PSIBLAST alignment of GI: 254780629 and protein with PDB id: 1v7r

gi|40889889|pdb|1V7R|A Chain A, Structure Of Nucleotide Triphosphate Pyrophosphatase From Pyrococcus Horikoshii Ot3 Length = 186
>gi|158428121|pdb|2DVN|A Chain A, Structure Of Ph1917 Protein With The Complex Of Imp From Pyrococcus Horikoshii Length = 186
 Score =  132 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 63/217 (29%), Positives = 86/217 (39%), Gaps = 32/217 (14%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             I   + N  K+ E+ + +   GI            PE      E+             
Sbjct: 1   MKIFFITSNPGKVREVANFLGTFGIEIVQLKH---EYPEIQAEKLEDVVDFGISWLKGKV 57

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
             P + +DSGL I+ L G PG++S+ +     G       M+  E+            R 
Sbjct: 58  PEPFMIEDSGLFIESLKGFPGVYSS-YVYRTIGLEGILKLMEGAED------------RR 104

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A+F SV+   + DG    FSG   G I    RG  GFGYDPIF P G ++TF EMT EEK
Sbjct: 105 AYFKSVIG-FYIDGKAYKFSGVTWGRISNEKRGTHGFGYDPIFIPEGSEKTFAEMTIEEK 163

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           N                LSHR +A K F +      +
Sbjct: 164 NA---------------LSHRGKALKAFFEWLKVNLK 185