   RG+ GFGYDP+F P+    D T  E
Sbjct: 116 -RRHGRFVCAMAFVDSDGTEITKVATMEGRIISQARGENGFGYDPMFVPDAQPGDLTSAE 174

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           MT E K               D +SHR +A +  V
Sbjct: 175 MTPEAK---------------DAISHRGQAVRAIV 194


>gi|218246212|ref|YP_002371583.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Cyanothece sp. PCC 8801]
 gi|218166690|gb|ACK65427.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Cyanothece sp. PCC 8801]
          Length = 190

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 112/212 (52%), Gaps = 34/212 (16%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M+KLI     +A+ N  K+ EM + +   G+     L+ + +  EE G++F ENA +K+ 
Sbjct: 1   MKKLI-----VATSNPGKLREMQAYLT--GLDWELQLKPDSLEIEEIGSTFSENACLKAS 53

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             AK  G  A++DDSGL +D L+G PG++SAR+  ++T ER     +Q++   L      
Sbjct: 54  QVAKALGEWAIADDSGLAVDALNGAPGLYSARYGTTDT-ER-----IQRLLTEL-----A 102

Query: 121 DPAFRSAHFISVLSLAWPDGHVE-NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
           D   R A FI V+++A PDG +     G  SG I+  PRG  GFGYDPIF      +TF 
Sbjct: 103 DNQQRQAQFICVVAIARPDGSIALQTEGICSGEILTHPRGTGGFGYDPIFYVPQQQQTFA 162

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAF 211
           EM  E K+                +SHR +AF
Sbjct: 163 EMPPEVKHQ---------------ISHRGQAF 179


>gi|27467762|ref|NP_764399.1| hypothetical protein SE0844 [Staphylococcus epidermidis ATCC 12228]
 gi|251810599|ref|ZP_04825072.1| nucleoside-triphosphatase [Staphylococcus epidermidis BCM-HMP0060]
 gi|282876401|ref|ZP_06285268.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus epidermidis SK135]
 gi|293366867|ref|ZP_06613543.1| ribonuclease PH/Ham1 protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|38258108|sp|Q8CSY5|NTPA_STAES RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|27315306|gb|AAO04441.1|AE016746_231 conserved hypothetical protein [Staphylococcus epidermidis ATCC
           12228]
 gi|251805759|gb|EES58416.1| nucleoside-triphosphatase [Staphylococcus epidermidis BCM-HMP0060]
 gi|281295426|gb|EFA87953.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Staphylococcus epidermidis SK135]
 gi|291319168|gb|EFE59538.1| ribonuclease PH/Ham1 protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329729985|gb|EGG66376.1| non-canonical purine NTP pyrophosphatase RdgB [Staphylococcus
           epidermidis VCU144]
 gi|329734449|gb|EGG70762.1| non-canonical purine NTP pyrophosphatase RdgB [Staphylococcus
           epidermidis VCU045]
 gi|329736338|gb|EGG72610.1| non-canonical purine NTP pyrophosphatase RdgB [Staphylococcus
           epidermidis VCU028]
          Length = 195

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 103/179 (57%), Gaps = 9/179 (5%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           +IVIA++N  KI++  ++     ++  S L  +  + EETG +FEENA +KS  AA    
Sbjct: 3   DIVIATNNQGKINDFKAIFKNQHVIGISELIEDFDV-EETGATFEENARLKSEAAAHALN 61

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
              ++DDSGL +  L+G+PG++SAR+A    G+ D D     IE  L +    D   R A
Sbjct: 62  KRVIADDSGLEVFALNGEPGVYSARYA--GLGKNDED----NIEKLLTN--LEDVQDRRA 113

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            F+ V+S++ P+   + F G VSG+I     G+ GFGYDPIF     ++T  E+T +EK
Sbjct: 114 QFVCVISMSAPNEKTKTFKGTVSGVITTERHGKNGFGYDPIFFVPELNKTMAEITNDEK 172


>gi|172036691|ref|YP_001803192.1| putative Ham1-like protein [Cyanothece sp. ATCC 51142]
 gi|171698145|gb|ACB51126.1| putative Ham1-like protein [Cyanothece sp. ATCC 51142]
          Length = 219

 Score =  108 bits (270), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 111/220 (50%), Gaps = 37/220 (16%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE----ETGNSFEENAM 56
           + ++++  +++A+ N  K+ EM   ++       S  EL L  PE    ETG +F ENA 
Sbjct: 20  IERIMKQKLIVATGNPGKLQEMQEYLI------ESDWELQLKPPEIDIEETGETFVENAC 73

Query: 57  IKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRS 116
           +K+