BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780629|ref|YP_003065042.1| putative deoxyribonucleotide
triphosphate pyrophosphatase [Candidatus Liberibacter asiaticus str.
psy62]
         (224 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780629|ref|YP_003065042.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040306|gb|ACT57102.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 224

 Score =  213 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 224/224 (100%), Positives = 224/224 (100%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL
Sbjct: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH
Sbjct: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE
Sbjct: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK
Sbjct: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224


>gi|315121830|ref|YP_004062319.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495232|gb|ADR51831.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 223

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 161/224 (71%), Positives = 191/224 (85%), Gaps = 1/224 (0%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL+E +IVIASHN DKIHE+ +L+ PLGI+T SALEL+L++PEETG++FEENA+IK+L
Sbjct: 1   MRKLVEKSIVIASHNYDKIHEIRNLVAPLGIVTKSALELDLVVPEETGDTFEENAIIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           +AA+ AG+PAL+DDSGLV+D LDGKPGI+SARWAE++TGERDF MAMQKIE  L S+ A+
Sbjct: 61  SAAQCAGIPALADDSGLVVDALDGKPGIYSARWAETSTGERDFYMAMQKIEEHLISQGAN 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P+ R AHFIS L LAWPDGHVE F G+V GIIVWPPRGQLGFGYDPIFQPNGYDRTFGE
Sbjct: 121 APSLRFAHFISALCLAWPDGHVEKFCGRVDGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           MTE+EKNG I    + S    DL+SHRARAFKC  D+CL +DEK
Sbjct: 181 MTEKEKNGEITR-EILSRSRDDLVSHRARAFKCLFDSCLCVDEK 223


>gi|209547616|ref|YP_002279533.1| deoxyribonucleotide triphosphate pyrophosphatase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209533372|gb|ACI53307.1| Ham1 family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 214

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 130/220 (59%), Positives = 155/220 (70%), Gaps = 7/220 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI PLG    SA ELN + P+ETG SFEENA IK++
Sbjct: 1   MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPDETGTSFEENATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  AGMPALSDDSGLV+D LDG PG+++A WAE++ G RDFDMAM K+E AL+   A 
Sbjct: 61  ASANAAGMPALSDDSGLVVDALDGDPGVYTANWAETSNGTRDFDMAMAKVEKALQDAGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGH E F G+V G +VWPPRG  GFGYDP+FQP GY  TFGE
Sbjct: 121 TPEQRTARFVSVLCLAWPDGHTELFRGEVEGSVVWPPRGGQGFGYDPVFQPEGYGVTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           M+ EEK+        +S+     LSHRARAFK FV+ CL 
Sbjct: 181 MSGEEKH-------GWSVGKPQALSHRARAFKLFVETCLE 213


>gi|159184260|ref|NP_353358.2| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Agrobacterium tumefaciens str. C58]
 gi|22653753|sp|Q8UIG9|NTPA_AGRT5 RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|159139587|gb|AAK86143.2| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Agrobacterium tumefaciens str. C58]
          Length = 214

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 131/220 (59%), Positives = 155/220 (70%), Gaps = 7/220 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI P G    SA ELN   PEETG +FEENA IK+L
Sbjct: 1   MRKLDTRTIVVASHNKGKIAEIADLIGPFGFSAKSAAELNFSEPEETGTTFEENAAIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +AK +G+PALSDDSGLVID LDG PG+++A WAE+  G RDF MAMQK+E+AL  + A 
Sbjct: 61  ASAKASGLPALSDDSGLVIDALDGAPGVYTANWAETADGTRDFAMAMQKVEDALAERGAS 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGHVE F G+V G +VWPPRG  GFGYDPIF+P+GYD TFGE
Sbjct: 121 KPEDRTARFVSVLCLAWPDGHVEYFRGEVEGTVVWPPRGTSGFGYDPIFKPDGYDTTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           M+ +EK+G               LSHRARAFK FV+ CL 
Sbjct: 181 MSADEKHGWKHGDA-------FALSHRARAFKKFVETCLE 213


>gi|218459792|ref|ZP_03499883.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhizobium etli Kim 5]
          Length = 214

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 129/220 (58%), Positives = 152/220 (69%), Gaps = 7/220 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI PLG    SA ELN + P+ETG SFEENA IK++
Sbjct: 1   MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPDETGTSFEENATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  AGMPALSDDSGLV+D L G PG+++A WAE   G RDFDMAM K+E AL+   A 
Sbjct: 61  ASAHAAGMPALSDDSGLVVDALGGDPGVYTANWAERADGTRDFDMAMAKVEKALQDAGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGH E F G+V G +VWPPRG  GFGYDP+FQP GY  TFGE
Sbjct: 121 TPEQRTARFVSVLCLAWPDGHTELFRGEVEGNVVWPPRGTQGFGYDPVFQPEGYGVTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           M+ EEK+        ++I     LSHRARAFK FV+ CL 
Sbjct: 181 MSGEEKH-------GWNIGKPQALSHRARAFKLFVETCLE 213


>gi|116250147|ref|YP_765985.1| deoxyribonucleotide triphosphate pyrophosphatase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|241202759|ref|YP_002973855.1| deoxyribonucleotide triphosphate pyrophosphatase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|115254795|emb|CAK05869.1| putative HAM1 family protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|240856649|gb|ACS54316.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 214

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 129/220 (58%), Positives = 153/220 (69%), Gaps = 7/220 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI PLG    SA ELN + P+ETG SFEENA IK++
Sbjct: 1   MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPDETGTSFEENATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  +GMPALSDDSGLV+D L G PG+++A WAE   G RDFDMAM K+E AL+   A 
Sbjct: 61  ASANASGMPALSDDSGLVVDALGGDPGVYTANWAEKADGTRDFDMAMAKVEKALQDAGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A FISVL LAWPDGH E F G+V G +VWPPRG  GFGYDP+FQP GYD TFGE
Sbjct: 121 KPEQRTARFISVLCLAWPDGHTELFRGEVEGSVVWPPRGTQGFGYDPVFQPEGYDITFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           M+ EEK+        +++     LSHRARAFK FV+ CL 
Sbjct: 181 MSGEEKH-------GWNVGKPQALSHRARAFKLFVETCLE 213


>gi|190890030|ref|YP_001976572.1| nucleoside-triphosphatase, HAM1-like protein [Rhizobium etli CIAT
           652]
 gi|218516542|ref|ZP_03513382.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhizobium etli 8C-3]
 gi|190695309|gb|ACE89394.1| probable nucleoside-triphosphatase protein, HAM1-like protein
           [Rhizobium etli CIAT 652]
          Length = 214

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 129/220 (58%), Positives = 152/220 (69%), Gaps = 7/220 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI PLG    SA ELN + P+ETG SFEENA IK++
Sbjct: 1   MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPDETGTSFEENATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  AGMPALSDDSGLV+D L G PG+++A WAE   G RDFDMAM K+E AL+   A 
Sbjct: 61  ASAHAAGMPALSDDSGLVVDALGGDPGVYTANWAEKADGTRDFDMAMAKVEKALQDAGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGH E F G+V G +VWPPRG  GFGYDP+FQP GY  TFGE
Sbjct: 121 APEQRTARFVSVLCLAWPDGHTELFRGEVEGNVVWPPRGTQGFGYDPVFQPEGYGVTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           M+ EEK+        ++I     LSHRARAFK FV+ CL 
Sbjct: 181 MSGEEKH-------GWNIGKPQALSHRARAFKLFVETCLE 213


>gi|86356018|ref|YP_467910.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhizobium etli CFN 42]
 gi|86280120|gb|ABC89183.1| probable nucleoside-triphosphatase HAM1-like protein [Rhizobium
           etli CFN 42]
          Length = 214

 Score =  198 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 128/220 (58%), Positives = 151/220 (68%), Gaps = 7/220 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI PLG    SA ELN + P+ETG SFEENA IK++
Sbjct: 1   MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPDETGTSFEENATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  AGMPALSDDSGLV+D L G PG+++A WAE   G RDFDMAM K+E AL+   A 
Sbjct: 61  ASANAAGMPALSDDSGLVVDALGGDPGVYTANWAEKADGTRDFDMAMAKVEKALQEAGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F+SVL LAWPDGH E F G+V G +VWPPRG  GFGYDP+FQP GY  TFGE
Sbjct: 121 TPEQRGARFVSVLCLAWPDGHTELFRGEVEGHVVWPPRGTQGFGYDPVFQPEGYAVTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           M+ EEK+        +++     LSHRARAFK FV+ CL 
Sbjct: 181 MSGEEKH-------GWNVGKPQALSHRARAFKLFVETCLE 213


>gi|218661635|ref|ZP_03517565.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhizobium etli IE4771]
          Length = 214

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 129/220 (58%), Positives = 152/220 (69%), Gaps = 7/220 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI PLG    SA ELN + P+ETG SFEENA IK++
Sbjct: 1   MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVAPDETGTSFEENATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  AGMPALSDDSGLV+D L G PG+++A WAE   G RDFDMAM K+E AL+   A 
Sbjct: 61  ASAHAAGMPALSDDSGLVVDALGGDPGVYTANWAERADGTRDFDMAMAKVEKALQDAGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGH E F G+V G +VWPPRG  GFGYDP+FQP GY  TFGE
Sbjct: 121 TPEQRTARFVSVLCLAWPDGHTELFRGEVEGNVVWPPRGTQGFGYDPVFQPEGYGVTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           M+ EEK+        ++I     LSHRARAFK FV+ CL 
Sbjct: 181 MSGEEKH-------GWNIGKPQALSHRARAFKLFVETCLE 213


>gi|227820595|ref|YP_002824565.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sinorhizobium fredii NGR234]
 gi|227339594|gb|ACP23812.1| Ham1-like protein [Sinorhizobium fredii NGR234]
          Length = 214

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 124/219 (56%), Positives = 156/219 (71%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL++  +V+ASHN  KI E+  LI PLG    SA +LN + P+ETG +FEENA IK+L
Sbjct: 1   MRKLVDKTLVVASHNAGKIREIRDLIGPLGFEAKSAADLNFVEPDETGTTFEENATIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A+ +G+PALSDDSGL ID L G PG+++A WAE + G RDF MAM+K+E  L  K A 
Sbjct: 61  ASARASGLPALSDDSGLAIDALGGAPGVYTANWAERDDGSRDFAMAMEKVERELSEKGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGHVE F G+V G +VWPPRG  GFGYDP+FQP GYD TFGE
Sbjct: 121 KPEERTARFVSVLCLAWPDGHVELFRGEVEGHVVWPPRGTSGFGYDPVFQPTGYDTTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+        +   +++ LSHRARAFK F + CL
Sbjct: 181 MSAEEKH-------GWKPGNSEALSHRARAFKLFAETCL 212


>gi|150395236|ref|YP_001325703.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sinorhizobium medicae WSM419]
 gi|150026751|gb|ABR58868.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sinorhizobium medicae WSM419]
          Length = 214

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 128/219 (58%), Positives = 154/219 (70%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+L +  +V+ASHN  KI E+  LI PLG    SA +LN I PEETG +FEENA IK+L
Sbjct: 1   MRRLSDKTLVVASHNAGKIREIRDLIGPLGFEAKSAADLNFIEPEETGTTFEENAAIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +AK +G+PALSDDSGLVID L G PG+++A WAE   G RDF MAM+K+E ALR K A 
Sbjct: 61  ASAKASGLPALSDDSGLVIDALGGAPGVYTANWAEREDGSRDFQMAMEKVEEALRDKGAV 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGHVE F G+V G +VWPPRG  GFGYDP+FQP GY+ TFGE
Sbjct: 121 MPESRTARFVSVLCLAWPDGHVELFRGEVEGTVVWPPRGTSGFGYDPVFQPKGYNTTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M  EEK+        +     + LSHRARAFK F + CL
Sbjct: 181 MRAEEKH-------GWKPGDPEALSHRARAFKLFAETCL 212


>gi|222084655|ref|YP_002543184.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Agrobacterium radiobacter K84]
 gi|221722103|gb|ACM25259.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Agrobacterium radiobacter K84]
          Length = 214

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 126/220 (57%), Positives = 150/220 (68%), Gaps = 7/220 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E++ LI P G    SA +LN I P+ETG +FEENA IK+L
Sbjct: 1   MRKLETKTIVVASHNAGKIREIEDLIGPFGFTAKSAADLNFIEPDETGTTFEENATIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +A  +G+PALSDDSGLVID L G PG+++A WAE+  G RDF MAMQK+E AL    A 
Sbjct: 61  ASANASGLPALSDDSGLVIDALGGDPGVYTANWAETADGTRDFAMAMQKVETALEKVGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGH E F G+V G + WPPRG  GFGYDPIFQP GY+ TFGE
Sbjct: 121 TPESRTARFVSVLCLAWPDGHTELFRGEVEGTVAWPPRGTQGFGYDPIFQPKGYETTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           M+ EEK+        +       LSHRARAFK FV+ CL 
Sbjct: 181 MSAEEKH-------GWKPGDAQALSHRARAFKLFVETCLE 213


>gi|15964127|ref|NP_384480.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sinorhizobium meliloti 1021]
 gi|307301272|ref|ZP_07581034.1| Ham1 family protein [Sinorhizobium meliloti BL225C]
 gi|307317943|ref|ZP_07597380.1| Ham1 family protein [Sinorhizobium meliloti AK83]
 gi|22653764|sp|Q92SK4|NTPA_RHIME RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|15073303|emb|CAC41811.1| HAM1 NTPase family protein [Sinorhizobium meliloti 1021]
 gi|306896345|gb|EFN27094.1| Ham1 family protein [Sinorhizobium meliloti AK83]
 gi|306903728|gb|EFN34315.1| Ham1 family protein [Sinorhizobium meliloti BL225C]
          Length = 214

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 126/219 (57%), Positives = 157/219 (71%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+LI+  +V+ASHN  KI E+  LI PLG    SA +LN + P+ETG +FEENA IK+L
Sbjct: 1   MRRLIDKTLVVASHNAGKIREIRDLIGPLGFEAKSAADLNFVEPDETGTTFEENATIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +AK +G+PALSDDSGL +D L G PG+++A WAE   G RDF MAM+K+E ALR+K A 
Sbjct: 61  ASAKASGLPALSDDSGLAVDALGGAPGVYTANWAEREDGSRDFQMAMEKVEEALRAKGAV 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F+SVL LAWPDGHVE F G+V G +VWPPRG  GFGYDP+FQP GYD TFGE
Sbjct: 121 KPESRTARFVSVLCLAWPDGHVELFRGEVEGYVVWPPRGTSGFGYDPVFQPKGYDTTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+        +    ++ LSHRARAFK F + CL
Sbjct: 181 MSAEEKH-------GWKPGDSEALSHRARAFKLFAETCL 212


>gi|239831021|ref|ZP_04679350.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ochrobactrum intermedium LMG 3301]
 gi|239823288|gb|EEQ94856.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ochrobactrum intermedium LMG 3301]
          Length = 224

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 119/222 (53%), Positives = 153/222 (68%), Gaps = 7/222 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L
Sbjct: 5   MRKLEQGKLIVASHNAGKLKEFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKAL 64

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+++D LDG PG+++A WAE+  G RDFDMAMQK+EN L+ K A 
Sbjct: 65  AAAEATGLPALSDDSGMMVDALDGDPGVYTANWAETEDGTRDFDMAMQKVENLLQEKGAL 124

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P  R A F+SV+ LAWPDG  E F G+V G IVWPPRG  GFG+DPIF P+GY++TFGE
Sbjct: 125 EPQQRKARFVSVICLAWPDGEAEYFRGEVEGTIVWPPRGNTGFGFDPIFLPDGYEKTFGE 184

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           MT +EK+        +       LSHRARAFK F +  L ++
Sbjct: 185 MTADEKH-------GWKPGDASALSHRARAFKLFAEKALNVE 219


>gi|23501086|ref|NP_697213.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           suis 1330]
 gi|62289150|ref|YP_220943.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82699089|ref|YP_413663.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           melitensis biovar Abortus 2308]
 gi|148560455|ref|YP_001258207.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           ovis ATCC 25840]
 gi|161618163|ref|YP_001592050.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           canis ATCC 23365]
 gi|163842444|ref|YP_001626848.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           suis ATCC 23445]
 gi|189023426|ref|YP_001934194.1| deoxyribonucleotide triphosphate pyrophosphatase [Brucella abortus
           S19]
 gi|225851707|ref|YP_002731940.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           melitensis ATCC 23457]
 gi|254690477|ref|ZP_05153731.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           abortus bv. 6 str. 870]
 gi|254694966|ref|ZP_05156794.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           abortus bv. 3 str. Tulya]
 gi|254696597|ref|ZP_05158425.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|254700980|ref|ZP_05162808.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           suis bv. 5 str. 513]
 gi|254705351|ref|ZP_05167179.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           suis bv. 3 str. 686]
 gi|254707136|ref|ZP_05168964.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           pinnipedialis M163/99/10]
 gi|254709321|ref|ZP_05171132.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           pinnipedialis B2/94]
 gi|254713258|ref|ZP_05175069.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           ceti M644/93/1]
 gi|254716389|ref|ZP_05178200.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           ceti M13/05/1]
 gi|254731510|ref|ZP_05190088.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           abortus bv. 4 str. 292]
 gi|256030844|ref|ZP_05444458.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           pinnipedialis M292/94/1]
 gi|256045965|ref|ZP_05448837.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256060314|ref|ZP_05450487.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           neotomae 5K33]
 gi|256158873|ref|ZP_05456727.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           ceti M490/95/1]
 gi|256254250|ref|ZP_05459786.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           ceti B1/94]
 gi|256258733|ref|ZP_05464269.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           abortus bv. 9 str. C68]
 gi|256264781|ref|ZP_05467313.1| nucleoside-triphosphatase [Brucella melitensis bv. 2 str. 63/9]
 gi|256368639|ref|YP_003106145.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           microti CCM 4915]
 gi|260169748|ref|ZP_05756559.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           sp. F5/99]
 gi|260885051|ref|ZP_05896665.1| nucleoside-triphosphatase [Brucella abortus bv. 9 str. C68]
 gi|261221401|ref|ZP_05935682.1| nucleoside-triphosphatase [Brucella ceti B1/94]
 gi|261324289|ref|ZP_05963486.1| nucleoside-triphosphatase [Brucella neotomae 5K33]
 gi|265987902|ref|ZP_06100459.1| nucleoside-triphosphatase [Brucella pinnipedialis M292/94/1]
 gi|265992377|ref|ZP_06104934.1| nucleoside-triphosphatase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265997363|ref|ZP_06109920.1| nucleoside-triphosphatase [Brucella ceti M490/95/1]
 gi|306844442|ref|ZP_07477032.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella sp. BO1]
 gi|54037240|sp|P64306|NTPA_BRUSU RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|54041338|sp|P64305|NTPA_BRUME RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|23346955|gb|AAN29128.1| ham1 protein [Brucella suis 1330]
 gi|62195282|gb|AAX73582.1| ham1 protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615190|emb|CAJ10131.1| Ham1-like protein [Brucella melitensis biovar Abortus 2308]
 gi|148371712|gb|ABQ61691.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Brucella ovis ATCC 25840]
 gi|161334974|gb|ABX61279.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella canis ATCC 23365]
 gi|163673167|gb|ABY37278.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella suis ATCC 23445]
 gi|189018998|gb|ACD71720.1| Ham1-like protein [Brucella abortus S19]
 gi|225640072|gb|ACN99985.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Brucella melitensis ATCC 23457]
 gi|255998797|gb|ACU47196.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           microti CCM 4915]
 gi|260874579|gb|EEX81648.1| nucleoside-triphosphatase [Brucella abortus bv. 9 str. C68]
 gi|260919985|gb|EEX86638.1| nucleoside-triphosphatase [Brucella ceti B1/94]
 gi|261300269|gb|EEY03766.1| nucleoside-triphosphatase [Brucella neotomae 5K33]
 gi|262551831|gb|EEZ07821.1| nucleoside-triphosphatase [Brucella ceti M490/95/1]
 gi|263003443|gb|EEZ15736.1| nucleoside-triphosphatase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263095190|gb|EEZ18859.1| nucleoside-triphosphatase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660099|gb|EEZ30360.1| nucleoside-triphosphatase [Brucella pinnipedialis M292/94/1]
 gi|306275255|gb|EFM57005.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella sp. BO1]
 gi|326537913|gb|ADZ86128.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Brucella melitensis M5-90]
          Length = 220

 Score =  194 bits (493), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 120/221 (54%), Positives = 151/221 (68%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR L +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L
Sbjct: 1   MRMLEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G PALSDDSGL++D LDG+PG+++A WAE+  G+RDFDMAMQK+EN L+ K A 
Sbjct: 61  AAAKATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFDMAMQKVENLLQEKGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F+SV+ LAWPDG  E F G+V G +VWPPRG +GFGYDP+F P+GY +TFGE
Sbjct: 121 TPDKRKARFVSVICLAWPDGEAEYFRGEVEGTLVWPPRGNIGFGYDPVFLPDGYGKTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           MT EEK+        +       LSHRARAFK F +  L +
Sbjct: 181 MTAEEKH-------GWKPGDASALSHRARAFKLFAEKALNV 214


>gi|325291760|ref|YP_004277624.1| deoxyribonucleotide triphosphate pyrophosphatase [Agrobacterium sp.
           H13-3]
 gi|325059613|gb|ADY63304.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Agrobacterium sp. H13-3]
          Length = 214

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 129/220 (58%), Positives = 153/220 (69%), Gaps = 7/220 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI P G    SA ELN + P+ETG +FEENA IK+L
Sbjct: 1   MRKLDTRTIVVASHNKGKIAEIADLIGPFGFSAKSAAELNFVEPDETGTTFEENAAIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +AK +G+PALSDDSGLVID LDG PG+++A WAE+  G RDF MAMQK+E+AL  + A 
Sbjct: 61  ASAKASGLPALSDDSGLVIDALDGAPGVYTANWAETADGTRDFAMAMQKVEDALAERGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+  F+SVL LAWPDGHVE F G+V G + WPPRG  GFGYDPIF+P GYD TFGE
Sbjct: 121 KPEDRTGRFVSVLCLAWPDGHVEYFRGEVEGTVAWPPRGTSGFGYDPIFKPEGYDTTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           MT +EK+G               LSHRARAFK FV+ CL 
Sbjct: 181 MTADEKHGWKHGDA-------FALSHRARAFKKFVETCLE 213


>gi|254718389|ref|ZP_05180200.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           sp. 83/13]
 gi|306839622|ref|ZP_07472426.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella sp. NF 2653]
 gi|306405320|gb|EFM61595.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella sp. NF 2653]
          Length = 220

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 120/221 (54%), Positives = 151/221 (68%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR L +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L
Sbjct: 1   MRMLEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G PALSDDSGL++D LDG+PG+++A WAE+  G+RDFDMAMQK+EN L+ K A 
Sbjct: 61  AAAKATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFDMAMQKVENLLQEKGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F+SV+ LAWPDG  E F G+V G +VWPPRG +GFGYDP+F P+GY +TFGE
Sbjct: 121 TPDKRKACFVSVICLAWPDGEAEYFRGEVEGALVWPPRGNIGFGYDPVFLPDGYGKTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           MT EEK+        +       LSHRARAFK F +  L +
Sbjct: 181 MTAEEKH-------GWKPGDASALSHRARAFKLFAEKALNV 214


>gi|17988055|ref|NP_540689.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           melitensis bv. 1 str. 16M]
 gi|225626713|ref|ZP_03784752.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Brucella ceti str. Cudo]
 gi|237814643|ref|ZP_04593641.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella abortus str. 2308 A]
 gi|297247566|ref|ZP_06931284.1| Ham1 family protein [Brucella abortus bv. 5 str. B3196]
 gi|17983803|gb|AAL52953.1| nucleoside-triphosphatase [Brucella melitensis bv. 1 str. 16M]
 gi|225618370|gb|EEH15413.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Brucella ceti str. Cudo]
 gi|237789480|gb|EEP63690.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella abortus str. 2308 A]
 gi|297174735|gb|EFH34082.1| Ham1 family protein [Brucella abortus bv. 5 str. B3196]
          Length = 224

 Score =  194 bits (492), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 120/221 (54%), Positives = 151/221 (68%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR L +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L
Sbjct: 5   MRMLEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKAL 64

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G PALSDDSGL++D LDG+PG+++A WAE+  G+RDFDMAMQK+EN L+ K A 
Sbjct: 65  AAAKATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFDMAMQKVENLLQEKGAT 124

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F+SV+ LAWPDG  E F G+V G +VWPPRG +GFGYDP+F P+GY +TFGE
Sbjct: 125 TPDKRKARFVSVICLAWPDGEAEYFRGEVEGTLVWPPRGNIGFGYDPVFLPDGYGKTFGE 184

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           MT EEK+        +       LSHRARAFK F +  L +
Sbjct: 185 MTAEEKH-------GWKPGDASALSHRARAFKLFAEKALNV 218


>gi|256112678|ref|ZP_05453599.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Brucella
           melitensis bv. 3 str. Ether]
 gi|265994120|ref|ZP_06106677.1| nucleoside-triphosphatase [Brucella melitensis bv. 3 str. Ether]
 gi|262765101|gb|EEZ11022.1| nucleoside-triphosphatase [Brucella melitensis bv. 3 str. Ether]
          Length = 220

 Score =  194 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 119/221 (53%), Positives = 151/221 (68%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR L +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L
Sbjct: 1   MRMLEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G PALSDDSGL++D LDG+PG+++A WAE+  G+RDFDMAMQK+EN L+ K A 
Sbjct: 61  AAAKATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFDMAMQKVENLLQEKGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F+SV+ LAWPDG  E F G++ G +VWPPRG +GFGYDP+F P+GY +TFGE
Sbjct: 121 TPDKRKARFVSVICLAWPDGEAEYFRGEMEGTLVWPPRGNIGFGYDPVFLPDGYGKTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           MT EEK+        +       LSHRARAFK F +  L +
Sbjct: 181 MTAEEKH-------GWKPGDASALSHRARAFKLFAEKALNV 214


>gi|307943384|ref|ZP_07658728.1| Ham1 family protein [Roseibium sp. TrichSKD4]
 gi|307773014|gb|EFO32231.1| Ham1 family protein [Roseibium sp. TrichSKD4]
          Length = 212

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 112/219 (51%), Positives = 146/219 (66%), Gaps = 11/219 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +V+ASHN  KI E++ L+ P G    SA +L+L  PEETG +FE NA +K+  
Sbjct: 4   RKLEPGRLVVASHNKGKIREINELLAPFGFDVVSAGDLDLPEPEETGTTFEANAELKARA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+ A +PAL+DDSG  +  LDG PGI+SARWA     ++DF MAM+ +E  L+ K A  
Sbjct: 64  AAEVANLPALADDSGFCVAALDGAPGIYSARWAGP---DKDFSMAMRNVEEKLQEKGATS 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R + F++VL+L WPDGH+E F G+V G IVWPPRG  GFGYDP+F+P+G++RTFGEM
Sbjct: 121 PEQRRSSFVAVLALVWPDGHMEQFRGEVEGEIVWPPRGDKGFGYDPVFRPDGHERTFGEM 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           T EEK+G   +           LSHRARAF+ F   CL 
Sbjct: 181 TSEEKHGWSRTEP--------ALSHRARAFQMFAKACLE 211


>gi|153007529|ref|YP_001368744.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Ochrobactrum anthropi ATCC 49188]
 gi|151559417|gb|ABS12915.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ochrobactrum anthropi ATCC 49188]
          Length = 220

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 119/222 (53%), Positives = 152/222 (68%), Gaps = 7/222 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L
Sbjct: 1   MRKLEQGKLIVASHNAGKLKEFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+++D LDG PG+++A WAE+  G RDFDMAMQK+EN L+ K A 
Sbjct: 61  AAAEATGLPALSDDSGMMVDALDGDPGVYTANWAETEDGTRDFDMAMQKVENLLQEKAAV 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F+SV+ LAWPDG  E F G+V G IVWPPRG  GFG+DPIF P+GY++TFGE
Sbjct: 121 APQQRKARFVSVICLAWPDGEAEYFRGEVEGAIVWPPRGTTGFGFDPIFLPDGYEKTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           MT +EK+        +       LSHRARAFK F +  L ++
Sbjct: 181 MTADEKH-------GWKPGDASALSHRARAFKLFAEKALNVE 215


>gi|254504255|ref|ZP_05116406.1| Ham1 family [Labrenzia alexandrii DFL-11]
 gi|222440326|gb|EEE47005.1| Ham1 family [Labrenzia alexandrii DFL-11]
          Length = 212

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 110/219 (50%), Positives = 143/219 (65%), Gaps = 11/219 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +V+ASHN  K+ E++ L+   G    SA +L L  PEETG +FE NA IK++ 
Sbjct: 4   RKLEPGKLVVASHNKGKLREINELLQSYGFEVVSAGDLGLPEPEETGTTFEANAEIKAVA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           +A  A +PAL+DDSG  +  L+G PGI+SARWA     ++DF MAM+ +E  L+S  A  
Sbjct: 64  SATAANLPALADDSGFCVAELNGDPGIYSARWAGP---DKDFAMAMRTVEEKLQSAGAMT 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R   F++VL LAWPDGH E F G+V G IVWPPRG  GFGYDP+FQP+G++RTFGEM
Sbjct: 121 PERRRGSFVAVLCLAWPDGHKEFFRGEVDGQIVWPPRGTQGFGYDPVFQPDGHERTFGEM 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           T +EK+G            T  LSHR+RAF+ F   CL+
Sbjct: 181 TSDEKHGWGP--------DTPALSHRSRAFELFAKACLK 211


>gi|49473732|ref|YP_031774.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bartonella quintana str. Toulouse]
 gi|62900216|sp|Q6G1E6|NTPA_BARQU RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|49239235|emb|CAF25555.1| hypothetical protein BQ00480 [Bartonella quintana str. Toulouse]
          Length = 215

 Score =  191 bits (486), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 109/222 (49%), Positives = 147/222 (66%), Gaps = 7/222 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +    +VIA+HN  K+HE+ +L+ P G+   SA EL+L  P+ETG +FEENA IK+ 
Sbjct: 1   MRSIASKKLVIATHNTGKLHEITTLVAPFGLEIQSAKELDLPEPKETGVTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAKN G+PALSDDSGL +D L G PG+++A WA  + G R+F  AMQKIE+ L+   AH
Sbjct: 61  AAAKNTGLPALSDDSGLEVDALGGAPGVYTADWALQSDGTRNFSKAMQKIEDELQKIGAH 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           + + R A FISV+ +AW D + + F G V G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 EKSQRKARFISVICIAWSDAYADYFRGSVEGTFIWPPRGDKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           M+ E+K+        + +     LSHRARAFK   +N L + 
Sbjct: 181 MSTEQKH-------GWKLNDKTPLSHRARAFKLLAENLLTLS 215


>gi|222147320|ref|YP_002548277.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Agrobacterium vitis S4]
 gi|221734310|gb|ACM35273.1| non-canonical purine NTP pyrophosphatase rdgB/HAM1 family
           [Agrobacterium vitis S4]
          Length = 214

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 125/219 (57%), Positives = 151/219 (68%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL    IV+ASHN  KI E+  LI P G    SA EL  I P+ETG +FEENA IK+L
Sbjct: 1   MRKLETRTIVVASHNAGKIAEIADLIGPFGFTAKSAKELGFIEPDETGTTFEENAAIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            +AK +G+PALSDDSGLV+D LDG PG+++A WAE   G RDF MAM+K+E+AL+ K A 
Sbjct: 61  ASAKASGLPALSDDSGLVVDALDGAPGVYTANWAEREDGSRDFAMAMEKVEHALQEKGAV 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R+A F+SVL L WPDGH E F G+V G++ WPPRG  GFGYDPIFQP G+  TFGE
Sbjct: 121 TQESRTARFVSVLCLGWPDGHTEFFRGEVEGVVAWPPRGTSGFGYDPIFQPEGFSTTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT EEK+        +   +   LSHRARAFK FV+ CL
Sbjct: 181 MTSEEKH-------GWKPGNAQALSHRARAFKLFVETCL 212


>gi|110636338|ref|YP_676546.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Mesorhizobium sp. BNC1]
 gi|110287322|gb|ABG65381.1| Ham1-like protein [Chelativorans sp. BNC1]
          Length = 215

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 110/219 (50%), Positives = 137/219 (62%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +     V+ASHN  K+ E   L+ P G    SA EL L  PEETG  FE+NA IK+ 
Sbjct: 1   MRPIDNKKFVLASHNKGKLDEFAGLLAPFGYEIRSAAELGLPEPEETGTEFEQNAYIKAS 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSG+ +D L G PG+++A WA    G RDF +AM+K+E  LR K A 
Sbjct: 61  AAAKATGLPALSDDSGMCVDALGGAPGVYTADWATLPDGRRDFGIAMEKVEKLLREKGAT 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F++VL L +PDG  E + G+V G +VWPPRG LGFGYDP+FQP+G+ RTFGE
Sbjct: 121 SPEQRRARFVAVLCLCFPDGEAEFYRGEVEGHLVWPPRGGLGFGYDPVFQPDGHQRTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+        +       LSHRARAF+ F    L
Sbjct: 181 MTAAEKH-------GWKPGDAQALSHRARAFQKFARARL 212


>gi|328541648|ref|YP_004301757.1| Nucleoside-triphosphatase [polymorphum gilvum SL003B-26A1]
 gi|326411400|gb|ADZ68463.1| Nucleoside-triphosphatase [Polymorphum gilvum SL003B-26A1]
          Length = 213

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 111/219 (50%), Positives = 142/219 (64%), Gaps = 11/219 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +V+ASHN  KI E+  L+ P G    SA EL+L  PEETG +FE NA +K+L 
Sbjct: 4   RKLEPGRLVVASHNPGKIREIRELLSPYGFDVVSAGELDLPEPEETGTTFEANAELKALA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+ +G+P+L+DDSG  +  LDG PG++SARWA     ++DF MAM+ IE  L+      
Sbjct: 64  AARGSGLPSLADDSGFCVAALDGAPGVYSARWAGP---DKDFAMAMRAIEEKLQQAGGTT 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R   F++VL LAWPDGH E F G+V G +VWPPRG+ GFGYDP+FQP+G+ RTFGEM
Sbjct: 121 PDRRRGSFVAVLCLAWPDGHREFFRGEVEGQVVWPPRGEQGFGYDPMFQPDGHARTFGEM 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +  EK+G   +        T  LSHRARAF  F   CL 
Sbjct: 181 SSTEKHGWSRT--------TPALSHRARAFVAFSKACLE 211


>gi|260546449|ref|ZP_05822189.1| nucleoside-triphosphatase [Brucella abortus NCTC 8038]
 gi|260563248|ref|ZP_05833734.1| nucleoside-triphosphatase [Brucella melitensis bv. 1 str. 16M]
 gi|260567188|ref|ZP_05837658.1| nucleoside-triphosphatase [Brucella suis bv. 4 str. 40]
 gi|260756031|ref|ZP_05868379.1| nucleoside-triphosphatase [Brucella abortus bv. 6 str. 870]
 gi|260759255|ref|ZP_05871603.1| nucleoside-triphosphatase [Brucella abortus bv. 4 str. 292]
 gi|260760978|ref|ZP_05873321.1| nucleoside-triphosphatase [Brucella abortus bv. 2 str. 86/8/59]
 gi|261215308|ref|ZP_05929589.1| nucleoside-triphosphatase [Brucella abortus bv. 3 str. Tulya]
 gi|261218175|ref|ZP_05932456.1| nucleoside-triphosphatase [Brucella ceti M13/05/1]
 gi|261314612|ref|ZP_05953809.1| nucleoside-triphosphatase [Brucella pinnipedialis M163/99/10]
 gi|261316832|ref|ZP_05956029.1| nucleoside-triphosphatase [Brucella pinnipedialis B2/94]
 gi|261320977|ref|ZP_05960174.1| nucleoside-triphosphatase [Brucella ceti M644/93/1]
 gi|261751501|ref|ZP_05995210.1| nucleoside-triphosphatase [Brucella suis bv. 5 str. 513]
 gi|261756065|ref|ZP_05999774.1| nucleoside-triphosphatase [Brucella suis bv. 3 str. 686]
 gi|261759289|ref|ZP_06002998.1| nucleoside-triphosphatase [Brucella sp. F5/99]
 gi|294851574|ref|ZP_06792247.1| Ham1 family protein [Brucella sp. NVSL 07-0026]
 gi|306842541|ref|ZP_07475192.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella sp. BO2]
 gi|260096556|gb|EEW80432.1| nucleoside-triphosphatase [Brucella abortus NCTC 8038]
 gi|260153264|gb|EEW88356.1| nucleoside-triphosphatase [Brucella melitensis bv. 1 str. 16M]
 gi|260156706|gb|EEW91786.1| nucleoside-triphosphatase [Brucella suis bv. 4 str. 40]
 gi|260669573|gb|EEX56513.1| nucleoside-triphosphatase [Brucella abortus bv. 4 str. 292]
 gi|260671410|gb|EEX58231.1| nucleoside-triphosphatase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676139|gb|EEX62960.1| nucleoside-triphosphatase [Brucella abortus bv. 6 str. 870]
 gi|260916915|gb|EEX83776.1| nucleoside-triphosphatase [Brucella abortus bv. 3 str. Tulya]
 gi|260923264|gb|EEX89832.1| nucleoside-triphosphatase [Brucella ceti M13/05/1]
 gi|261293667|gb|EEX97163.1| nucleoside-triphosphatase [Brucella ceti M644/93/1]
 gi|261296055|gb|EEX99551.1| nucleoside-triphosphatase [Brucella pinnipedialis B2/94]
 gi|261303638|gb|EEY07135.1| nucleoside-triphosphatase [Brucella pinnipedialis M163/99/10]
 gi|261739273|gb|EEY27269.1| nucleoside-triphosphatase [Brucella sp. F5/99]
 gi|261741254|gb|EEY29180.1| nucleoside-triphosphatase [Brucella suis bv. 5 str. 513]
 gi|261745818|gb|EEY33744.1| nucleoside-triphosphatase [Brucella suis bv. 3 str. 686]
 gi|294820163|gb|EFG37162.1| Ham1 family protein [Brucella sp. NVSL 07-0026]
 gi|306287397|gb|EFM58877.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brucella sp. BO2]
 gi|326408198|gb|ADZ65263.1| Ham1-like protein [Brucella melitensis M28]
          Length = 218

 Score =  189 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 118/218 (54%), Positives = 149/218 (68%), Gaps = 7/218 (3%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           L +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L AA
Sbjct: 2   LEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKALAAA 61

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G PALSDDSGL++D LDG+PG+++A WAE+  G+RDFDMAMQK+EN L+ K A  P 
Sbjct: 62  KATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFDMAMQKVENLLQEKGATTPD 121

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+SV+ LAWPDG  E F G+V G +VWPPRG +GFGYDP+F P+GY +TFGEMT 
Sbjct: 122 KRKARFVSVICLAWPDGEAEYFRGEVEGTLVWPPRGNIGFGYDPVFLPDGYGKTFGEMTA 181

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EEK+        +       LSHRARAFK F +  L +
Sbjct: 182 EEKH-------GWKPGDASALSHRARAFKLFAEKALNV 212


>gi|265983353|ref|ZP_06096088.1| nucleoside-triphosphatase [Brucella sp. 83/13]
 gi|264661945|gb|EEZ32206.1| nucleoside-triphosphatase [Brucella sp. 83/13]
          Length = 218

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 118/218 (54%), Positives = 149/218 (68%), Gaps = 7/218 (3%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           L +  +++ASHN  K+ E D LI P G   +S   L L  P+ETG +FEENA IK+L AA
Sbjct: 2   LEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAYIKALAAA 61

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G PALSDDSGL++D LDG+PG+++A WAE+  G+RDFDMAMQK+EN L+ K A  P 
Sbjct: 62  KATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFDMAMQKVENLLQEKGATTPD 121

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+SV+ LAWPDG  E F G+V G +VWPPRG +GFGYDP+F P+GY +TFGEMT 
Sbjct: 122 KRKACFVSVICLAWPDGEAEYFRGEVEGALVWPPRGNIGFGYDPVFLPDGYGKTFGEMTA 181

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EEK+        +       LSHRARAFK F +  L +
Sbjct: 182 EEKH-------GWKPGDASALSHRARAFKLFAEKALNV 212


>gi|158425914|ref|YP_001527206.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Azorhizobium caulinodans ORS 571]
 gi|158332803|dbj|BAF90288.1| HAM1 protein [Azorhizobium caulinodans ORS 571]
          Length = 210

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 111/220 (50%), Positives = 139/220 (63%), Gaps = 11/220 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + +   IVIA+HN  K+ EM  L+ P GI   SA ELNL  P+ETG +F  NA IK+ 
Sbjct: 1   MSRKLTGRIVIATHNPGKLKEMQELLAPYGIEAVSAGELNLPEPDETGTTFRANARIKAE 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK AG+PA +DDSG+ +D LDG PGI+SARW      ++DF MAM K+   + ++ A 
Sbjct: 61  AAAKAAGLPAFADDSGIAVDALDGAPGIYSARWGGP---QKDFRMAMGKVHEEMLARGAA 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +PA R+A F+S L +AWPDGH+E F G V G +VWPPRG  GFGYDP F P G+ RTFGE
Sbjct: 118 EPAQRTARFVSALCIAWPDGHLEEFEGIVEGEVVWPPRGNSGFGYDPFFLPEGHTRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           MT EEK+                LSHRARAF+     CL 
Sbjct: 178 MTSEEKHSMPPLGLG--------LSHRARAFRQLALACLE 209


>gi|118593718|ref|ZP_01551093.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Stappia
           aggregata IAM 12614]
 gi|118433728|gb|EAV40390.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Stappia
           aggregata IAM 12614]
          Length = 212

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 115/219 (52%), Positives = 144/219 (65%), Gaps = 11/219 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +V+ASHN  KI E++ L+ P G    SA EL+L  P+ETG +FEENA IK+  
Sbjct: 4   RKLEPGKLVVASHNKGKIREINELLQPYGFEVISAGELDLPEPDETGVTFEENAAIKAHA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK +G+PAL+DDSG  +  L+G PGI+SARWA     ++DF MAM+ +E  L+S  A  
Sbjct: 64  AAKASGLPALADDSGFCVAALNGDPGIYSARWAGP---DKDFAMAMRTVEEKLQSLGATT 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R   F++VL LAWPDG  E F G+V G IVWPPRG  GFGYDPIFQP+G++RTFGEM
Sbjct: 121 DDQRRGSFVAVLCLAWPDGSEEYFRGEVDGQIVWPPRGTQGFGYDPIFQPDGHERTFGEM 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           T EEK+G     +         LSHRARAF+ F   CL 
Sbjct: 181 TSEEKHGWSKDGS--------ALSHRARAFQLFSAGCLE 211


>gi|319407923|emb|CBI81577.1| HAM1-like protein [Bartonella schoenbuchensis R1]
          Length = 214

 Score =  188 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 108/219 (49%), Positives = 146/219 (66%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M+++    +VIA+HN  K+HE+ +LI P G+ T SA EL L  P+ETG +FE+NA IK+ 
Sbjct: 1   MKRITNEKLVIATHNAGKLHEITALIAPFGLTTLSAKELGLPEPKETGTTFEKNAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK   +PALSDDSGL ID L G PG+++A WA    G R+F  AMQKIE+ L+   A 
Sbjct: 61  AAAKTTQLPALSDDSGLEIDALGGAPGVYTADWAIQPDGTRNFSKAMQKIEDELQKIGAL 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +   R   FISV+ +AWPDG+ + F G + G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 EKGQRKCRFISVICVAWPDGYADYFRGSIEGTFIWPPRGDKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ E+K+        +++     LSHR+RAFK FV+N L
Sbjct: 181 MSTEQKH-------GWTLNDKTPLSHRSRAFKLFVENFL 212


>gi|316931692|ref|YP_004106674.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rhodopseudomonas palustris DX-1]
 gi|315599406|gb|ADU41941.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rhodopseudomonas palustris DX-1]
          Length = 210

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 112/219 (51%), Positives = 138/219 (63%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG+SF+ NA IK+ 
Sbjct: 1   MHRRITGKLVIATHNPGKLAEMRELLAPYGIEAISAGELGLAEPDETGDSFQANARIKAE 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK A +PA +DDSGL +D LDG PGI+SARWA      +DF  AM +IE  L+ + A 
Sbjct: 61  AAAKAAQLPAFADDSGLAVDALDGAPGIYSARWA---GDSKDFGGAMARIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+AHF+S L +AWPDGHVE       G +VWPPRG  GFGYDPIF P+G+DRTFGE
Sbjct: 118 APERRTAHFVSALCVAWPDGHVEEVEAHAGGTLVWPPRGTAGFGYDPIFLPDGHDRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+G               LSHRA+AF    + CL
Sbjct: 178 MTSVEKHGLPPLGLG--------LSHRAKAFVKLAEICL 208


>gi|91974876|ref|YP_567535.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodopseudomonas palustris BisB5]
 gi|91681332|gb|ABE37634.1| Ham1-like protein [Rhodopseudomonas palustris BisB5]
          Length = 210

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 111/219 (50%), Positives = 138/219 (63%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG+SF  NA IK+ 
Sbjct: 1   MHRRISGKLVIATHNPGKLAEMRELLAPYGIEAVSAGELGLGEPDETGDSFRANARIKAE 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+ A +PA +DDSGL +D LDG PGI SARWA      +DF+ AM +IE  LR + A 
Sbjct: 61  AAAQAAKLPAFADDSGLSVDALDGAPGIFSARWAGEG---KDFNAAMAQIERLLRERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            PA R AHF+S L +AWPDGH+E    +  G +VWPPRG  GFGYDP+F P+G+DRTFGE
Sbjct: 118 APAQRGAHFVSALCVAWPDGHIEEVEARADGTLVWPPRGDAGFGYDPMFLPDGHDRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+  EK+G               LSHRARAF    + CL
Sbjct: 178 MSSIEKHGLPPLGLG--------LSHRARAFVKLAEICL 208


>gi|163867356|ref|YP_001608550.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bartonella tribocorum CIP 105476]
 gi|161016997|emb|CAK00555.1| HAM1-like protein [Bartonella tribocorum CIP 105476]
          Length = 215

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 111/219 (50%), Positives = 145/219 (66%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR + +  +VIA+HN  K+HE+ +L+ P G++  SA EL L  P+ETG +FEENA IK+ 
Sbjct: 1   MRSIADKKLVIATHNTGKLHEITTLVAPFGLIIQSAKELGLPEPKETGTTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSGL +D L G PG+++A WA    G R+F  AMQKIE+ L+   A 
Sbjct: 61  AAAKKTGLPALSDDSGLEVDALGGAPGVYTADWAIQADGTRNFPKAMQKIEDELQKIEAR 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           + + R   FISV+ +AWPD H + F G V G  VWPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 EKSQRKCRFISVICIAWPDNHADYFRGCVEGTFVWPPRGDKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ E+K+G   +  L        LSHRARAFK   +N L
Sbjct: 181 MSTEQKHGWQHNDILP-------LSHRARAFKLLAENLL 212


>gi|121602526|ref|YP_989583.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bartonella bacilliformis KC583]
 gi|120614703|gb|ABM45304.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bartonella bacilliformis KC583]
          Length = 215

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 107/222 (48%), Positives = 144/222 (64%), Gaps = 7/222 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +I   +VIA+HN  K++E+ +L+ P  +   SA ELNL  P+ETG +FEENA IK+ 
Sbjct: 1   MRSIIGKKLVIATHNTGKLYEITTLVAPFDLTIQSAAELNLPEPKETGTTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSG+ ID L   PG+++A WA    G RDF  AMQK+EN L+   A 
Sbjct: 61  AAAKATGLPALSDDSGMEIDALGNAPGVYTANWAMQPDGTRDFSKAMQKVENELQKIGAV 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +   R   F+SV+ +AWPDG+ + F G + G  +WPPRG  GFG+DPIF P+GYD +FGE
Sbjct: 121 EKNQRKGRFVSVICVAWPDGYADYFRGSIDGTFIWPPRGNKGFGFDPIFLPDGYDNSFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           M+ E+K+        + +     LSHRARAFK F ++ L I 
Sbjct: 181 MSTEQKH-------GWQLNDEIPLSHRARAFKLFAESLLVIS 215


>gi|319403536|emb|CBI77117.1| HAM1-like protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 215

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 110/222 (49%), Positives = 139/222 (62%), Gaps = 7/222 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +    ++IA+HN  K+HE+ +LI P GI T S  EL L  P+ETG +FEENA IK+ 
Sbjct: 1   MRNITIKKLIIATHNTGKLHEITTLIAPFGITTQSVKELGLPEPKETGTTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK    PALSDDSG+ ID L+G PG+++A WA    G RDF  AMQK+EN L+     
Sbjct: 61  AAAKATNFPALSDDSGMEIDALNGAPGVYTADWALQPDGTRDFVKAMQKVENELQKVDPL 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R   FISV+ LA+PDGH + F G V G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 KKNQRKGRFISVICLAYPDGHADYFRGSVEGTFIWPPRGNKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           M+ E+K+                LSHRARAFK F +N L + 
Sbjct: 181 MSTEQKHSWKLHGQTP-------LSHRARAFKLFAENLLVLS 215


>gi|27375784|ref|NP_767313.1| deoxyribonucleotide triphosphate pyrophosphatase [Bradyrhizobium
           japonicum USDA 110]
 gi|62900283|sp|Q89WK5|NTPA_BRAJA RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|27348922|dbj|BAC45938.1| bll0673 [Bradyrhizobium japonicum USDA 110]
          Length = 211

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 107/220 (48%), Positives = 137/220 (62%), Gaps = 11/220 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETGN F  NA IK++
Sbjct: 1   MHRRITGKLVIATHNPGKLAEMKELLAPYGIEAVSAGELGLSEPDETGNDFRSNAAIKAI 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA  + +P+ +DDSG+V+D LDG PGI+SARWA      +DF  AM +IE  L+ + A 
Sbjct: 61  AAAHASKLPSFADDSGIVVDALDGAPGIYSARWAGPT---KDFTAAMTRIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R AHF+S L +AWPD H+E    +V G +VWPPRG  GFGYDP+F+P+G+ RTFGE
Sbjct: 118 APDKRKAHFVSALCVAWPDDHLEEVEARVDGTLVWPPRGTAGFGYDPMFRPDGHTRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           MT  EK+G               LSHRARAF    + CL 
Sbjct: 178 MTSIEKHGLPPLGL--------ALSHRARAFVKLAEICLE 209


>gi|209883566|ref|YP_002287423.1| non-canonical purine NTP pyrophosphatase [Oligotropha
           carboxidovorans OM5]
 gi|209871762|gb|ACI91558.1| non-canonical purine NTP pyrophosphatase [Oligotropha
           carboxidovorans OM5]
          Length = 212

 Score =  185 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 110/218 (50%), Positives = 138/218 (63%), Gaps = 11/218 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            + I   +VIA+HN  K+ EM  L+ P GI   SA ELNL  PEETG +F  NA IK+  
Sbjct: 4   HRHITGRLVIATHNPGKLAEMRELLAPYGIEAVSAAELNLDEPEETGTTFAANARIKATA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA   G+PA +DDSGL +D L+G+PGI+SARWA  +   +DF  AM +IE  L+ + A +
Sbjct: 64  AANATGLPAFADDSGLCVDALEGQPGIYSARWAGPS---KDFMAAMTQIERLLQERDATE 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           PA R AHF+S L +AWPDGHVE    +V G +VWPPRG  GFGYDP F P+G+ RTFGEM
Sbjct: 121 PAQRKAHFVSALCVAWPDGHVEEVEERVDGQMVWPPRGTAGFGYDPAFLPDGHGRTFGEM 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           T  EK+G               LSHRA+AF    + CL
Sbjct: 181 TSIEKHGLPPHGMG--------LSHRAKAFVKLAEICL 210


>gi|39933405|ref|NP_945681.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodopseudomonas palustris CGA009]
 gi|62900229|sp|Q6NCY9|NTPA_RHOPA RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|39647251|emb|CAE25772.1| Ham1-like protein [Rhodopseudomonas palustris CGA009]
          Length = 210

 Score =  184 bits (467), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 109/219 (49%), Positives = 137/219 (62%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG+SF+ NA IK+ 
Sbjct: 1   MHRRITGKLVIATHNPGKLAEMRELLAPYGIEAISAGELGLAEPDETGDSFQANARIKAE 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK A +PA +DDSGL +D LDG PGI+SARWA      +DF  AM +IE  L+ + A 
Sbjct: 61  AAAKAAQLPAFADDSGLAVDALDGAPGIYSARWA---GDAKDFAGAMARIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+AHF+S L +AWPDGH+E    +  G +VWPPRG  GFGYDP+F P G+ RTFGE
Sbjct: 118 APERRTAHFVSALCVAWPDGHIEEVEARADGTLVWPPRGTAGFGYDPVFLPEGHSRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+G               LSHRA+AF    + CL
Sbjct: 178 MTSIEKHGLPPLGLG--------LSHRAKAFVKLAEICL 208


>gi|319898243|ref|YP_004158336.1| HAM1-like protein [Bartonella clarridgeiae 73]
 gi|319402207|emb|CBI75738.1| HAM1-like protein [Bartonella clarridgeiae 73]
          Length = 215

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 108/222 (48%), Positives = 143/222 (64%), Gaps = 7/222 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +    +VIA+HN  K+HE+  LI P G+ T S  EL L  P+ETG +FEENA IK+ 
Sbjct: 1   MRSIAIKKLVIATHNTGKLHEITRLIAPFGVTTQSVKELGLPEPKETGTTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK   +PALSDDSG+ ID L+G PG+++A WA  + G RDF  AMQK+EN L+   + 
Sbjct: 61  AAAKATNLPALSDDSGIEIDALNGAPGVYTADWALQSDGTRDFLKAMQKVENELQKVASL 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R + FISV+ +A+PDG+ + F G V G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 KKNQRKSRFISVICIAYPDGYADYFRGSVEGTCIWPPRGNKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           M+ E+K+    +           LSHRARAFK F +N L + 
Sbjct: 181 MSTEQKHSWKFNGQTP-------LSHRARAFKLFAENLLALS 215


>gi|13473882|ref|NP_105450.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Mesorhizobium loti MAFF303099]
 gi|22653768|sp|Q98DN4|NTPA_RHILO RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|14024633|dbj|BAB51236.1| mlr4626 [Mesorhizobium loti MAFF303099]
          Length = 220

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 110/221 (49%), Positives = 141/221 (63%), Gaps = 7/221 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M  L    IV+ASHN  K+ E   L+ P G    SA +  L  P+ETG +FEENA IK+L
Sbjct: 1   MHTLDGKKIVVASHNAGKLREFADLMGPFGFEAKSAKDYGLPEPDETGTTFEENAYIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSGL +D LDG PG+++A WAE+  G RDF MAMQ+ E AL+   A 
Sbjct: 61  AAAKATGLPALSDDSGLCVDALDGAPGVYTANWAETPDGSRDFAMAMQRTEVALQEVGAA 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R   F++V+ LA+PDG  E + G+  G +VWPPRG+LGFGYDP+F PNG+D+TFGE
Sbjct: 121 SAEQRKGRFVAVICLAFPDGAAEYYRGEAEGTLVWPPRGELGFGYDPVFLPNGFDKTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           M+ EEK+        +       LSHRARAF+ F    L +
Sbjct: 181 MSAEEKH-------GWKPGQAAALSHRARAFQKFAQARLDL 214


>gi|319406450|emb|CBI80090.1| HAM1-like protein [Bartonella sp. 1-1C]
          Length = 215

 Score =  184 bits (466), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 110/222 (49%), Positives = 140/222 (63%), Gaps = 7/222 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M+ +    ++IA+HN  K+HE+ +LI P GI T S  EL L  P+ETG +FEENA IK+ 
Sbjct: 1   MKSITIKKLIIATHNTGKLHEITTLIAPFGITTQSVKELGLPEPKETGTTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK   +PALSDDSG+ ID L+G PGI++A WA    G RDF  AMQK+EN L+     
Sbjct: 61  AAAKATNLPALSDDSGMEIDALNGAPGIYTADWALQPDGTRDFLKAMQKVENELQKVGPL 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R   FISV+ LA+PDGH + F G V G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 KKNQRKGRFISVICLAYPDGHADYFRGSVEGTFIWPPRGNKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           M+ E+K+                LSHRARAFK F +N L + 
Sbjct: 181 MSTEQKHSWKLHGPTP-------LSHRARAFKLFAENLLVLS 215


>gi|319780509|ref|YP_004139985.1| Ham1 family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166397|gb|ADV09935.1| Ham1 family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 215

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 110/219 (50%), Positives = 141/219 (64%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M  L    IV+ASHN  K+ E   L+ P G    SA E  L  P+ETG +FEENA IK+L
Sbjct: 1   MHSLDGKKIVVASHNEGKLREFADLMGPFGFEAKSAREYGLPEPDETGTTFEENAYIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSGL +D LDG PG+++A WAE+  G RDF MAMQ+ E AL+   A 
Sbjct: 61  AAAKATGLPALSDDSGLCVDALDGAPGVYTANWAETPDGSRDFGMAMQRTEVALQEVGAA 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R   F++V+ LA+PDG  E + G+  G +VWPPRG+LGFGYDP+F P+G+++TFGE
Sbjct: 121 LPEQRKGRFVAVICLAFPDGEAEYYRGEAEGTLVWPPRGELGFGYDPVFLPDGFEKTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ EEK+        +       LSHRARAF+ F    L
Sbjct: 181 MSAEEKH-------GWKPGQPTALSHRARAFQKFAKARL 212


>gi|192288762|ref|YP_001989367.1| deoxyribonucleotide triphosphate pyrophosphatase [Rhodopseudomonas
           palustris TIE-1]
 gi|192282511|gb|ACE98891.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rhodopseudomonas palustris TIE-1]
          Length = 210

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 109/219 (49%), Positives = 136/219 (62%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG SF+ NA IK+ 
Sbjct: 1   MHRRITGKLVIATHNPGKLAEMRELLAPYGIEAISAGELGLAEPDETGGSFQANARIKAE 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK A +PA +DDSGL +D LDG PGI+SARWA      +DF  AM +IE  L+ + A 
Sbjct: 61  AAAKAAQLPAFADDSGLTVDALDGAPGIYSARWA---GDAKDFAGAMARIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+AHF+S L +AWPDGH+E    +  G +VWPPRG  GFGYDP+F P G+ RTFGE
Sbjct: 118 APERRTAHFVSALCVAWPDGHIEEVEARADGTLVWPPRGTAGFGYDPVFLPEGHSRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+G               LSHRA+AF    + CL
Sbjct: 178 MTSVEKHGLPPLGLG--------LSHRAKAFVKLAEICL 208


>gi|148251803|ref|YP_001236388.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bradyrhizobium sp. BTAi1]
 gi|189030894|sp|A5E8I8|NTPA_BRASB RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|146403976|gb|ABQ32482.1| putative HAM1 protein [Bradyrhizobium sp. BTAi1]
          Length = 214

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 108/218 (49%), Positives = 138/218 (63%), Gaps = 11/218 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            + +   IVIA+HN  K+ EM  L+ P G+   SA EL+L  P+ETG +F+ NA IK++ 
Sbjct: 5   HRKLSGRIVIATHNPGKLAEMRELLAPYGVEAVSAGELSLGEPDETGETFQANARIKAVA 64

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  A +PA +DDSG+V+  LDG PGI+SARWA     ++DF  AM +IE  L+ + A  
Sbjct: 65  AADAAQLPAFADDSGIVVHALDGAPGIYSARWAGP---DKDFTAAMTRIERLLQERGATG 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R AHF+S L +AWPDGHVE    +V G +VWPPRG  GFGYDP+F P G+DRTFGEM
Sbjct: 122 PDKRGAHFVSALCVAWPDGHVEEVEARVDGTLVWPPRGSAGFGYDPMFLPEGHDRTFGEM 181

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           T  EK+G               LSHRARAF    + CL
Sbjct: 182 TSLEKHGLPPLGLG--------LSHRARAFVKLAEICL 211


>gi|75674391|ref|YP_316812.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Nitrobacter winogradskyi Nb-255]
 gi|74419261|gb|ABA03460.1| Ham1-like protein [Nitrobacter winogradskyi Nb-255]
          Length = 211

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 107/220 (48%), Positives = 133/220 (60%), Gaps = 11/220 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ E+  L+ P G+   SA EL L  PEETG  F  NA IK+ 
Sbjct: 1   MHRRIAGKLVIATHNPGKLAEIRELLAPYGVEAVSAGELGLDEPEETGEDFRANARIKAT 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           +AA +A +PA +DDSGLV+D LDG PGIHSARWA        F  AM +IE  L+ + A 
Sbjct: 61  SAALSAKLPAFADDSGLVVDALDGAPGIHSARWAGKPAD---FSAAMARIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R AHFIS L +AWPDGH++   G+V G +VWPPRG  GFGYDP+F P+G+ RTFGE
Sbjct: 118 SADQRKAHFISALCVAWPDGHLQEVEGRVDGTLVWPPRGTAGFGYDPVFLPDGHGRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           M   EK+G               LSHRARAF    +  L 
Sbjct: 178 MAGIEKHGLPPRGLG--------LSHRARAFVKLAEIALE 209


>gi|49474878|ref|YP_032919.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bartonella henselae str. Houston-1]
 gi|62900217|sp|Q6G565|NTPA_BARHE RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|49237683|emb|CAF26870.1| hypothetical protein BH00540 [Bartonella henselae str. Houston-1]
          Length = 215

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 108/222 (48%), Positives = 144/222 (64%), Gaps = 7/222 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +    +VIA+HN+ K+ E+ +L+ P G+   SA EL L  P+ETG +FEENA IK+ 
Sbjct: 1   MRSIANKKLVIATHNIGKLQEITTLVAPFGLTIQSAKELGLPEPKETGTTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAKN G+PALSDDSGL +D L+G PG+++A  A  + G RDF  AMQKIE  L+   AH
Sbjct: 61  AAAKNTGLPALSDDSGLEVDALNGAPGVYTADLALQSDGTRDFLKAMQKIEEKLQKIGAH 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             + R   FISV+ +AWPD H + F G+V G  +WPPRG  GFG+DP+F P+GY  TFGE
Sbjct: 121 KKSQRKCRFISVICIAWPDAHADYFHGRVEGSFIWPPRGDKGFGFDPVFLPDGYKNTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           MT E+K+        + +     LSHRA AFK   +N L++ 
Sbjct: 181 MTTEQKH-------GWKLNDQTPLSHRACAFKLLAENLLKLS 215


>gi|319404962|emb|CBI78564.1| HAM1-like protein [Bartonella sp. AR 15-3]
          Length = 215

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 106/222 (47%), Positives = 138/222 (62%), Gaps = 7/222 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR +    ++IA+HN  K++E+ +LI P  I T S  EL L  P+E G +FEENA IK+ 
Sbjct: 1   MRSIAIKKLIIATHNAGKLNEITTLIAPFDITTQSVKELGLPEPKEIGRTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK    PALSDDSG+ ID L+G PG+++A WA    G RDF  AMQ +EN L+   + 
Sbjct: 61  AAAKATSFPALSDDSGIEIDALNGAPGVYTADWALQPDGTRDFLKAMQTVENELQKVGSL 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R   FISV+ LA+PDGH + F G V G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 KKNQRKGRFISVICLAYPDGHADYFCGSVEGTFIWPPRGNKGFGFDPIFVPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           M+ E+K+    +           LSHRARAFK F +N L + 
Sbjct: 181 MSTEQKHNWKLNGQTP-------LSHRARAFKLFAENFLVLS 215


>gi|77464800|ref|YP_354304.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacter sphaeroides 2.4.1]
 gi|77389218|gb|ABA80403.1| putative Ham1p_like protein, Ham1 family [Rhodobacter sphaeroides
           2.4.1]
          Length = 203

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 104/219 (47%), Positives = 128/219 (58%), Gaps = 18/219 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  L  PLGI   SA EL L  PEET  +F  NA IK+  
Sbjct: 3   RKFSGDRLLVATHNKGKLEEIQHLFEPLGIEVVSAGELGLPEPEETETTFAGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK A M AL+DDSG+ ID LDG PG+++A WA + TG RDF  AM      L +  A  
Sbjct: 63  AAKAADMVALADDSGITIDALDGAPGVYTADWAMTPTG-RDFVKAMTDTWARLEAVNAPF 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G + G +VWP RGQ G GYDPIFQP+G + TFGEM
Sbjct: 122 P--RRAQFRCTLVLAWPDGHDEVFEGVMPGQVVWPMRGQQGHGYDPIFQPDGSELTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
              EKN                +SHRARAF+  +  C +
Sbjct: 180 DRWEKNE---------------ISHRARAFRNLMQGCFK 203


>gi|126463643|ref|YP_001044757.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126105307|gb|ABN77985.1| Ham1 family protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 203

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 104/219 (47%), Positives = 128/219 (58%), Gaps = 18/219 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  L  PLGI   SA EL L  PEET  +F  NA IK+  
Sbjct: 3   RKFSGDRLLVATHNKGKLEEIQHLFEPLGIEVVSAGELGLPEPEETETTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK A M AL+DDSG+ ID LDG PG+++A WA + TG RDF  AM      L +  A  
Sbjct: 63  AAKAADMVALADDSGITIDALDGAPGVYTADWAMTPTG-RDFVKAMTDTWARLEAVNAPF 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G + G +VWP RGQ G GYDPIFQP+G + TFGEM
Sbjct: 122 P--RRAQFRCTLVLAWPDGHDEVFEGVMPGQVVWPMRGQQGHGYDPIFQPDGSELTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
              EKN                +SHRARAF+  +  C +
Sbjct: 180 DRWEKNE---------------ISHRARAFRNLMQGCFK 203


>gi|115522382|ref|YP_779293.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodopseudomonas palustris BisA53]
 gi|115516329|gb|ABJ04313.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rhodopseudomonas palustris BisA53]
          Length = 211

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 108/219 (49%), Positives = 137/219 (62%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA +L L  P+ETG++F+ NA IK+ 
Sbjct: 1   MHRRITGQLVIATHNPGKLAEMRELLAPYGIEAISAGDLGLQEPDETGDTFQANARIKAQ 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA  A +PA +DDSGLV+D LDG PGI SARWA      +DF  AM +IE  L+ + A 
Sbjct: 61  AAANAAQLPAFADDSGLVVDALDGAPGIFSARWAGEG---KDFLAAMTQIERLLQERGAR 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P  R+AHF+S L +AWPDGHVE    +  G +VWPPRG  GFGYDP F P+G+ RTFGE
Sbjct: 118 EPEQRTAHFVSALCVAWPDGHVEEVEARADGTLVWPPRGSAGFGYDPTFLPDGHGRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+G               LSHRA+AF    + CL
Sbjct: 178 MTSLEKHGLPPLGLG--------LSHRAKAFIKLAELCL 208


>gi|240849729|ref|YP_002971117.1| HAM1 protein [Bartonella grahamii as4aup]
 gi|240266852|gb|ACS50440.1| HAM1 protein [Bartonella grahamii as4aup]
          Length = 215

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 108/219 (49%), Positives = 145/219 (66%), Gaps = 7/219 (3%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR + +  +VIA+HN  K+HE+ +LI P G++  SA EL L  P+ETG +FEENA IK+ 
Sbjct: 1   MRSIADKKLVIATHNTGKLHEITTLITPFGLIIQSAKELGLPEPKETGKTFEENAYIKAF 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           +AAK  G+PALSDDSGL +D L+G PG+++A WA    G R+F  AM+KIEN L+   A 
Sbjct: 61  SAAKKTGLPALSDDSGLEVDALEGAPGVYTADWAIQADGTRNFPKAMKKIENELQKVGAR 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           + + R   FIS++ +AWPD H + F G V G  +WPPRG  GFG+DPIF P+GY+ TFGE
Sbjct: 121 EKSQRKCRFISIICIAWPDAHADYFRGCVEGTFIWPPRGDKGFGFDPIFLPDGYENTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+ E+K+        +       LSHRARAFK   +N L
Sbjct: 181 MSTEQKH-------NWKCNDIPPLSHRARAFKLLAENLL 212


>gi|260463466|ref|ZP_05811666.1| Ham1 family protein [Mesorhizobium opportunistum WSM2075]
 gi|259030791|gb|EEW32067.1| Ham1 family protein [Mesorhizobium opportunistum WSM2075]
          Length = 225

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 107/216 (49%), Positives = 139/216 (64%), Gaps = 7/216 (3%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+ASHN  K+ E   L+ P G    SA +  L  P+ETG +FEENA IK+L AAK  
Sbjct: 12  KKIVVASHNAGKLREFADLMRPFGFEAKSAKDYGLPEPDETGTTFEENAYIKALAAAKAT 71

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PALSDDSGL +D LDG PG+++A WAE+  G RDF MAMQ+ E AL+   A  P  R 
Sbjct: 72  GLPALSDDSGLCVDALDGAPGVYTANWAETPDGGRDFAMAMQRTEVALQEVGAALPEQRK 131

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
             F++V+ LA+PDG  E + G+  G +VWPPRG+LGFGYDP+F P+G+D+TFGEM+  EK
Sbjct: 132 GRFVAVICLAFPDGEAEYYRGEAEGTLVWPPRGELGFGYDPVFLPDGFDKTFGEMSAAEK 191

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           +        +       LSHRARAF+ F    L + 
Sbjct: 192 H-------GWKPGQATALSHRARAFQKFAQARLDLA 220


>gi|332559696|ref|ZP_08414018.1| dITP/XTP pyrophosphatase [Rhodobacter sphaeroides WS8N]
 gi|332277408|gb|EGJ22723.1| dITP/XTP pyrophosphatase [Rhodobacter sphaeroides WS8N]
          Length = 203

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 104/219 (47%), Positives = 128/219 (58%), Gaps = 18/219 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  L  PLGI   SA EL L  PEET  +F  NA IK+  
Sbjct: 3   RKFSGDRLLVATHNKGKLEEIQHLFEPLGIEVVSAGELGLPEPEETETTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK A M AL+DDSG+ ID LDG PG+++A WA + TG RDF  AM      L +  A  
Sbjct: 63  AAKAADMVALADDSGITIDALDGAPGVYTADWAMTPTG-RDFVKAMTDTWARLEAVNAPF 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G + G +VWP RGQ G GYDPIFQP+G + TFGEM
Sbjct: 122 P--RRAQFRCTLVLAWPDGHDEVFEGVMPGQVVWPMRGQQGHGYDPIFQPDGSELTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
              EKN                +SHRARAF+  +  C +
Sbjct: 180 GRWEKNE---------------ISHRARAFRDLMQGCFK 203


>gi|119382768|ref|YP_913824.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Paracoccus denitrificans PD1222]
 gi|119372535|gb|ABL68128.1| dITPase [Paracoccus denitrificans PD1222]
          Length = 201

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 96/214 (44%), Positives = 130/214 (60%), Gaps = 18/214 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+L E  +++A+HN  K+ E+ +++ P GI  TSA E+ L  P ET +SF  NA IK+ 
Sbjct: 1   MRRLTERKLLVATHNKGKLDEIRAMMAPHGIEVTSAGEMGLPEPAETESSFIGNARIKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A +  G+P L+DDSG+ +D LDG PG+++A WAE+  G RDF  AM +    L  + A 
Sbjct: 61  AAMQATGLPVLADDSGITVDGLDGAPGVYTADWAETPNG-RDFMQAMTRTWTELDERGAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P  R+A F + L L WPDGH E F G   G +VWPPRG  G GYDPIF P+G+D T+ E
Sbjct: 120 EP--RTAQFRATLILLWPDGHEEIFEGVAPGRLVWPPRGAHGHGYDPIFVPDGHDVTYAE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
           M  E+KN                +SHRARAF+  
Sbjct: 178 MPSEQKNA---------------ISHRARAFRKL 196


>gi|299133260|ref|ZP_07026455.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Afipia
           sp. 1NLS2]
 gi|298593397|gb|EFI53597.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Afipia
           sp. 1NLS2]
          Length = 212

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 109/218 (50%), Positives = 137/218 (62%), Gaps = 11/218 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            + I   +VIA+HN  K+ EM  L+ P GI   SA ELNL  PEETG +F  NA IK+  
Sbjct: 4   HRHITGRLVIATHNSGKLAEMRELLAPYGIEAVSAGELNLPEPEETGTTFAANARIKAEA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA   G+PA +DDSGL +D LD +PGI+SARWA  +   +DF  AM +IE  L+ + A  
Sbjct: 64  AANATGLPAFADDSGLCVDALDSQPGIYSARWAGPS---KDFMAAMAQIERLLQERGATA 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           PA R AHF+S L +AWPDGH+E    +V+G +VWPPRG  GFGYDP F P+G+ RTFGEM
Sbjct: 121 PAQRKAHFVSALCVAWPDGHLEEVEERVNGAMVWPPRGDAGFGYDPAFLPDGHGRTFGEM 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           T  EK+G               LSHRA+AF    + CL
Sbjct: 181 TSIEKHGLPPLGLG--------LSHRAKAFVKLAEICL 210


>gi|221640719|ref|YP_002526981.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacter sphaeroides KD131]
 gi|221161500|gb|ACM02480.1| Ham1 family protein [Rhodobacter sphaeroides KD131]
          Length = 203

 Score =  180 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 104/219 (47%), Positives = 127/219 (57%), Gaps = 18/219 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  L  PLGI   SA EL L  PEET  +F  NA IK+  
Sbjct: 3   RKFSGDRLLVATHNKGKLEEIQHLFEPLGIEVVSAGELGLPEPEETETTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK A M AL+DDSG+ ID LDG PG+++A WA + TG RDF  AM      L +  A  
Sbjct: 63  AAKAADMVALADDSGITIDALDGAPGVYTADWAMTPTG-RDFVKAMTDTWARLEAVNAPF 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G + G +VWP RGQ G GYDPIFQP G + TFGEM
Sbjct: 122 P--RRAQFRCTLVLAWPDGHDEVFEGVMPGQVVWPMRGQQGHGYDPIFQPAGSELTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
              EKN                +SHRARAF+  +  C +
Sbjct: 180 DRWEKNE---------------ISHRARAFRNLMQGCFK 203


>gi|92115782|ref|YP_575511.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Nitrobacter hamburgensis X14]
 gi|91798676|gb|ABE61051.1| Ham1-like protein [Nitrobacter hamburgensis X14]
          Length = 211

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 109/216 (50%), Positives = 136/216 (62%), Gaps = 11/216 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  PEETG+ F  NA IK++
Sbjct: 1   MHRRIAGKLVIATHNPGKLAEMRELLAPYGIEAVSAGELGLGEPEETGDDFRANATIKAV 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA++A +PA +DDSGLV+D LDG PGI+SARWA      +DF  AM +IE  L+ + A 
Sbjct: 61  AAARSAKLPAFADDSGLVVDALDGAPGIYSARWAGET---KDFSAAMTRIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R AHF+S L +AWPDGH+E    +V G +VWPPRG  GFGYDP FQP+G+ RTFGE
Sbjct: 118 TAEKRKAHFVSALCVAWPDGHLEEVEARVHGTLVWPPRGTAGFGYDPAFQPDGHTRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           MT  EK+G               LSHRARAF    +
Sbjct: 178 MTSIEKHGLPPRGLG--------LSHRARAFVKLAE 205


>gi|86747550|ref|YP_484046.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodopseudomonas palustris HaA2]
 gi|86570578|gb|ABD05135.1| Ham1-like protein [Rhodopseudomonas palustris HaA2]
          Length = 210

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 112/219 (51%), Positives = 136/219 (62%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG+SF  NA IK+ 
Sbjct: 1   MHRRISGQLVIATHNPGKLAEMRELLAPYGIAAVSAGELGLGEPDETGDSFRANARIKAE 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+ A +PA +DDSGL +D LDG PGI SARWA      +DF+ AM +IE  L+ + A 
Sbjct: 61  AAAQAAQLPAFADDSGLAVDALDGAPGILSARWAGEG---KDFNAAMARIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R AHF+S L +AWPDGHVE    +  G +VWPPRG  GFGYDPIF P G+DRTFGE
Sbjct: 118 TPDRRGAHFVSALCVAWPDGHVEEVEARADGTLVWPPRGSAGFGYDPIFLPEGHDRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+G               LSHRARAF    + CL
Sbjct: 178 MTSLEKHGLPPLGLG--------LSHRARAFVELAEICL 208


>gi|126734414|ref|ZP_01750161.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter sp. CCS2]
 gi|126717280|gb|EBA14144.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter sp. CCS2]
          Length = 202

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 103/219 (47%), Positives = 128/219 (58%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+     +VIA+HN  K+ E+  L+ P G+  TS  +  L  PEET  +F  NA IK+ 
Sbjct: 1   MRRFDGKELVIATHNQGKLEEIADLLKPYGVSLTSNADHGLPEPEETETTFVGNAQIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+ ID L G PG+++A WAE+  G RDF MAM++    L +  A 
Sbjct: 61  AAAQAIGLPALSDDSGIEIDGLGGAPGVYTADWAETPNG-RDFKMAMKRSWAELEAVSAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F   L LAWPDGH E F G + G IVWP RG  G GYDPIFQP+GYD TFGE
Sbjct: 120 FP--RTARFCCTLVLAWPDGHDEVFPGVMPGQIVWPMRGDQGHGYDPIFQPDGYDITFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                +SHRA AF   +  C 
Sbjct: 178 MDRWEKNK---------------ISHRADAFAKLIAGCF 201


>gi|260431971|ref|ZP_05785942.1| Ham1 family protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415799|gb|EEX09058.1| Ham1 family protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 204

 Score =  178 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 103/218 (47%), Positives = 132/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+   + +++A+HN  K+ EM  L+ P G+    A E+NL  PEET ++F  NA IK+  
Sbjct: 3   RRFEGDRLLVATHNKGKLEEMSHLLEPFGVTVVGAAEMNLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  N L +  A  
Sbjct: 63  AAQATGLPALSDDSGITIDALDGAPGVYTADWAETGNG-RDFLMAMTRAHNELEALNAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P   +A F   L LAWPDGH E F G V G +VWP RG+ GFGYDP+F P GYD+TF EM
Sbjct: 122 PR--TAQFRCTLVLAWPDGHDEVFEGVVPGHLVWPIRGKDGFGYDPMFVPEGYDQTFAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRARA + FV  C 
Sbjct: 180 DRWEKNK---------------ISHRARAVELFVKGCF 202


>gi|260576116|ref|ZP_05844109.1| Ham1 family protein [Rhodobacter sp. SW2]
 gi|259021596|gb|EEW24899.1| Ham1 family protein [Rhodobacter sp. SW2]
          Length = 202

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 103/219 (47%), Positives = 132/219 (60%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRK   + +++A+HN  K+ E+  L+ P GI  TSA E+ L  P ET ++F  NA IK+ 
Sbjct: 1   MRKFSGDRLLVATHNRGKLEEIAKLLEPFGIDVTSAGEMGLAEPIETESTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A +  G+PAL+DDSG+ ID LDG PG+++A WAE+ TG RDF MAM K  + L +  A 
Sbjct: 61  FATQATGLPALADDSGISIDALDGAPGVYTADWAETPTG-RDFGMAMAKTWDRLEAVNAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F   L LAWPDGH E F G + G +VWP RG  G GYDPIFQP+G+D TFGE
Sbjct: 120 FP--RRAQFRCTLVLAWPDGHDEVFEGVMPGQVVWPMRGDQGHGYDPIFQPDGFDLTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   +KN                +SHRA AF+  V  C 
Sbjct: 178 MDRWQKNQ---------------ISHRADAFRKLVAGCF 201


>gi|110677821|ref|YP_680828.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter denitrificans OCh 114]
 gi|109453937|gb|ABG30142.1| Ham1 protein-like protein [Roseobacter denitrificans OCh 114]
          Length = 203

 Score =  177 bits (449), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 97/218 (44%), Positives = 127/218 (58%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK     I+IA+HN  K+ EM  L  P G+    A E+ L  PEET ++F  NA IK+  
Sbjct: 3   RKFDGKRILIATHNAGKLEEMQQLFAPYGVDVVGAAEMGLAEPEETESTFIGNARIKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A +  G+PAL+DDSG+ ++ L+  PG+++A WAE+  G RDF MAM K    L    A  
Sbjct: 63  AVEATGLPALADDSGIEVEALNNAPGVYTADWAETPNG-RDFVMAMTKTHTKLEEINAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F + L LAWPDGH E F G+V+G +VWP RG+ G GYDP+FQP+G+D TF EM
Sbjct: 122 P--RRARFRATLVLAWPDGHDEVFDGRVNGTLVWPIRGKTGHGYDPMFQPDGHDMTFAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRA AF+  +  C 
Sbjct: 180 DPAEKN---------------RISHRADAFQKLIAGCF 202


>gi|254472486|ref|ZP_05085886.1| Ham1 family protein [Pseudovibrio sp. JE062]
 gi|211958769|gb|EEA93969.1| Ham1 family protein [Pseudovibrio sp. JE062]
          Length = 213

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 99/218 (45%), Positives = 139/218 (63%), Gaps = 15/218 (6%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L    +V+ASHN  K+ E+  ++ P G    SA +L+L  P E G++FE NA IK+L 
Sbjct: 9   RRLEPGKLVLASHNKGKLREIQDMLAPHGFEVLSAGDLDLPEPVEDGDTFEANAAIKALA 68

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA   G+PAL+DDSG  ++ L+G PGI+SARWA      +DF +AMQ +++ L    A  
Sbjct: 69  AATATGLPALADDSGFCVNGLNGDPGIYSARWAGPG---KDFGVAMQSVQDKLTETGAT- 124

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A+F++VL +AWPDGH + + G++ G + WPPRG  GFGYDP+F P G+DRTFGEM
Sbjct: 125 --DRTAYFVAVLCMAWPDGHTQFYRGEIHGELAWPPRGLEGFGYDPMFVPEGFDRTFGEM 182

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            ++EK+         +    + LSHRARAF  F   CL
Sbjct: 183 DKQEKH---------TTKEGEALSHRARAFVKFQKECL 211


>gi|114762202|ref|ZP_01441670.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Pelagibaca bermudensis HTCC2601]
 gi|114545226|gb|EAU48229.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius sp. HTCC2601]
          Length = 203

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 101/218 (46%), Positives = 130/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK     +++A+HN  K+ E+  L+ P G+    A E++L  PEETG +F ENA IK+  
Sbjct: 3   RKFEGKKLLVATHNRGKLEEIADLLKPYGVEVVGAAEMDLPEPEETGTTFVENARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  + L +    +
Sbjct: 63  AAQATGLPALSDDSGIAIDALDGAPGVYTADWAETGNG-RDFVMAMTRAHDELTASGKPE 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P   +A F   L LAWPDGH E F G + G +VWP RG  G GYDP+F+P GYD TFGEM
Sbjct: 122 P--WTARFCCTLVLAWPDGHDEVFPGVMEGRVVWPMRGDQGHGYDPVFEPQGYDITFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRA AF  FV  C 
Sbjct: 180 DRWEKNK---------------ISHRADAFAKFVTGCF 202


>gi|85714062|ref|ZP_01045051.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Nitrobacter sp. Nb-311A]
 gi|85699188|gb|EAQ37056.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Nitrobacter sp. Nb-311A]
          Length = 211

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 107/220 (48%), Positives = 134/220 (60%), Gaps = 11/220 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P G+   SA EL L  PEETG  F  NA IK+ 
Sbjct: 1   MNRRIAGKLVIATHNPGKLVEMRELLAPYGVEAISAGELGLSEPEETGEDFRANARIKAT 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           +AA++A +PA +DDSGLV+D LDG PGIHSARWA        F  AM +IE  L+ + A 
Sbjct: 61  SAARSAKLPAFADDSGLVVDALDGAPGIHSARWAGKPAD---FSAAMTRIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R AHF+S L +AWPDGH++   G+V G +VWPPRG  GFGYDP+F P+G+ RTFGE
Sbjct: 118 GADKRKAHFVSALCVAWPDGHLQEVEGRVDGTLVWPPRGTAGFGYDPVFLPDGHRRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           M   EK+G               LSHRARAF    +  L 
Sbjct: 178 MAGIEKHGLPPRGLG--------LSHRARAFVKLAEIALE 209


>gi|254463982|ref|ZP_05077393.1| Ham1 family [Rhodobacterales bacterium Y4I]
 gi|206684890|gb|EDZ45372.1| Ham1 family [Rhodobacterales bacterium Y4I]
          Length = 204

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 98/218 (44%), Positives = 131/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +++A+HN  K+ E+  ++ P G+    A E+NL  PEET ++F  NA IK+  
Sbjct: 3   RKLEGGKLLVATHNKGKLSEIAEILAPYGVTVIGAGEMNLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID L+G PG+++A WAE+  G RDF MAM +  + L +  A  
Sbjct: 63  AAKATGLPALSDDSGITIDALNGAPGVYTADWAETPDG-RDFKMAMTRANDELTAAGAAA 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R+A F   L +AWPDGH E F G ++G +VWP RG  GFGYDP+FQP+GY+ T  EM
Sbjct: 122 P--RTAQFRCTLVVAWPDGHDEVFEGVMAGQLVWPIRGGHGFGYDPMFQPDGYEITCAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHR +A   FV  C 
Sbjct: 180 DPAEKNK---------------ISHRGKALAQFVQGCF 202


>gi|146337342|ref|YP_001202390.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bradyrhizobium sp. ORS278]
 gi|146190148|emb|CAL74140.1| putative HAM1 protein [Bradyrhizobium sp. ORS278]
          Length = 202

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 105/210 (50%), Positives = 135/210 (64%), Gaps = 11/210 (5%)

Query: 11  IASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPA 70
           IA+HN  K+ EM  L+ P G+   SA EL L  PEETG++F+ NA IK++ AA+ A +PA
Sbjct: 2   IATHNAGKLVEMRELLAPHGVEAVSAGELGLGEPEETGDTFQANARIKAVAAAEAAQLPA 61

Query: 71  LSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFI 130
            +DDSG+V+  LDG PGI+SARWA      +DF  AM +IE  L+ + A     R+AHF+
Sbjct: 62  FADDSGIVVHALDGAPGIYSARWAGPG---KDFGAAMAQIERLLQERGAVTADKRTAHFV 118

Query: 131 SVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGGI 190
           S L +AWPDGH+E    +V G +VWPPRG  GFGYDP+F P+G+DRTFGEMT  EK+G  
Sbjct: 119 SALCVAWPDGHIEEVEARVDGTLVWPPRGTAGFGYDPMFLPDGHDRTFGEMTSIEKHGLP 178

Query: 191 DSATLFSILSTDLLSHRARAFKCFVDNCLR 220
                        LSHRARAF    + CL 
Sbjct: 179 PLGLG--------LSHRARAFVKLAEICLE 200


>gi|149912895|ref|ZP_01901429.1| Ham1-like protein [Roseobacter sp. AzwK-3b]
 gi|149813301|gb|EDM73127.1| Ham1-like protein [Roseobacter sp. AzwK-3b]
          Length = 202

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 106/219 (48%), Positives = 128/219 (58%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRK   + +++A+HN  K+ E+ SL+ P G+    A E  L  PEET  SF  NA IK+ 
Sbjct: 1   MRKFTGDTLLVATHNSGKLEEIASLLEPFGVKVVGAAEKGLAEPEETETSFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSG+ +D LDG PG+ +A WAE+ TG RDF MAM K  + L    A 
Sbjct: 61  AAAKATGLPALSDDSGIEVDALDGAPGVFTANWAETETG-RDFIMAMGKTHDRLVESGAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P   +A F   L LAWPDGH E F G V G IVWP RG  G GYDPIFQP+GY++TFGE
Sbjct: 120 QP--WTARFCCTLVLAWPDGHDEVFPGTVEGRIVWPMRGHEGHGYDPIFQPDGYEQTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M    KN                +SHRA AF   V  C 
Sbjct: 178 MDRWGKN---------------RISHRADAFAKLVKGCF 201


>gi|126724519|ref|ZP_01740362.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacterales bacterium HTCC2150]
 gi|126705683|gb|EBA04773.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacterales bacterium HTCC2150]
          Length = 203

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 95/219 (43%), Positives = 127/219 (57%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+  E  ++IA+HN  K+ E++ L+ P G+   SA +LNL  P+ET ++F  NA IK+ 
Sbjct: 1   MRQFSEKKLLIATHNQGKLEEIERLLAPFGVAVVSAGQLNLDEPDETEDNFIGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A K  G+PAL+DDSG+ ID LDG PG+++A WAE+  G    D  M       + + A 
Sbjct: 61  AAVKATGLPALADDSGIEIDALDGAPGVYTADWAETPNG---RDFVMAMTNTWQKLEDAV 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F   L LAWPDGH E F G++ G + WP RG+ G GYDPIF P+GYD T GE
Sbjct: 118 APYPRTARFRCTLVLAWPDGHDEIFEGQIDGAVTWPLRGEQGHGYDPIFMPDGYDITLGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   +KN                +SHRA AF   V+ C 
Sbjct: 178 MDRWKKNE---------------ISHRADAFNKLVNGCF 201


>gi|146278692|ref|YP_001168851.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145556933|gb|ABP71546.1| Ham1 family protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 203

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 98/218 (44%), Positives = 124/218 (56%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R    + +++A+HN  K+ E+  L  PLGI   SA +L L  PEET  +F  NA IK+  
Sbjct: 3   RTFSGDRLLVATHNKGKLEEIQHLFEPLGIAVVSAGDLGLPEPEETETTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK AGM AL+DDSG+ ID LDG PG+++A WA + TG    D      +   + + A+ 
Sbjct: 63  AAKAAGMVALADDSGITIDALDGAPGVYTADWAMTPTG---RDFVKAMTDTWAKLETANA 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G + G +VWP RG  G GYDPIFQP+G D TFGEM
Sbjct: 120 PFPRKAQFRCTLVLAWPDGHDEVFEGVMPGQVVWPMRGDQGHGYDPIFQPDGSDLTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRARAF+  +  C 
Sbjct: 180 DRWEKNQ---------------ISHRARAFRSLMAGCF 202


>gi|89052696|ref|YP_508147.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Jannaschia sp. CCS1]
 gi|88862245|gb|ABD53122.1| Ham1-like protein [Jannaschia sp. CCS1]
          Length = 203

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 102/218 (46%), Positives = 132/218 (60%), Gaps = 18/218 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+   + ++IA+HN  K+ EM  L+ P GI  + A + +L  P+ET  +F  NA IK+ 
Sbjct: 1   MRRFTGDQLLIATHNQGKLDEMRHLLQPFGIRVSGAADHDLPEPDETETTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSG+ ID L G PG+++A WAE+  G RDF MAM++    L +  A 
Sbjct: 61  AAAKATGLPALSDDSGIEIDALGGAPGVYTADWAETPDG-RDFVMAMERAHRELEAVGAS 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F   L LAWPDGH E F G + G +VWP RG+ G GYDP+FQPNGYD TFGE
Sbjct: 120 HP--RTARFCCTLVLAWPDGHDEVFPGVMEGQVVWPMRGEQGHGYDPVFQPNGYDLTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           M   EKN                +SHRARA +  V+  
Sbjct: 178 MDRWEKNK---------------ISHRARAVEQLVEIF 200


>gi|163732969|ref|ZP_02140413.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter litoralis Och 149]
 gi|161393504|gb|EDQ17829.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter litoralis Och 149]
          Length = 203

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 97/218 (44%), Positives = 125/218 (57%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK     I+IA+HN  K+ EM  L  P G+    A E+ L  PEET  +F  NA IK+  
Sbjct: 3   RKFDGTRILIATHNAGKLEEMQQLFAPYGVDVVGAAEMGLAEPEETETTFIGNARIKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A    G+PAL+DDSG+ ++ L+  PG+++A WAE   G RDF MAM K    L    A  
Sbjct: 63  AVAATGLPALADDSGIEVEALNDAPGVYTADWAEIPNG-RDFIMAMTKTHTKLEEINAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F + L LAWPDGH E F G+V+G +VWP RG+ G GYDP+FQP+G+D TF EM
Sbjct: 122 P--RRARFRATLVLAWPDGHDEVFDGRVNGTLVWPMRGKTGHGYDPMFQPDGHDITFAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             E+KN                +SHRA AF+  +  C 
Sbjct: 180 DPEQKN---------------RISHRADAFQKLIAGCF 202


>gi|294679007|ref|YP_003579622.1| nucleoside-triphosphatase [Rhodobacter capsulatus SB 1003]
 gi|294477827|gb|ADE87215.1| nucleoside-triphosphatase [Rhodobacter capsulatus SB 1003]
          Length = 203

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 93/216 (43%), Positives = 119/216 (55%), Gaps = 18/216 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR   E  +++A+HN  K+ EM  L+ P G+    A E+NL  P ET  +F  NA IK+ 
Sbjct: 1   MRAFTEKRLLVATHNKGKLAEMRDLLAPYGVEVVGAAEMNLPEPAETETTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PALSDDSG+ +D LDG PG+++A WAE+  G        +        +  +
Sbjct: 61  AAAKATGLPALSDDSGIEVDALDGAPGVYTADWAETPNGRDFVQAMTRTWAEC---EAKN 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F S L LAWPDGH E F G   G +VWP RG  G GYDP+FQP G+D TF E
Sbjct: 118 APFPRRARFRSTLVLAWPDGHDEVFEGSAEGQLVWPMRGAQGHGYDPMFQPEGFDVTFAE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           M   +KN                +SHRA AF+ FV 
Sbjct: 178 MDPAQKNE---------------ISHRADAFRKFVK 198


>gi|296533565|ref|ZP_06896134.1| nucleoside-triphosphatase [Roseomonas cervicalis ATCC 49957]
 gi|296266102|gb|EFH12158.1| nucleoside-triphosphatase [Roseomonas cervicalis ATCC 49957]
          Length = 202

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 99/219 (45%), Positives = 122/219 (55%), Gaps = 20/219 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L E  IV+ASHN  K+ E  +L+   GI   SA EL L  P ET  +F  NA IK+L 
Sbjct: 3   RRLEERRIVLASHNAGKVRENAALLAEYGIAVVSAKELGLPEPAETETTFLGNATIKALA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+ A M A++DDSG  I  L+G PG+++A WAE   G RD+  AM K E       A  
Sbjct: 63  AARAANMVAMADDSGFSIASLNGDPGVYTADWAEQPGGGRDYAKAMAKAE-----ALARP 117

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F   L LAWPDGH E F GK  G  VWPPRG  GFGYDP+FQP G+  TF EM
Sbjct: 118 HPDRTAWFTCALVLAWPDGHTEGFEGKAMGEWVWPPRGAAGFGYDPMFQPKGHAETFAEM 177

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
               K+                +SHRA AF+   + CL+
Sbjct: 178 DPAVKH---------------RISHRAEAFRLLAEGCLK 201


>gi|298293789|ref|YP_003695728.1| Ham1 family protein [Starkeya novella DSM 506]
 gi|296930300|gb|ADH91109.1| Ham1 family protein [Starkeya novella DSM 506]
          Length = 218

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 111/214 (51%), Positives = 139/214 (64%), Gaps = 11/214 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            + +E  IVIA+HN  K+ EM  L+ P G+   SA EL L  PEETG +F ENA IK+++
Sbjct: 7   HRRLEGRIVIATHNPGKLEEMRGLLAPYGVDAVSAGELGLPEPEETGLTFAENARIKAVS 66

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK +G+PA +DDSGL ++ L G PG+ +ARWA     E+DF  AM ++E  LR+  A  
Sbjct: 67  AAKASGLPAFADDSGLCVEALGGAPGLLTARWAGP---EKDFMAAMTRVETELRAAGAEL 123

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A+FIS L LAWPDGH E+F G V G +VWPPRG  GFGYDP+FQP+GY+RTFGEM
Sbjct: 124 PDLRRAYFISALCLAWPDGHAEDFEGVVEGTLVWPPRGPAGFGYDPMFQPDGYERTFGEM 183

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           T  EK+G               LSHRARAF    
Sbjct: 184 TGAEKHGLPPLGRG--------LSHRARAFIALA 209


>gi|126730098|ref|ZP_01745910.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sagittula stellata E-37]
 gi|126709478|gb|EBA08532.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sagittula stellata E-37]
          Length = 203

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 105/218 (48%), Positives = 129/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK     +++A+HN  K+ E+  L+ P G+    A  + L  P E G +F ENA IK+  
Sbjct: 3   RKFEGEKLLVATHNQGKLEEIADLLKPFGVEVVGAAGMGLPEPVEDGTTFIENARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LD  PG+++A WAE+ TG RDF MAM K  + L    A +
Sbjct: 63  AAKATGLPALSDDSGIEIDALDKAPGVYTADWAETETG-RDFVMAMTKSHDLLVKSGAPE 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P    A F   L LAWPDGH E F GK+ G +VWP RG+ G GYDPIFQP GYD TFGEM
Sbjct: 122 PWI--ARFCCTLVLAWPDGHDEVFPGKMEGRVVWPMRGEQGHGYDPIFQPEGYDVTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRA AF+ FVD C 
Sbjct: 180 DRWEKNK---------------ISHRADAFRKFVDGCF 202


>gi|296447434|ref|ZP_06889359.1| Ham1 family protein [Methylosinus trichosporium OB3b]
 gi|296255054|gb|EFH02156.1| Ham1 family protein [Methylosinus trichosporium OB3b]
          Length = 209

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 100/217 (46%), Positives = 134/217 (61%), Gaps = 12/217 (5%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           + IE  +VIA+HN  K+ E+  L+ P G+   SA EL +  PEET  SF  NA++K+  +
Sbjct: 4   RKIEGRLVIATHNPGKLWELRQLLEPHGVDAVSAGELGVTEPEETETSFAGNALLKARAS 63

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
               G+PA +DDSGL +D LDG PG++SARW       RDF  A++++E  L  + A  P
Sbjct: 64  CAATGLPAFADDSGLCVDALDGAPGVYSARW---GGDNRDFAAAIRRVERELAERGATAP 120

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
               AHF+  L++AWPDGHVE F G+V G++V+PPRG+ GFGYDPIF P+G  RTFGEM 
Sbjct: 121 FP--AHFVCALAVAWPDGHVEEFEGRVDGVLVFPPRGEQGFGYDPIFLPDGLSRTFGEMM 178

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             EK+             +  LSHRARAF+     CL
Sbjct: 179 SAEKHA-------LPGDGSRALSHRARAFQALARACL 208


>gi|332188369|ref|ZP_08390094.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sphingomonas sp. S17]
 gi|332011598|gb|EGI53678.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sphingomonas sp. S17]
          Length = 208

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 104/218 (47%), Positives = 131/218 (60%), Gaps = 21/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +V+ASHN  KI E   L+ P G+   +A +L+L  PEETG +F  NA +K+L 
Sbjct: 12  RKLEPGKLVLASHNKGKIVEFRELLAPYGVEVIAAGDLDLPEPEETGTTFVANAELKALA 71

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G+PALSDDSGL ++ L G PG+ SARWA     E+DF MAM+ +E+ L  +    
Sbjct: 72  AADLSGLPALSDDSGLCVEALGGDPGLFSARWAGP---EKDFAMAMRAVEDRLNEEPD-- 126

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+AHF+  L++ WPDGHVE F G+V G IVWPPRG  G GYDPIFQP GY  TF EM
Sbjct: 127 -MSRAAHFVCALAVGWPDGHVEWFEGRVDGTIVWPPRGDKGHGYDPIFQPIGYTETFAEM 185

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            + EKN                +SHRA AF   V    
Sbjct: 186 DQGEKN---------------RISHRADAFGQLVKAVF 208


>gi|163745105|ref|ZP_02152465.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanibulbus indolifex HEL-45]
 gi|161381923|gb|EDQ06332.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanibulbus indolifex HEL-45]
          Length = 203

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 104/218 (47%), Positives = 131/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK  E+ I+IA+HN  K+ EM  L  P G+    A E+NL  PEET  +F  NA IK+  
Sbjct: 3   RKFTESRILIATHNAGKLAEMSQLFAPHGVSVFGAAEMNLPEPEETETTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  GMPAL+DDSG+ ++ LD  PG+++A WAE+  G RDF MAM K  + L  K A  
Sbjct: 63  AAKATGMPALADDSGIEVEALDNAPGVYTADWAETENG-RDFVMAMTKTRDLLEEKNAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F + L LAWPDGH E F GKV+G +VWP RG+ G GYDP+FQP+G+D TF EM
Sbjct: 122 P--RRARFCATLVLAWPDGHDEVFVGKVNGTLVWPMRGEQGHGYDPMFQPDGHDVTFAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              +KN                +SHRA AF   +  C 
Sbjct: 180 DAAQKNS---------------ISHRADAFAKLIAGCF 202


>gi|254486927|ref|ZP_05100132.1| Ham1 family protein [Roseobacter sp. GAI101]
 gi|214043796|gb|EEB84434.1| Ham1 family protein [Roseobacter sp. GAI101]
          Length = 203

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 104/218 (47%), Positives = 134/218 (61%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+   + I+IA+HN  K+ EM  L  P G+    A E+NL  PEET ++F  NA IK++ 
Sbjct: 3   RRFTGDQILIATHNAGKLQEMAELFAPFGVRVVGAAEMNLAEPEETEDNFIGNARIKAVA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A K  G+PAL+DDSG+ ++ LDG PG+++A W+E+  G RDF MAM K  N L  K A  
Sbjct: 63  AVKATGLPALADDSGIEVEALDGAPGVYTADWSETPNG-RDFVMAMTKTHNLLEEKNAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P    A F + L LAWPDGH E F G V+G +VWP RG++G GYDPIFQP+GYD+TFGEM
Sbjct: 122 PR--RARFCATLVLAWPDGHEEIFEGTVNGKLVWPMRGEIGHGYDPIFQPDGYDQTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           T +EKN                +SHRA AF      C 
Sbjct: 180 THDEKNK---------------ISHRADAFAKLTSACF 202


>gi|84684653|ref|ZP_01012554.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84667632|gb|EAQ14101.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodobacterales bacterium HTCC2654]
          Length = 204

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 103/218 (47%), Positives = 137/218 (62%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R    + +VIASHN  K+ E+ +L+ P G+  +SA E  L  P+ET ++F  NA IK+  
Sbjct: 3   RAFTGDRLVIASHNKGKLREIAALVEPFGVTCSSASEFGLEEPDETEDTFAGNARIKAHF 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+++D LDG PG+++A WAE+  G RDF MAM+K  + L  + A +
Sbjct: 63  AAKATGLPALSDDSGIMVDALDGAPGVYTADWAETPDG-RDFPMAMRKTWDLLDERGAAE 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R+A F   L LAWPDGH E F G+VSG + WP RG  GFGYDPIF P+G+D TFGEM
Sbjct: 122 P--RTASFNCTLCLAWPDGHDEIFEGRVSGRLTWPMRGDQGFGYDPIFIPDGFDITFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             ++K+                +SHRA AF   V+ C 
Sbjct: 180 DPKQKHE---------------MSHRAVAFAKLVEGCF 202


>gi|149204371|ref|ZP_01881338.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius sp. TM1035]
 gi|149142256|gb|EDM30303.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius sp. TM1035]
          Length = 202

 Score =  173 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 93/219 (42%), Positives = 123/219 (56%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRK  ++ +++A+HN  K+ E+ +L+ P G+    A  + L  P ET  SF  NA IK+ 
Sbjct: 1   MRKFTDDRLLVATHNAGKLDEIRALLAPYGVDVVGAAAMGLQEPAETETSFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+ ID LDG PG+++A WAE+ TG        +  E  L    + 
Sbjct: 61  AAAQATGLPALSDDSGIAIDALDGAPGVYTADWAETETGRDFGKAMSRAHEALL---ASK 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P   +A F   L LAWPDGH E F G V G +VWP RG  G GYDP+FQP G+D TF E
Sbjct: 118 EPQPWTARFCCTLVLAWPDGHDEVFEGTVEGWVVWPIRGAEGHGYDPMFQPLGHDLTFAE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M+  +KN                +SHRA AF   V  C 
Sbjct: 178 MSPAKKN---------------RISHRADAFGKLVAGCF 201


>gi|84501188|ref|ZP_00999393.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanicola batsensis HTCC2597]
 gi|84390479|gb|EAQ02967.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanicola batsensis HTCC2597]
          Length = 202

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 100/219 (45%), Positives = 129/219 (58%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+     +VIASHN  K+ E+  L+ P GI  +SA +  L  P ET  +F  NA IK+ 
Sbjct: 1   MRRFDGKELVIASHNKGKLREIAELLTPFGINVSSAADHGLDEPAETEETFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+ +D L G+PG+H+A WAE+  G RDF MAM ++   L  + A 
Sbjct: 61  YAAQATGLPALSDDSGITVDALGGQPGVHTADWAETPDG-RDFPMAMTRVWTLLEERDAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R+A F + L LAWPDGH E F GKV G +VWP RG+ GFG+DP+F P+G   TFGE
Sbjct: 120 LP--RTASFNATLVLAWPDGHDEVFEGKVDGQVVWPMRGEEGFGFDPVFLPDGETETFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M    K                 +SHRA AF+  V  C 
Sbjct: 178 MDPARK---------------KDMSHRADAFRKLVKGCF 201


>gi|84514912|ref|ZP_01002275.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Loktanella vestfoldensis SKA53]
 gi|84511071|gb|EAQ07525.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Loktanella vestfoldensis SKA53]
          Length = 202

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 95/219 (43%), Positives = 122/219 (55%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+   + +++A+HN  K+ E+  L+ P G+M +S  +  L  PEET  +F  NA IK+ 
Sbjct: 1   MRRFAGDRLLVATHNQGKLDEIADLLSPFGVMLSSNADHGLPEPEETETTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+ ID L G PG+++A WAE+  G    D  M         + A 
Sbjct: 61  AAAQATGLPALSDDSGITIDGLGGAPGVYTADWAETPQG---RDFGMAMNRAWAELEAAR 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P  R A F   L LAWPDGH E F G ++G IVWP RG  G GYDPIFQP GY +TFGE
Sbjct: 118 APFPRLAQFRCTLVLAWPDGHDEVFEGVMAGQIVWPMRGDQGHGYDPIFQPEGYAQTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                +SHRA AF   +  C 
Sbjct: 178 MDRWEKNK---------------ISHRADAFAKLIAGCF 201


>gi|154246477|ref|YP_001417435.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Xanthobacter autotrophicus Py2]
 gi|154160562|gb|ABS67778.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Xanthobacter autotrophicus Py2]
          Length = 211

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 107/219 (48%), Positives = 134/219 (61%), Gaps = 11/219 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            ++++  +V+A+HN  K+ EM  L+ P G+   SA EL L  PEET  +F  NA +K+  
Sbjct: 3   HRILKGRLVVATHNPGKLIEMRMLLAPHGVEAVSAGELGLTEPEETEETFSGNARLKAQA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+ A +PA +DDSGLVID L G PGIH+ARWA     +RDF+MAM+K+E  L    A  
Sbjct: 63  AAQAANLPAFADDSGLVIDALGGAPGIHTARWAGP---DRDFEMAMEKVEAELEKVGAIA 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F+S L LAWPDGHVE F G V G +VWPPRG  GFGYDP+F P  Y +TF EM
Sbjct: 120 PEQRRARFVSALCLAWPDGHVEEFEGVVEGTLVWPPRGAKGFGYDPMFIPEDYPKTFAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           T +EK+                LSHRARAF      CL 
Sbjct: 180 TADEKHSMPPKGFG--------LSHRARAFLKLSQACLE 210


>gi|56694935|ref|YP_165280.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Ruegeria
           pomeroyi DSS-3]
 gi|62900156|sp|Q5LWF7|NTPA_SILPO RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|56676672|gb|AAV93338.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ruegeria pomeroyi DSS-3]
          Length = 204

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 104/218 (47%), Positives = 129/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R    + ++IA+HN  K+ EM  L+ P G+    A E+NL  PEET ++F  NA IK+  
Sbjct: 3   RAFDGDTLLIATHNKGKLEEMAHLLQPFGVKVVGAAEMNLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  +AL +K A  
Sbjct: 63  AARATGLPALSDDSGITIDALDGAPGVYTADWAETGNG-RDFLMAMTRAHDALEAKSAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P    A F   L LAWPDGH E F G   G +VWP RG  GFGYDP+F P GYD TF EM
Sbjct: 122 PRL--AQFRCTLVLAWPDGHDEVFEGVAPGHLVWPIRGAAGFGYDPMFVPEGYDVTFAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRARA + FV  C 
Sbjct: 180 DRWEKNK---------------ISHRARAVEKFVKGCF 202


>gi|126738498|ref|ZP_01754203.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter sp. SK209-2-6]
 gi|126720297|gb|EBA17003.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter sp. SK209-2-6]
          Length = 204

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 101/218 (46%), Positives = 132/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + I++A+HN  K+ E+  ++ P G+    A  ++L  PEET ++F  NA IK+  
Sbjct: 3   RKFEGDQILVATHNKGKLQEITEILAPYGVKVIGAAAMDLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  + + +K A  
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETGNG-RDFMMAMTRANDEITAKGADA 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  RSA F   L LAWPDGH E F G + G +VWP RG+ GFGYDP+F P+GYD T  EM
Sbjct: 122 P--RSAQFRCTLVLAWPDGHDEVFEGVMPGTLVWPIRGEGGFGYDPMFMPDGYDVTCAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            +EEKN                +SHR RA   FV  C 
Sbjct: 180 PKEEKNQ---------------ISHRGRAVSAFVQGCF 202


>gi|260429183|ref|ZP_05783160.1| Ham1 family protein [Citreicella sp. SE45]
 gi|260419806|gb|EEX13059.1| Ham1 family protein [Citreicella sp. SE45]
          Length = 203

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 102/218 (46%), Positives = 128/218 (58%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  L+ P G+      EL L  PEETG +F ENA IK+  
Sbjct: 3   RKFEGDRLLVATHNQGKLDEITDLLKPFGVSVVGNAELGLPEPEETGTTFVENARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+  G+PALSDDSG+ ID L G PG+++A WAE+  G RDF MAM +  + L +  A  
Sbjct: 63  AAQATGLPALSDDSGIAIDALGGAPGVYTADWAETGNG-RDFVMAMTRAHDELLASGAAQ 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P   +A F   L LAWPDGH E F G + G +VWP RG  G GYDP+FQP GYD TFGEM
Sbjct: 122 P--WTARFCCTLVLAWPDGHDEVFPGVMEGQVVWPMRGDQGHGYDPVFQPQGYDITFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRA AF  FV  C 
Sbjct: 180 DRWEKN---------------RISHRADAFAKFVKGCF 202


>gi|254475771|ref|ZP_05089157.1| Ham1 family protein [Ruegeria sp. R11]
 gi|214030014|gb|EEB70849.1| Ham1 family protein [Ruegeria sp. R11]
          Length = 204

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 92/218 (42%), Positives = 124/218 (56%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ EM  L+ P G+    A E+NL  PEET ++F  NA IK+  
Sbjct: 3   RKFEGDRLLVATHNKGKLEEMTHLLQPFGVTVVGAGEMNLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+  G        +        +  + 
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETGNGRDFMMAMTRAH---TELEAKNA 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F   L LAWPDGH E F G + G +VWP RG+ GFGYDP+FQP+G+++T  EM
Sbjct: 120 PYPRRAQFRCTLVLAWPDGHDEVFEGVMPGQLVWPIRGKDGFGYDPMFQPDGHEQTCAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHR +A   FV+ C 
Sbjct: 180 DRWEKNK---------------ISHRGQAVAKFVEACF 202


>gi|255264234|ref|ZP_05343576.1| Ham1 family protein [Thalassiobium sp. R2A62]
 gi|255106569|gb|EET49243.1| Ham1 family protein [Thalassiobium sp. R2A62]
          Length = 203

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 100/218 (45%), Positives = 130/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK  +  +++ASHN  KI E+ +L+ P G+   S ++ +L  PEET  +F  NA IK+  
Sbjct: 3   RKFGDKTLLVASHNAGKIEEIAALLEPFGVSIKSNIDFDLPEPEETETTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A++  G+PALSDDSG+ +D L G PG+++A WAE+  G RDF MAM +  N L +  A  
Sbjct: 63  ASQATGLPALSDDSGIEVDALGGAPGVYTADWAETENG-RDFPMAMTRTWNELDAINAPS 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R+A F S L LAWPDGH E F GK+ G +VWP RG+ G GYDPIF  +GYD T GEM
Sbjct: 122 P--RTARFKSTLVLAWPDGHDEVFDGKIEGQVVWPMRGKQGHGYDPIFMADGYDITMGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHRA A K  V  C 
Sbjct: 180 DRWEKNK---------------ISHRADALKKLVAACF 202


>gi|85706899|ref|ZP_01037989.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius sp. 217]
 gi|85668510|gb|EAQ23381.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius sp. 217]
          Length = 202

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 100/219 (45%), Positives = 130/219 (59%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRK  ++ +++A+HN  K+ E+ +L+ P G+    A  L L  P+ET  +F  NA IK+ 
Sbjct: 1   MRKFTDDRLLVATHNAGKLGEITALLAPYGVEVVGAAALGLAEPDETETTFLGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PALSDDSG+VID LDG PG+++A WAE+ TG RDF MAM +  +AL    + 
Sbjct: 61  AAARATGLPALSDDSGIVIDALDGAPGVYTADWAETETG-RDFGMAMHRAHDAL--VASK 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P   +A F   L LAWPDGH E F G   G +VWP RG  G GYDP+FQP G+D TF E
Sbjct: 118 QPQPWTARFCCTLVLAWPDGHDEVFEGTAEGWVVWPMRGAQGHGYDPMFQPLGHDVTFAE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                +SHRA AF+  V  C 
Sbjct: 178 MVPTEKN---------------RISHRADAFRKLVAGCF 201


>gi|254510867|ref|ZP_05122934.1| Ham1 family protein [Rhodobacteraceae bacterium KLH11]
 gi|221534578|gb|EEE37566.1| Ham1 family protein [Rhodobacteraceae bacterium KLH11]
          Length = 204

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 105/218 (48%), Positives = 132/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ EM  L+ P G+    A E+NL  P+ET ++F  NA IK+  
Sbjct: 3   RKFDSDRLLVATHNQGKLEEMTHLLEPFGVTIVGAGEMNLPEPDETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  NAL     + 
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETGNG-RDFLMAMTRAYNALE--AKNV 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R+A F S L LAWPDGH E F G   G +VWP RGQ GFGYDP+F P+GYD TF EM
Sbjct: 120 PHPRTAQFRSTLVLAWPDGHDEVFEGIAPGHLVWPIRGQGGFGYDPMFVPDGYDITFAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EKN                +SHR RA + FV  C 
Sbjct: 180 DRWEKNK---------------ISHRGRAVEMFVKGCF 202


>gi|259417925|ref|ZP_05741844.1| Ham1 family protein [Silicibacter sp. TrichCH4B]
 gi|259346831|gb|EEW58645.1| Ham1 family protein [Silicibacter sp. TrichCH4B]
          Length = 204

 Score =  171 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 98/218 (44%), Positives = 130/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  ++ P G+    A E+NL  PEET ++F  NA IK+  
Sbjct: 3   RKFEGDTLLVATHNAGKLGEITEILAPFGVKVVGAGEMNLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  + + +K    
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETGQG-RDFMMAMTRANDEITAKGPDA 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R+A F   L LAWPDGH E F G + G +VWP RG+ GFGYDP+F P GYD T  +M
Sbjct: 122 P--RTAQFRCTLVLAWPDGHDEVFEGVMPGRLVWPIRGEGGFGYDPMFMPEGYDVTCAQM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            + EKN                +SHR RA   FV  C 
Sbjct: 180 DKAEKN---------------RISHRGRALAQFVQGCF 202


>gi|114705079|ref|ZP_01437987.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Fulvimarina pelagi HTCC2506]
 gi|114539864|gb|EAU42984.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Fulvimarina pelagi HTCC2506]
          Length = 216

 Score =  171 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 104/208 (50%), Positives = 130/208 (62%), Gaps = 10/208 (4%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +++ASHN  KI E+  L+ P G   TSA E NL  PEETG ++E NA IK+L +    G+
Sbjct: 13  LLVASHNRGKIWEIRELMEPFGFEVTSAKEKNLEDPEETGTTYEANAEIKALASHNATGL 72

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
             LSDDSGL I+ L G PGI+SARWA     +RDF MAM+ +E  L++  A  P  R A 
Sbjct: 73  ACLSDDSGLSIEALSGDPGIYSARWAGP---DRDFSMAMRNVEEKLQAVGATTPEKRRAT 129

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F++VL LA P G    + G+V G +VWPPRG LGFGYDPIF P+G DRTFGEM   EK+ 
Sbjct: 130 FVAVLCLAMPSGETHLYRGEVHGQVVWPPRGDLGFGYDPIFLPDGLDRTFGEMMSLEKHA 189

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFVD 216
                  +     D LSHRARAF+ F  
Sbjct: 190 -------WKPGQPDALSHRARAFQKFAR 210


>gi|148553492|ref|YP_001261074.1| Ham1 family protein [Sphingomonas wittichii RW1]
 gi|148498682|gb|ABQ66936.1| Ham1 family protein [Sphingomonas wittichii RW1]
          Length = 209

 Score =  171 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 103/218 (47%), Positives = 128/218 (58%), Gaps = 17/218 (7%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +VIASHN  K+ E+  L+ P GI T SA  L +  PEETG SF  NA +K+  
Sbjct: 9   RKLAPGKLVIASHNKGKLREIAELLAPHGIETVSAGALGVPEPEETGTSFVANAELKARF 68

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           +A   G+PAL+DDSGL ++ L G+PGI SARWAE + G RDF   M+++   +       
Sbjct: 69  SADLTGLPALADDSGLCVEALGGEPGIFSARWAELDDGSRDFAEGMRRVHARMVEAGDEA 128

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
                AHFI  LS+AWPDGHVE F G+V G+I WPPRG  GFGYDPIFQP G+  +FGEM
Sbjct: 129 GHD--AHFICALSIAWPDGHVETFEGRVDGLITWPPRGDKGFGYDPIFQPLGHAASFGEM 186

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             E K+                +SHRA AF   V    
Sbjct: 187 DPEAKHA---------------MSHRADAFAKLVAAVF 209


>gi|99082711|ref|YP_614865.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Ruegeria
           sp. TM1040]
 gi|99038991|gb|ABF65603.1| Ham1-like protein [Ruegeria sp. TM1040]
          Length = 204

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 98/218 (44%), Positives = 132/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + +++A+HN  K+ E+  ++ P G+    A ELNL  PEET ++F  NA IK+  
Sbjct: 3   RKFNGDTLLVATHNEGKLGEITEILAPFGVKVVGAGELNLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+N G RDF  AM +  + + +K    
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETNNG-RDFMKAMTRANDEITAKGPDA 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R+A F   L LAWPDGH E F G ++G +VWP RG+ GFGYDP+F P GYD T  ++
Sbjct: 122 P--RTAQFRCTLVLAWPDGHDEVFEGVMAGSLVWPIRGEGGFGYDPMFMPEGYDVTCAQL 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            ++EKN                +SHR RA   FV  C 
Sbjct: 180 DKDEKN---------------RISHRGRALAKFVQGCF 202


>gi|163757815|ref|ZP_02164904.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Hoeflea
           phototrophica DFL-43]
 gi|162285317|gb|EDQ35599.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Hoeflea
           phototrophica DFL-43]
          Length = 217

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 111/212 (52%), Positives = 144/212 (67%), Gaps = 7/212 (3%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            I++ASHN  KI E+  L  PLG+  TSA ELNL  PEETG++FE NA  K+L AA  +G
Sbjct: 8   EILVASHNAGKIAEIRDLFGPLGVAVTSAAELNLPEPEETGDTFEANAATKALAAATASG 67

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             ALSDDSGL++D LDG PG+++A WA    G RDF +AMQK+E+AL+++ A   A R+ 
Sbjct: 68  KIALSDDSGLIVDALDGAPGVYTADWATLPDGSRDFAVAMQKVEDALQARGALTEAKRTG 127

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+S+L LA PDG V  + G+  G++VWPPRG  GFGYDP+F+P+G+ RTFGEMT EEK+
Sbjct: 128 RFVSMLCLATPDGDVSFYRGEADGVMVWPPRGTSGFGYDPVFRPDGHTRTFGEMTAEEKH 187

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           G        +       SHRARAFK F +  L
Sbjct: 188 GWKPGQATAT-------SHRARAFKLFAEQRL 212


>gi|323137090|ref|ZP_08072170.1| Ham1 family protein [Methylocystis sp. ATCC 49242]
 gi|322397851|gb|EFY00373.1| Ham1 family protein [Methylocystis sp. ATCC 49242]
          Length = 209

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 87/218 (39%), Positives = 125/218 (57%), Gaps = 12/218 (5%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            + I   +V+A+HN  K+ E+  L+ P G+   SA ++ L  PEET  +F  NA +K+  
Sbjct: 3   HRKISGKLVVATHNPGKLWELQQLLAPHGVDAVSAGDMALPEPEETEPTFRGNAALKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G+PA +DDSGL ++ LDG PGI+SARWA  N   +     +++            
Sbjct: 63  AAMASGLPAFADDSGLCVEALDGAPGIYSARWAGPNRDFKAACELVRQELE-----KRGA 117

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
                A+F   L++ WPDGH+E F G+V G++V+PP+G  GFGYDPIF+P+  D+TFGEM
Sbjct: 118 KPPYRANFTCALAIVWPDGHIEEFEGRVDGVLVFPPKGDKGFGYDPIFKPDELDKTFGEM 177

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EK+             +  LSHRARAF+     CL
Sbjct: 178 MSAEKHA-------LPGDGSRALSHRARAFQALAKACL 208


>gi|94496906|ref|ZP_01303480.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sphingomonas sp. SKA58]
 gi|94423582|gb|EAT08609.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sphingomonas sp. SKA58]
          Length = 209

 Score =  170 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 102/218 (46%), Positives = 136/218 (62%), Gaps = 20/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +VIASHN  K+ E+ +L+ P GI   SA  L+L  PEETG +F  NA +K++ 
Sbjct: 12  RKLQAGKLVIASHNAGKVREIAALLGPYGIEPISAGALDLPEPEETGTTFIANAELKAMQ 71

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G+PAL+DDSGL ++ L G PG+ SARWA     ++DF++AMQK+ + + +K    
Sbjct: 72  AADLSGLPALADDSGLCVEALGGDPGLFSARWAGP---DKDFNLAMQKVWDGIAAKGPDA 128

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
                AHF+  L+LAWPDGHVE F G+V G IVWPPRG  GFGYDP+FQP+G+D +FGEM
Sbjct: 129 GHD--AHFVCALALAWPDGHVEAFEGRVDGTIVWPPRGDKGFGYDPMFQPHGHDISFGEM 186

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             + K+                +SHRA AF   V    
Sbjct: 187 DPDAKHA---------------MSHRAHAFAQLVKAVF 209


>gi|90420651|ref|ZP_01228557.1| conserved hypothetical protein, Ham1 family [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334942|gb|EAS48703.1| conserved hypothetical protein, Ham1 family [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 214

 Score =  170 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 104/218 (47%), Positives = 136/218 (62%), Gaps = 12/218 (5%)

Query: 1   MRKLIENN--IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIK 58
           M +L   +  +++ASHN+ KI E+  L+ P G   TSA +  L  PEETG +FE NA +K
Sbjct: 1   MTRLDPKDGPLLVASHNIGKIWEIRELMEPFGFEVTSAKDKGLEDPEETGTTFEANAELK 60

Query: 59  SLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
           +L A +  G+ +LSDDSG+ ID L+G PGI+SARW      +RDF MAM+ +E  L++  
Sbjct: 61  ALAAMRATGLVSLSDDSGIAIDALNGDPGIYSARWGGP---DRDFAMAMRNVEEKLQAAG 117

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
           A  P  R A F++VL LA P G    F G+V G IVWPPRG+LGFGYDPIF P+G DRTF
Sbjct: 118 ATTPEQRRAKFVAVLCLADPAGGTHLFRGEVEGTIVWPPRGELGFGYDPIFLPDGSDRTF 177

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           GEM   EK+        +       +SHRARAF+ F  
Sbjct: 178 GEMMSAEKHA-------WKPGQPTAMSHRARAFQKFAR 208


>gi|90421848|ref|YP_530218.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodopseudomonas palustris BisB18]
 gi|90103862|gb|ABD85899.1| Ham1-like protein [Rhodopseudomonas palustris BisB18]
          Length = 211

 Score =  170 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 108/219 (49%), Positives = 133/219 (60%), Gaps = 11/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + I   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG+SF  NA IK++
Sbjct: 1   MHRRITGQLVIATHNPGKLAEMRELLAPYGIAAVSAGELKLAEPDETGDSFRANARIKAI 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA  A +PA +DDSGLV++ LDG PGI SARWA      +DF  AM +IE  L+ + A 
Sbjct: 61  AAANAAQLPAFADDSGLVVEALDGAPGIFSARWAGEG---KDFTSAMTRIERLLQERGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R AHF+S L +AWPDGH+E    +  G +VWPPRG  GFGYDP F P G+ RTFGE
Sbjct: 118 TSDQRKAHFVSALCVAWPDGHLEEVEARADGTLVWPPRGTAGFGYDPAFLPEGHVRTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT  EK+G               LSHRARAF    + CL
Sbjct: 178 MTSVEKHGLPPLGLG--------LSHRARAFVKLAEICL 208


>gi|154254012|ref|YP_001414836.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Parvibaculum lavamentivorans DS-1]
 gi|154157962|gb|ABS65179.1| Ham1 family protein [Parvibaculum lavamentivorans DS-1]
          Length = 201

 Score =  170 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 100/219 (45%), Positives = 128/219 (58%), Gaps = 21/219 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+     +V+ASHN  K+ E+  L+  L +   SA +L L  P+ETG +F ENA +K+L 
Sbjct: 3   RRFEGGKLVVASHNPGKVREIADLLASLNVEILSAADLGLAEPDETGETFRENAELKALA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK A +PALSDDSGL ++ L G PGI SARWA               +E   R      
Sbjct: 63  AAKTAQLPALSDDSGLCVEALGGAPGIFSARWAGPTKDFAF------AMEKLRRGMLETG 116

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P   SA+FI  L+LAWPDGHVE F G+V G +VWPPRG+ GFGYDP+F P+GY+ TFGEM
Sbjct: 117 PVDTSAYFICGLALAWPDGHVEYFEGRVDGDLVWPPRGEKGFGYDPVFVPHGYETTFGEM 176

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             + K+                +SHRA AF+  VD C R
Sbjct: 177 EPQAKH---------------DISHRAHAFRQLVDACFR 200


>gi|86136763|ref|ZP_01055341.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter sp. MED193]
 gi|85826087|gb|EAQ46284.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseobacter sp. MED193]
          Length = 204

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 99/218 (45%), Positives = 131/218 (60%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + I++A+HN  K+ E+  ++ P G+    A E++L  PEET ++F  NA IK+  
Sbjct: 3   RKFEGDQILVATHNAGKLQEITEILAPFGVKVVGAAEMDLPEPEETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  + + +K    
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETGNG-RDFMMAMTRANDEISAKGPDA 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  RSA F   L LAWPDGH E F G ++G +VWP RG+ GFGYDP+F P GYD T  +M
Sbjct: 122 P--RSAQFRCTLVLAWPDGHDEVFEGVMAGDLVWPIRGEGGFGYDPMFMPEGYDVTCAQM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            + EKN                +SHR RA   FV  C 
Sbjct: 180 DKAEKN---------------RISHRGRAVSAFVKGCF 202


>gi|83942033|ref|ZP_00954495.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sulfitobacter sp. EE-36]
 gi|83847853|gb|EAP85728.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sulfitobacter sp. EE-36]
          Length = 203

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 97/218 (44%), Positives = 129/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + I++A+HN  K+ EM  L  P G+    A E+NL  PEET N+F  NA IK+  
Sbjct: 3   RKFTGDQILVATHNAGKLQEMTELFAPFGVTVKGAAEMNLGEPEETENTFIGNARIKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A    G+PAL+DDSG+ ++ LD  PG+++A W+E+  G RDF MAM K    L    A  
Sbjct: 63  AVAATGLPALADDSGIEVEALDNAPGVYTADWSETPNG-RDFVMAMTKTHRLLEEANAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F + L L WPDGH E F G+V+G +VWP RG +G GYDP+FQP+G+D+TFGEM
Sbjct: 122 P--RRARFCATLVLVWPDGHEEVFEGRVNGTLVWPIRGDIGHGYDPMFQPDGHDQTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           + + KN                +SHRA AF   +  C 
Sbjct: 180 SADAKNA---------------ISHRADAFAKLISACF 202


>gi|83950768|ref|ZP_00959501.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius nubinhibens ISM]
 gi|83838667|gb|EAP77963.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Roseovarius nubinhibens ISM]
          Length = 202

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 96/219 (43%), Positives = 124/219 (56%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRK  ++ +++A+HN  K+ E+  L+ P G+    A E+ L  PEET +SF  NA IK+ 
Sbjct: 1   MRKFSDDRLLVATHNAGKLEEIAHLLEPYGVSVVGAAEMQLGEPEETEDSFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PAL+DDSGL I+ L G PG+++A WAE+  G RDF MAM K+ + L      
Sbjct: 61  AAAKATGLPALADDSGLSIEALGGAPGVYTADWAETPEG-RDFAMAMAKVHDLLE--NEQ 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
                 A F   L +AWPDGH E F G   G I+WPPRG  G GYDPIF P G++ +F E
Sbjct: 118 HAKPWRAKFCCTLVIAWPDGHDEVFEGIAPGEIIWPPRGDQGHGYDPIFLPEGHEISFAE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                +SHRA AF   V  C 
Sbjct: 178 MDRWEKN---------------RISHRADAFAKLVQGCF 201


>gi|220924629|ref|YP_002499931.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Methylobacterium nodulans ORS 2060]
 gi|219949236|gb|ACL59628.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylobacterium nodulans ORS 2060]
          Length = 210

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 106/220 (48%), Positives = 137/220 (62%), Gaps = 13/220 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M +L+   +VIA+HN  K+ EM  L+ P G+   SA EL+L  P ETG  F ENA IK+ 
Sbjct: 1   MARLLSGRVVIATHNSGKLKEMRELLAPFGVEAVSAGELDLPEPVETGTMFAENAAIKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           +AA   G+PA +DDSG+ ++ LDG PG+ SARWA    G +DF  AM +IE  L  + A 
Sbjct: 61  SAAAATGLPAFADDSGICVEALDGAPGLFSARWA---GGSKDFSAAMARIERELAQRGAT 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R AHF+S L +AWPDGH E F G+V G +VWPPRG LGFGYDP+F+P+    TFGE
Sbjct: 118 ---NRRAHFVSALVVAWPDGHEELFEGRVFGELVWPPRGTLGFGYDPMFKPDESPLTFGE 174

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           ++ EEK+            +   LSHRARAF     +CLR
Sbjct: 175 LSSEEKH-------GIDWENGRALSHRARAFLSLAASCLR 207


>gi|159046002|ref|YP_001534796.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Dinoroseobacter shibae DFL 12]
 gi|157913762|gb|ABV95195.1| nucleoside-triphosphatase [Dinoroseobacter shibae DFL 12]
          Length = 204

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 101/219 (46%), Positives = 129/219 (58%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M +  +  +++ASHN  KI E+  L+ P G+  TSA    L  PEET  +F  NA IK+ 
Sbjct: 1   MSRFKDKTLLVASHNKGKIEEIAHLLEPYGVRVTSAAAHGLSEPEETETTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PAL+DDSGL +  LDG PG+++A WAE+ TG RDF+MAM K+ +AL +K A 
Sbjct: 61  YAAKETGLPALADDSGLEVLALDGAPGVYTADWAETPTG-RDFEMAMVKVHDALIAKGAE 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P    A F   L LAWPDG    F G + G +VWP RG  G GYDP+FQP+GY +TFGE
Sbjct: 120 RP--WRARFCCTLVLAWPDGTDMVFPGTMKGQLVWPMRGSQGHGYDPMFQPDGYAQTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                +SHRA AF+     C 
Sbjct: 178 MDRWEKNK---------------VSHRADAFRKLTVACF 201


>gi|304392747|ref|ZP_07374687.1| Ham1 family protein [Ahrensia sp. R2A130]
 gi|303295377|gb|EFL89737.1| Ham1 family protein [Ahrensia sp. R2A130]
          Length = 218

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 105/223 (47%), Positives = 129/223 (57%), Gaps = 11/223 (4%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR L   NI++A+HNV K+ E   L+ P G+  TSA + +L  P E G +FEENA IK+ 
Sbjct: 1   MRALDTANIILATHNVGKLDEFRELVQPYGLTITSAADHDLPEPVEDGTTFEENAYIKAW 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAE-SNTGERDFDMAMQKIENALRSKFA 119
            AA   G  ALSDDSGL +  LDG PGI++A WAE  +   RDF  AM+K+E AL     
Sbjct: 61  AAASATGKVALSDDSGLCVAALDGDPGIYTADWAEKPDGSGRDFQYAMEKVEKALNDVGL 120

Query: 120 HDPAFRS--AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                 S   +F +VL L WPDGH E F G+  G +VWPPRG  GFGYDP+F+P G+ RT
Sbjct: 121 KSEDEASREGYFCAVLCLCWPDGHAEYFRGEAHGHLVWPPRGDSGFGYDPVFRPQGHTRT 180

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           FGEMT  EK+                LSHRARAF       L 
Sbjct: 181 FGEMTATEKHSWKPGEEG--------LSHRARAFGKLATALLE 215


>gi|83953082|ref|ZP_00961804.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sulfitobacter sp. NAS-14.1]
 gi|83842050|gb|EAP81218.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sulfitobacter sp. NAS-14.1]
          Length = 203

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 96/218 (44%), Positives = 129/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK   + I++A+HN  K+ EM  L  P G+    A E+NL  PEET N+F  NA IK+  
Sbjct: 3   RKFTGDQILVATHNAGKLQEMTELFAPFGVTVKGAAEMNLGEPEETENTFIGNARIKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A    G+PAL+DDSG+ ++ LD  PG+++A W+E+  G RDF MAM K    L    A  
Sbjct: 63  AVAATGLPALADDSGIEVEALDNAPGVYTADWSETPNG-RDFVMAMTKTHRLLEEANAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F + L L WPDGH E F G+V+G +VWP RG +G GYDP+FQP+G+++TFGEM
Sbjct: 122 P--RRARFCATLVLVWPDGHEEVFEGRVNGTLVWPIRGDIGHGYDPMFQPDGHEQTFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           + + KN                +SHRA AF   +  C 
Sbjct: 180 SADAKNA---------------ISHRADAFAKLISACF 202


>gi|114769781|ref|ZP_01447391.1| putative deoxyribonucleotide triphosphate pyrophosphatase [alpha
           proteobacterium HTCC2255]
 gi|114549486|gb|EAU52368.1| putative deoxyribonucleotide triphosphate pyrophosphatase [alpha
           proteobacterium HTCC2255]
          Length = 201

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 102/220 (46%), Positives = 131/220 (59%), Gaps = 20/220 (9%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL E  IV+ASHN  K+ E+  L+ P GI   SA +L L  PEET N++  NA IK+ 
Sbjct: 1   MRKLNEKQIVLASHNKGKLKEIGHLLKPFGISVISASDLGLDEPEETENTYAGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK +G PALSDDSG  +++LDG PG++SA WAE++ G R+F MAM KI + ++     
Sbjct: 61  FAAKASGKPALSDDSGFSVEILDGAPGVYSADWAETSNG-RNFSMAMSKIWDKIQHAEKP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
                 A F   L LAWPDGH E F G ++G I WPPRG  GFGYDP+F   G  +TFGE
Sbjct: 120 CK----AKFCCTLCLAWPDGHDELFEGSINGEIAWPPRGNNGFGYDPMFIAEGMHQTFGE 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           M   +K+               L+SHRA AFK  +    +
Sbjct: 176 MLPTDKH---------------LISHRADAFKKLIKTFEK 200


>gi|254440372|ref|ZP_05053866.1| Ham1 family [Octadecabacter antarcticus 307]
 gi|198255818|gb|EDY80132.1| Ham1 family [Octadecabacter antarcticus 307]
          Length = 202

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 97/219 (44%), Positives = 131/219 (59%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRK    +++IA+HN  K+ E+ +L+ P G++ +S  +  L  PEET  +F  NA IK+ 
Sbjct: 1   MRKFGGTDLLIATHNHGKLEEIANLLSPYGVVVSSNADHGLPEPEETETTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A K  G+PALSDDSG+ +D LDG PG+++A WAE+  G RDF  AM +  + L ++ A 
Sbjct: 61  AAVKATGLPALSDDSGITVDGLDGAPGVYTADWAETPDG-RDFVKAMTRTWDELDARGAT 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P  R A F   L LAWPDGH E F G + G +VWP RG  G GYDPIFQP+G+  TFGE
Sbjct: 120 EP--RVAQFRCCLVLAWPDGHDEVFEGMIPGRVVWPMRGDQGHGYDPIFQPDGFGVTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                ++HRA AF   ++ C 
Sbjct: 178 MDRFEKN---------------RINHRADAFTKLIEGCF 201


>gi|163737987|ref|ZP_02145403.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Phaeobacter gallaeciensis BS107]
 gi|163742617|ref|ZP_02150003.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Phaeobacter gallaeciensis 2.10]
 gi|161384202|gb|EDQ08585.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Phaeobacter gallaeciensis 2.10]
 gi|161388603|gb|EDQ12956.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Phaeobacter gallaeciensis BS107]
          Length = 204

 Score =  168 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 98/218 (44%), Positives = 130/218 (59%), Gaps = 18/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK + + +++A+HN  K+ EM  L+ P G+    A E++L  P ET ++F  NA IK+  
Sbjct: 3   RKFVGDRLLVATHNKGKLEEMKHLLQPFGVTVVGAGEMDLPEPAETEDTFVGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK  G+PALSDDSG+ ID LDG PG+++A WAE+  G RDF MAM +  N L +K A  
Sbjct: 63  AAKATGLPALSDDSGITIDALDGAPGVYTADWAETGDG-RDFMMAMTRAHNELEAKGAAH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P    A F   L LAWPDGH E F G + G +VWP RG+ GFGYDP+FQP+G+ +T  EM
Sbjct: 122 PRL--AQFRCTLVLAWPDGHDEVFEGVMPGQLVWPIRGKDGFGYDPMFQPDGHTQTCAEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
               KN                +SHR +A   FV+ C 
Sbjct: 180 DRWAKNK---------------ISHRGQAVAKFVEACF 202


>gi|254453444|ref|ZP_05066881.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Octadecabacter antarcticus 238]
 gi|198267850|gb|EDY92120.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Octadecabacter antarcticus 238]
          Length = 202

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 96/219 (43%), Positives = 130/219 (59%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+    +++IA+HN  K+ E+  L+ P G+  +S  +  L  PEET  +F  NA IK+ 
Sbjct: 1   MRRFDGTDLLIATHNHGKLVEIADLLSPYGVAVSSNADHGLPEPEETETTFVGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A K  G+PALSDDSG+ +D LDG PG+++A WAE++ G RDF  AM +  + L S+ A 
Sbjct: 61  AATKATGLPALSDDSGITVDGLDGAPGVYTADWAETSNG-RDFVKAMTRTWDELESRRAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P    A F   L LAWPDGH E F G + G +VWP RG  G GYDPIFQP+ +++TFGE
Sbjct: 120 EPRL--AQFRCCLVLAWPDGHDEVFEGVMPGRLVWPMRGDQGHGYDPIFQPDSFEQTFGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                +SHRA AF   ++ C 
Sbjct: 178 MDRFEKN---------------RISHRADAFAKLIEGCF 201


>gi|217978305|ref|YP_002362452.1| Ham1 family protein [Methylocella silvestris BL2]
 gi|217503681|gb|ACK51090.1| Ham1 family protein [Methylocella silvestris BL2]
          Length = 209

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 100/219 (45%), Positives = 132/219 (60%), Gaps = 12/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + IE  +V+A+HN  K+ EM  L+   G+   SA EL L  PEETG++F EN+ +K+L
Sbjct: 1   MVRAIEGRLVVATHNAGKLAEMRELLDHYGVKAVSAGELGLPEPEETGSTFLENSRLKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+ +  PAL+DDSGL +D L G+PGI+SARWA  +        A+++         A 
Sbjct: 61  AAAEGSASPALADDSGLCVDALGGEPGIYSARWAGPDRDFAIGRAAVEEALRV-----AG 115

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             A  +AHFI VL+LA+PDG   +F G+V G +V+PPRG L FGYDPIF P G  +TFGE
Sbjct: 116 AQAPFAAHFICVLTLAFPDGETSSFEGRVDGELVFPPRGSLVFGYDPIFLPEGLSKTFGE 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT EEK              +  LSHRARAF+ F   C 
Sbjct: 176 MTLEEKQA-------IPPDGSPALSHRARAFQAFAKACF 207


>gi|260753399|ref|YP_003226292.1| deoxyribonucleotide triphosphate pyrophosphatase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258552762|gb|ACV75708.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 209

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 100/219 (45%), Positives = 130/219 (59%), Gaps = 20/219 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L    +V+ASHN  K+ E+  L+ P G+ T SA EL L  P E G+SF  NA IK+  
Sbjct: 11  RRLEPGRLVLASHNQGKLREIRELLSPFGLETVSAAELGLPEPVEDGDSFIANAEIKARF 70

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            A+  G  AL+DDSGL ++ LD  PGI+SARWA      RDFD AM+K+   L +K A  
Sbjct: 71  VAEKTGSVALADDSGLCVEALDEAPGIYSARWAGEP---RDFDKAMEKVHQELTAKGAEA 127

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              + AHF+  LSL WPDGHVENF G V G ++WPPRG  GFGYDP+F  +G+ ++F E+
Sbjct: 128 S--KRAHFVCALSLCWPDGHVENFEGHVWGNLIWPPRGDRGFGYDPMFVADGHQQSFAEI 185

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             E K                 +SHR+ AFK  +  CLR
Sbjct: 186 GAEAKKA---------------ISHRSEAFKQLLAACLR 209


>gi|294011051|ref|YP_003544511.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sphingobium japonicum UT26S]
 gi|292674381|dbj|BAI95899.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sphingobium japonicum UT26S]
          Length = 209

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 102/218 (46%), Positives = 128/218 (58%), Gaps = 20/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +VIASHN  K+ E+  L+ P GI T SA  L+L  PEETG +F  NA +K++ 
Sbjct: 12  RKLGPGRLVIASHNPGKVREIGELLAPYGIETVSAAALDLPEPEETGTTFIANAELKAMQ 71

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G+PAL+DDSGL ++ L+G PGI SARWA         D  +         +    
Sbjct: 72  AADLSGLPALADDSGLCVEALNGDPGIFSARWAGP-----TKDFGIAMRLVWDNIQAKGP 126

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            A   AHFI  L+LAWPDGHVE F G+V G I+WPPRG  GFGYDPIFQP+G+D +FGEM
Sbjct: 127 EAGHGAHFICALALAWPDGHVEAFEGRVDGTIIWPPRGDRGFGYDPIFQPHGHDISFGEM 186

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             E+K+G               +SHRA AF   V    
Sbjct: 187 DPEKKHG---------------MSHRADAFAQLVAAVF 209


>gi|103485752|ref|YP_615313.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Sphingopyxis alaskensis RB2256]
 gi|98975829|gb|ABF51980.1| Ham1-like protein [Sphingopyxis alaskensis RB2256]
          Length = 210

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 99/219 (45%), Positives = 132/219 (60%), Gaps = 21/219 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +VIASHN  K+ E+ +L+ P G+   SA +L L  PEETG SF +NA++K+  
Sbjct: 6   RKLAPGKLVIASHNAGKVREIRALLAPYGVDPVSAADLGLPEPEETGTSFRDNALLKAHA 65

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE----RDFDMAMQKIENALRSK 117
           +A  +G+PAL+DDSGL +D L G+PG+++A WAE    E    RD+ +AM K+E  L  +
Sbjct: 66  SAAASGLPALADDSGLCVDALGGRPGVYTADWAERQWFEGNPGRDWYLAMGKVEGLLAEQ 125

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                  RSA F+  L+LAWPDGH E F G+V G + WPPRG+LGFGYDP+F P G   T
Sbjct: 126 GPD--VDRSARFVCTLALAWPDGHAEVFEGRVEGGLTWPPRGKLGFGYDPVFVPAGKTLT 183

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           F E+   EK+                +SHRA AF   V 
Sbjct: 184 FAEIEPAEKHA---------------ISHRADAFAKLVA 207


>gi|296114410|ref|ZP_06833064.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295979171|gb|EFG85895.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 205

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 98/214 (45%), Positives = 126/214 (58%), Gaps = 23/214 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + +V+ASHN  K+ E  +L+   GI   SA  LNL  PEET  +F  NA IK+L AA+ A
Sbjct: 13  DTLVLASHNAGKLVEFSALLSGYGIKVISAATLNLPEPEETATTFAGNAEIKALAAAQAA 72

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSG  +  L+G PGI SARWA     ++DF   M++I + +          R+
Sbjct: 73  GLPALADDSGFCVSALNGDPGILSARWAGP---DKDFPAVMRRIHDLMGDTPD-----RT 124

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A FISVL LAWPDG    F G++ G +VWPPRG  G GYDPIF P G   TF EMTE +K
Sbjct: 125 AWFISVLCLAWPDGQSTTFEGRIDGQVVWPPRGTHGHGYDPIFAPEGSPLTFAEMTETQK 184

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           N                +SHR RAF+ F + CL+
Sbjct: 185 N---------------TISHRGRAFRLFREGCLQ 203


>gi|161170277|gb|ABX59247.1| xanthosine triphosphate pyrophosphatase [uncultured marine
           bacterium EB000_55B11]
 gi|297183805|gb|ADI19928.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 201

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 101/220 (45%), Positives = 130/220 (59%), Gaps = 20/220 (9%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL E  IV+AS N  K+ E+  L+ P GI   SA +L L  PEET N++  NA IK+ 
Sbjct: 1   MRKLNEKQIVLASXNKGKLKEIGHLLKPFGISVISASDLGLDEPEETENTYAGNARIKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK +G PALSDDSG  +++LDG PG++SA WAE++ G R+F MAM KI + ++     
Sbjct: 61  FAAKASGKPALSDDSGFSVEILDGAPGVYSADWAETSNG-RNFSMAMSKIWDXIQHAEKP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
                 A F   L LAWPDGH E F G ++G I WPPRG  GFGYDP+F   G  +TFGE
Sbjct: 120 CK----AKFCCTLCLAWPDGHDELFEGSINGEIAWPPRGNNGFGYDPMFIAEGMHQTFGE 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           M   +K+               L+SHRA AFK  +    +
Sbjct: 176 MLPTDKH---------------LISHRADAFKKLIKTFEK 200


>gi|56550909|ref|YP_161748.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241762327|ref|ZP_04760407.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|62900165|sp|Q5NRL7|NTPA_ZYMMO RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|56542483|gb|AAV88637.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373121|gb|EER62760.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 209

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 101/219 (46%), Positives = 130/219 (59%), Gaps = 20/219 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L    +V+ASHN  K+ E+  L+ P G+ T SA EL L  P E GNSF  NA IK+  
Sbjct: 11  RRLEPGRLVLASHNQGKLREIRELLSPFGLETVSAAELGLPEPVEDGNSFIANAEIKARF 70

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            A+  G  AL+DDSGL ++ LD  PGI+SARWA      RDFD AM+K+   L +K A  
Sbjct: 71  VAEKTGSVALADDSGLCVEALDEAPGIYSARWAGEP---RDFDKAMEKVHQELTAKGAEA 127

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              + AHF+  LSL WPDGHVENF G V G ++WPPRG  GFGYDP+F  +G+ ++F E+
Sbjct: 128 S--KRAHFVCALSLCWPDGHVENFEGHVWGNLIWPPRGDRGFGYDPMFVADGHQQSFAEI 185

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             E K                 +SHR+ AFK  +  CLR
Sbjct: 186 GAEAKKA---------------ISHRSEAFKQLLAACLR 209


>gi|138896230|ref|YP_001126683.1| nucleoside-triphosphatase [Geobacillus thermodenitrificans NG80-2]
 gi|134267743|gb|ABO67938.1| Nucleoside-triphosphatase [Geobacillus thermodenitrificans NG80-2]
          Length = 204

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 72/221 (32%), Positives = 104/221 (47%), Gaps = 23/221 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              IVIA+ N  K+ E  ++    GI   S L+  ++   EETG++F ENA +K+    +
Sbjct: 1   MKEIVIATKNAGKVREFAAMFAKRGIEVKSLLDFPDVPDVEETGSTFVENAKLKAEAVCQ 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P ++DDSGL +D L G+PG+HSAR+A  +  +       + I   LR         
Sbjct: 61  RLQRPVIADDSGLAVDALGGRPGVHSARYAGEDKNDA------RNIAKLLRELDGVPMEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P            G I   PRG+ GFGYDP+F      +T  E+T E
Sbjct: 115 RTARFHCALAVAIPGQPTAIVEATCDGYIAEAPRGEGGFGYDPVFYLPERGKTMAELTPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI-DEK 224
           EKN                +SHRA+A +   +    I  EK
Sbjct: 175 EKNA---------------ISHRAKALEKLNEQWDEIMGEK 200


>gi|288956859|ref|YP_003447200.1| nucleoside-triphosphatase [Azospirillum sp. B510]
 gi|288909167|dbj|BAI70656.1| nucleoside-triphosphatase [Azospirillum sp. B510]
          Length = 204

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 98/219 (44%), Positives = 129/219 (58%), Gaps = 19/219 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+   + +VIASHN  K+ E+  L+ P     TSA EL L  PEETG+SF  NA +K+  
Sbjct: 5   RRFTGDTLVIASHNQGKVREIAELLGPYVATFTSAGELGLPEPEETGSSFIANAELKARA 64

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA    +   +DDSGLV+  L+G PGI+SARWA      +DF +AM+K+E+ L  +    
Sbjct: 65  AAAAGHVAL-ADDSGLVVPALNGDPGIYSARWAGPT---KDFALAMRKVEDGLAEQVKAG 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A+F+  LSLAWPDGHVE   G+  G +VWPPRG  GFGYDP+F P+G+  TFGEM
Sbjct: 121 RTDRGAYFVCALSLAWPDGHVETVEGRCHGTLVWPPRGPQGFGYDPMFLPDGHGLTFGEM 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
               K+                +SHRA AF+  V+ C R
Sbjct: 181 EPARKHE---------------MSHRADAFRQLVERCFR 204


>gi|196250188|ref|ZP_03148882.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. G11MC16]
 gi|196210372|gb|EDY05137.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. G11MC16]
          Length = 204

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 71/221 (32%), Positives = 103/221 (46%), Gaps = 23/221 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              IVIA+ N  K+ E  ++    GI   S L+  ++   EETG++F ENA +K+    +
Sbjct: 1   MKEIVIATKNAGKVREFAAMFAKRGIEVKSLLDFPDVPDVEETGSTFVENAKLKAEAVCQ 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P ++DDSGL +D L G+PG+HSAR+A  +  +       + I   L          
Sbjct: 61  RLQRPVIADDSGLAVDALGGRPGVHSARYAGEDKNDA------RNIAKLLHELDGVPMEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P            G I   PRG+ GFGYDP+F      +T  E+T E
Sbjct: 115 RTARFHCALAVAIPGQPTAIVEATCDGYIAEAPRGEGGFGYDPVFYLPERGKTMAELTPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI-DEK 224
           EKN                +SHRA+A +   +    I  EK
Sbjct: 175 EKNA---------------ISHRAKALEKLNEQWDEIMGEK 200


>gi|85374028|ref|YP_458090.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Erythrobacter litoralis HTCC2594]
 gi|84787111|gb|ABC63293.1| ham1 protein [Erythrobacter litoralis HTCC2594]
          Length = 209

 Score =  165 bits (418), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 96/220 (43%), Positives = 129/220 (58%), Gaps = 21/220 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L   ++VIA+HN  K+ E+ +L+ P G+   SA  L L  P ETG +F ENA+IK+  
Sbjct: 3   RRLGSGSLVIATHNAGKLKEISALLEPYGVKCISAGSLGLPEPAETGTTFVENALIKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE----RDFDMAMQKIENALRSK 117
           AA+ +GM AL+DDSGL +D L+G+PG+++A WAE    E    RD+ MAM K+E  L+  
Sbjct: 63  AAEASGMAALADDSGLSVDALEGRPGVYTADWAERQWFEGKPGRDWYMAMGKVEGMLQQL 122

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                    A F  VL+LAWPDG    + GK  G + WPPRG+LGFGYDP+F P G  +T
Sbjct: 123 GPDTDRN--AAFHCVLALAWPDGEHAIYEGKCPGSLTWPPRGKLGFGYDPVFVPTGRGQT 180

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           F E+  EEK+                +SHRA AF   V  
Sbjct: 181 FAEIDPEEKHA---------------ISHRADAFAKLVAK 205


>gi|260893785|ref|YP_003239882.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ammonifex degensii KC4]
 gi|260865926|gb|ACX53032.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ammonifex degensii KC4]
          Length = 196

 Score =  165 bits (418), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 101/215 (46%), Gaps = 22/215 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              IV+AS N  K+ E  +L+ PLG          +L   EETG +F  NA+IK+ T A 
Sbjct: 1   MRKIVLASRNEGKLREFKALLSPLGWEVIPLTSYPDLPEIEETGETFAANALIKARTVAF 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G  AL+DDSGL +D L+G PG+ SAR+A     +      +      L+         
Sbjct: 61  YTGEVALADDSGLEVDYLEGAPGVRSARFAGRQGDDAANIALL------LKLMEGVPWEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F  V+++  P+G      G V G I+  PRG+ GFGYDP+F    Y +TF E+  E
Sbjct: 115 RKACFRCVIAVVTPEGKEYLAEGTVEGYILEEPRGKGGFGYDPVFYLPEYGQTFAELPLE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            KN                +SHRARA     +   
Sbjct: 175 VKNQ---------------ISHRARALAKIKEILR 194


>gi|258541166|ref|YP_003186599.1| deoxyribonucleotide triphosphate pyrophosphatase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632244|dbj|BAH98219.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-01]
 gi|256635301|dbj|BAI01270.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-03]
 gi|256638356|dbj|BAI04318.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-07]
 gi|256641410|dbj|BAI07365.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-22]
 gi|256644465|dbj|BAI10413.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-26]
 gi|256647520|dbj|BAI13461.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-32]
 gi|256650573|dbj|BAI16507.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256653564|dbj|BAI19491.1| nucleoside-triphosphatase [Acetobacter pasteurianus IFO 3283-12]
          Length = 199

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 104/212 (49%), Positives = 126/212 (59%), Gaps = 24/212 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V+A+HN  K+ E  +L+   GI   SA ELNL  PEET  +F  NA IK+L AAK A 
Sbjct: 11  TLVLATHNAGKLAEFATLLADFGIKVVSAGELNLPEPEETATTFAGNAAIKALAAAKAAN 70

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSGL +  LDG PGI+SARWA  N   +DF  AM +IE  +          R+A
Sbjct: 71  LPALADDSGLCVAALDGAPGIYSARWAGPN---KDFAGAMARIEKEI------GQGERNA 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            FI VL LA PDG  E+F G++ G IVWPPRG  G GYDPIF P G  RTF EM + EKN
Sbjct: 122 WFICVLCLALPDGRTESFEGRIDGQIVWPPRGTQGHGYDPIFAPEGETRTFAEMADAEKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
                           +SHRARAF  F + CL
Sbjct: 182 A---------------ISHRARAFDTFKNACL 198


>gi|307294010|ref|ZP_07573854.1| Ham1 family protein [Sphingobium chlorophenolicum L-1]
 gi|306880161|gb|EFN11378.1| Ham1 family protein [Sphingobium chlorophenolicum L-1]
          Length = 209

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 99/218 (45%), Positives = 126/218 (57%), Gaps = 20/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +VIASHN  K+ E+ +L+ P GI T SA  L+L  P+ETG +F  NA +K++ 
Sbjct: 12  RKLGPGKLVIASHNPGKVREIGALLAPYGIETVSAGALDLPEPDETGTTFIANAELKAMQ 71

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G+PAL+DDSGL ++ L+G PGI SARWA         D  +         +    
Sbjct: 72  AADLSGLPALADDSGLCVEALNGDPGIFSARWAG-----EAKDFGLAMQLVWDNIQAKGP 126

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            A   AHFI  L+LAWPDGHVE F G+V G I WPPRG  GFGYDPIFQP+G+  +FGEM
Sbjct: 127 EAGHGAHFICALALAWPDGHVEAFEGRVDGTITWPPRGDQGFGYDPIFQPHGHAISFGEM 186

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             E+K+                +SHRA AF   V    
Sbjct: 187 EPEKKHA---------------MSHRADAFAQLVAAVF 209


>gi|182677772|ref|YP_001831918.1| Ham1 family protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633655|gb|ACB94429.1| Ham1 family protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 215

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 103/213 (48%), Positives = 130/213 (61%), Gaps = 12/213 (5%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + +VIA+HN  K+ EM  L+ P  I   SA EL L  PEETG +F  NA IK+  AA+ +
Sbjct: 9   DRLVIATHNAGKLREMRELLAPYRITAVSAGELRLPEPEETGATFIANAEIKAKAAAERS 68

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL ++ L G PGI+SARWA         D A      A+  + A  P    
Sbjct: 69  GLPALADDSGLCVEGLGGAPGIYSARWAG-----EGKDFAAAMSRIAMELEKAKVPPPHR 123

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A+F+S L+LA PDG +  F GKV GI+V+PPRG  GFGYDPIF P+GY+RTFGEM  EEK
Sbjct: 124 AYFVSALALALPDGTISTFEGKVFGILVFPPRGTRGFGYDPIFLPDGYERTFGEMEAEEK 183

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           +             +  LSHRARAF+ F   CL
Sbjct: 184 H-------GLPADGSQALSHRARAFQLFARACL 209


>gi|114326690|ref|YP_743847.1| xanthosine triphosphate pyrophosphatase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114314864|gb|ABI60924.1| xanthosine triphosphate pyrophosphatase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 205

 Score =  164 bits (414), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 102/223 (45%), Positives = 133/223 (59%), Gaps = 24/223 (10%)

Query: 2   RKL-IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           R+L   + +++A+HN  K+ E DSL+ P  I   SA  LNL  PEET + F  NA +K+L
Sbjct: 5   RRLNRNDTLILATHNAGKVREFDSLLKPWSITLVSAASLNLPEPEETASDFVGNARLKAL 64

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+ +G PAL+DDSG  +  L+G PGI SARWA     E+DF  AMQ+I +      A 
Sbjct: 65  AAAQVSGQPALADDSGFCVAALEGDPGIFSARWAGP---EKDFAAAMQRIHD-----LAG 116

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +   R A F+ VLSLAWPDGH ++F G+V G  VWPPRG  GFGYDP+F P G + T+GE
Sbjct: 117 EDEDRRAWFVCVLSLAWPDGHTDSFLGRVDGERVWPPRGTQGFGYDPMFIPRGGNLTYGE 176

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           +   EK+                 SHRARAF+ F   CL + E
Sbjct: 177 IAPAEKDAA---------------SHRARAFEQFAAACLPLAE 204


>gi|300024893|ref|YP_003757504.1| Ham1 family protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526714|gb|ADJ25183.1| Ham1 family protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 296

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 99/224 (44%), Positives = 135/224 (60%), Gaps = 23/224 (10%)

Query: 1   MRKLI-ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKS 59
           MR+L   + +V+ASHN  K+ E++ L+ P G+   SA +LNL  PEET  +F  NA +K+
Sbjct: 1   MRRLTHGSKLVVASHNPGKVWEINQLLAPYGLNAISAGDLNLSEPEETETTFAGNARLKA 60

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
           L AA+ +G+P+L+DDSGL +D LDG PGI+SARWA      +DF +AM+K+ + +  +  
Sbjct: 61  LAAAEGSGLPSLADDSGLEVDCLDGAPGIYSARWAGPG---KDFGIAMKKVADEISVRNG 117

Query: 120 HDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
             P    A+FISVL LAWPDG  + F GKV G +VWP RG  GFGYDP+F  +G  +TFG
Sbjct: 118 WGPPHPKANFISVLCLAWPDGETQIFEGKVFGHLVWPARGGNGFGYDPMFVADGESKTFG 177

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAF----KCFVDNCL 219
           EM   EK                 +SHR RAF       +D+  
Sbjct: 178 EMEPAEKYA---------------ISHRTRAFAVFQAAMLDHLK 206


>gi|74316496|ref|YP_314236.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Thiobacillus denitrificans ATCC 25259]
 gi|74055991|gb|AAZ96431.1| Ham1-like protein [Thiobacillus denitrificans ATCC 25259]
          Length = 199

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 63/218 (28%), Positives = 102/218 (46%), Gaps = 25/218 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + IVIAS N  K+ E+  ++ PL I      + ++    E   +F EN + K+  A+++
Sbjct: 1   MSKIVIASGNPGKLREIARILAPLEIEAVPQSDFDVPDCPEPHVTFVENCLAKARHASRH 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G+PAL+DDSG+ ++ L G PG+ SAR+A     +   +  +               + R
Sbjct: 61  SGLPALADDSGICVEALGGAPGVFSARYAGEPKSDARNNEKLIADLK--------GKSNR 112

Query: 126 SAHFISVLSLAWPDGHVENFS--GKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            AH+  V+         E     G+  G I+  PRG+ GFGYDP F    + +T  E+ E
Sbjct: 113 RAHYTCVMVYVRHPDDPEPVIAEGRWYGEIIDTPRGEKGFGYDPYFLVPEFGKTGAELDE 172

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           + KN                +SHR +A +  VD   R+
Sbjct: 173 DVKNA---------------VSHRGQALRDLVDKLKRL 195


>gi|162147172|ref|YP_001601633.1| deoxyribonucleotide triphosphate pyrophosphatase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209544227|ref|YP_002276456.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785749|emb|CAP55320.1| putative HAM1 protein homolog [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209531904|gb|ACI51841.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 205

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 100/213 (46%), Positives = 126/213 (59%), Gaps = 23/213 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + +V+ASHN  K+ E  +L+   GI   SA +L L  PEET  +F  NA +K+  AA+ +
Sbjct: 13  DRLVLASHNAGKLVEFSALLDGYGITVLSAGQLGLPEPEETAETFVGNAALKAHAAAQAS 72

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +  L G PGI+SARWA     E+DF  AM +I   +          RS
Sbjct: 73  GLPALADDSGLCVAALGGAPGIYSARWAGP---EKDFPGAMARIHEGIGDDPD-----RS 124

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+SVL LAWPDG + +F G++ G I WPPRG  G GYDP+F P G DRTF EM E EK
Sbjct: 125 AWFVSVLCLAWPDGTIRSFEGRIDGRITWPPRGTHGHGYDPVFTPEGRDRTFAEMPEAEK 184

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           N                +SHRARAF  F D CL
Sbjct: 185 N---------------TISHRARAFALFRDACL 202


>gi|329114776|ref|ZP_08243533.1| Nucleoside-triphosphatase [Acetobacter pomorum DM001]
 gi|326695907|gb|EGE47591.1| Nucleoside-triphosphatase [Acetobacter pomorum DM001]
          Length = 199

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 96/212 (45%), Positives = 117/212 (55%), Gaps = 24/212 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V+A+HN  K+ E  +L+   GI   SA  LNL  PEET  +F  NA IK+L AAK A 
Sbjct: 11  TLVLATHNAGKLAEFATLLADFGIKVVSAGALNLPEPEETATTFTGNAAIKALAAAKAAN 70

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSGL +  LD  PGI+SARWA  N         +++               R+A
Sbjct: 71  LPALADDSGLCVAALDSAPGIYSARWAGPNKDFAGAMARIEE---------GIGQGKRNA 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            FI VL LA PDG  E+F G++ G IVWPPRG  G GYDPIF P G  RTF EM + EKN
Sbjct: 122 WFICVLCLALPDGRTESFEGRIDGQIVWPPRGTHGHGYDPIFAPEGETRTFAEMADTEKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
                           +SHRARAF  F   CL
Sbjct: 182 A---------------ISHRARAFDAFKKACL 198


>gi|163797074|ref|ZP_02191029.1| hypothetical protein BAL199_11211 [alpha proteobacterium BAL199]
 gi|159177590|gb|EDP62143.1| hypothetical protein BAL199_11211 [alpha proteobacterium BAL199]
          Length = 209

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 92/218 (42%), Positives = 121/218 (55%), Gaps = 21/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK  +  +++ASHN  K+ E+  L+ P G+   SA +L L  P+ETG++F  NA +K+L 
Sbjct: 7   RKFTDKTLIVASHNSGKVREIGELLGPFGLEVVSAGDLGLPEPDETGDTFIANAELKALA 66

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  AG PAL+DDSG  +  L+G PGI+SARWA  +            +     +  A  
Sbjct: 67  AALAAGKPALADDSGFCVSALNGDPGIYSARWAGPSKDFSV------AMGKVWAAVEASG 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F   L+LAWPDGHVE   G V G  VWPPRG  GFGYDP+F P G+DRTFGE+
Sbjct: 121 STDRRAWFTCALTLAWPDGHVETVEGHVQGTAVWPPRGDHGFGYDPMFVPEGHDRTFGEV 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
               K+                +SHRA AF+  V+ C 
Sbjct: 181 DSAWKHS---------------VSHRAEAFRQLVERCF 203


>gi|114800076|ref|YP_761983.1| non-canonical purine NTP pyrophosphatase [Hyphomonas neptunium ATCC
           15444]
 gi|114740250|gb|ABI78375.1| non-canonical purine NTP pyrophosphatase [Hyphomonas neptunium ATCC
           15444]
          Length = 218

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 89/219 (40%), Positives = 116/219 (52%), Gaps = 21/219 (9%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M +L+   +V A+HN  K+ E+  L  P G    SALEL+L  PEET +SF  NA++K+ 
Sbjct: 20  MPRLVPGKLVAATHNRGKVSELKDLFAPHGFEVVSALELDLDEPEETEDSFSGNALLKAR 79

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA   G+PALSDDSGL +  L G+PGI+SARWA             + +E       A 
Sbjct: 80  AAALATGLPALSDDSGLAVTALGGQPGIYSARWAGEPRD------FYKAMEKVEAELKAS 133

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               RSA F+  L++ WPDG    + G+V G +VWPPRG  GFGYDP+F   G   TFGE
Sbjct: 134 GSQDRSAKFVCALAVVWPDGTQAVYEGEVHGTLVWPPRGDKGFGYDPVFVAEGETMTFGE 193

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M    K+                +SHRARA +      L
Sbjct: 194 MDPARKHA---------------MSHRARAVEKLRAALL 217


>gi|254462309|ref|ZP_05075725.1| Ham1 family [Rhodobacterales bacterium HTCC2083]
 gi|206678898|gb|EDZ43385.1| Ham1 family [Rhodobacteraceae bacterium HTCC2083]
          Length = 204

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 103/219 (47%), Positives = 133/219 (60%), Gaps = 18/219 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK  ++ ++IA+HN  K+ EM  L+ P G+    A E NL  PEET ++F  NA IK+  
Sbjct: 3   RKFSDDILLIATHNAGKLEEMRELLAPFGVSVVGATEKNLAEPEETEDNFIGNARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A K  G+PALSDDSG+ ++ L+ +PG+++A WAE+  G RDF MAM K  + L +  A  
Sbjct: 63  AVKATGLPALSDDSGIEVEALNNEPGVYTADWAETPNG-RDFVMAMTKTNDKLEAVNAPH 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P  R A F S L LAWPDGH E F GK +G +VWP RGQ+G GYDP+F P+GYD TFGEM
Sbjct: 122 P--RRARFCSTLVLAWPDGHDEVFEGKANGSLVWPMRGQIGHGYDPMFMPDGYDITFGEM 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             E+KN                +SHRA AF   V  C  
Sbjct: 180 AFEKKNE---------------ISHRADAFAKLVKGCFE 203


>gi|238752327|ref|ZP_04613806.1| Nucleoside-triphosphatase [Yersinia rohdei ATCC 43380]
 gi|238709488|gb|EEQ01727.1| Nucleoside-triphosphatase [Yersinia rohdei ATCC 43380]
          Length = 203

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 75/219 (34%), Positives = 108/219 (49%), Gaps = 23/219 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
                IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA
Sbjct: 5   FSMQKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAA 64

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G+PA++DDSGL +D L G PGI+SAR+A  +  ++      Q +E  L +       
Sbjct: 65  QITGLPAIADDSGLAVDALAGAPGIYSARYAGIDASDQ------QNLEKLLLALKDIPDE 118

Query: 124 FRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            RSA F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+
Sbjct: 119 QRSAQFHCVLVYMRHAQDPTPLVFHGQWPGVIARQPSGSAGFGYDPIFYVPELGKTAAEL 178

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           T EEK+                +SHR +A K  +D    
Sbjct: 179 TREEKHA---------------VSHRGQALKLMLDALRN 202


>gi|225848861|ref|YP_002729025.1| deoxyribonucleotide triphosphate pyrophosphatase
           [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643081|gb|ACN98131.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 211

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 105/219 (47%), Gaps = 19/219 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             I++A+ N  K+ E+ S++  L +   S  ++ N+I  EE   +F ENA+ K+   A  
Sbjct: 1   MKILVATTNEGKLREIKSILSDLDVELLSLKDMDNIIDVEEDRKTFLENAIKKATQYANF 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD--PA 123
             +P +++DSGL +D L+G PG++SAR+   + G +  D ++ K E              
Sbjct: 61  YKLPVIAEDSGLEVDALEGYPGVYSARFYSIDYGGKVEDESLSKDEKNNLKLLKLLEGKQ 120

Query: 124 FRSAHFISVLSLAWPDGHV-ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
            R   + +V+    P+  V     G   G I   P G  GFGYDPIF P GYD+T  ++ 
Sbjct: 121 NRKGRYKTVVVYYDPEKAVGIWTEGVCEGEIGKKPEGSGGFGYDPIFIPEGYDKTMAQLP 180

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            EEKN                +SHR +A     +  ++I
Sbjct: 181 PEEKNK---------------ISHRGKALNKLKELLIKI 204


>gi|58039734|ref|YP_191698.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Gluconobacter oxydans 621H]
 gi|62900144|sp|Q5FRF4|NTPA_GLUOX RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|58002148|gb|AAW61042.1| Nucleoside-triphosphatase [Gluconobacter oxydans 621H]
          Length = 208

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 93/220 (42%), Positives = 125/220 (56%), Gaps = 24/220 (10%)

Query: 1   MRKLI-ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKS 59
           MRKL   + IV+ASHN  K+ E  +L+   GI   SA EL+L  PEET  +F  NA IK+
Sbjct: 2   MRKLSPGSKIVLASHNAGKLREFSTLLAESGITVISAAELDLPEPEETEETFTGNAAIKA 61

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
           L AA+ +G+PAL+DDSG  +  LD +PG++SARW       +D  +AM+++   +     
Sbjct: 62  LAAARASGLPALADDSGFCVSALDNRPGVYSARWGGPT---KDMQVAMERVHREMGDNPD 118

Query: 120 HDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
                + A F++ L LAWPDG      G+  G +VWPPRG  G GYDP+F P G  RTF 
Sbjct: 119 -----QRAFFVAALCLAWPDGETRTVQGECHGTVVWPPRGDHGHGYDPMFVPEGESRTFA 173

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EM+E EKN                +SHR RA   F++ CL
Sbjct: 174 EMSEAEKNA---------------VSHRGRALTAFLNTCL 198


>gi|83313598|ref|YP_423862.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Magnetospirillum magneticum AMB-1]
 gi|82948439|dbj|BAE53303.1| HAM1 protein homolog [Magnetospirillum magneticum AMB-1]
          Length = 201

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 90/218 (41%), Positives = 116/218 (53%), Gaps = 23/218 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+     +VIASHN  K+ E+  L+ P G    SA  L L  PEETG++F  NA +K+  
Sbjct: 4   RRFQGGKLVIASHNAGKVREIGELLAPFGTEVVSAGALGLDEPEETGDTFVANAELKARA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G+P+L+DDSGL +D L G PGI+SARWA +          +       + +    
Sbjct: 64  AALASGLPSLADDSGLAVDALAGAPGIYSARWAGAAKDFAFAMAKVHTALGEEKDR---- 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
               +A F+  L+LAWPDGH E F G V G IVWPP+G+ GFGYDPIF P     TFGEM
Sbjct: 120 ----TARFVCALALAWPDGHCETFEGVVEGDIVWPPKGENGFGYDPIFLPKDGVLTFGEM 175

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
               K+                +SHRA AF   V  C 
Sbjct: 176 DAAAKHA---------------ISHRADAFAKLVAACF 198


>gi|23015828|ref|ZP_00055594.1| COG0127: Xanthosine triphosphate pyrophosphatase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 202

 Score =  161 bits (406), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 91/218 (41%), Positives = 116/218 (53%), Gaps = 23/218 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+     +VIASHN  K+ E+  L+ P G    SA  L L  PEETG++F  NA +K+  
Sbjct: 4   RRFQGGRLVIASHNAGKVREIGELLAPFGTEVVSAGALGLPEPEETGDTFVANAELKARA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G+P+L+DDSGL ++ L G PGI+SARWA            +Q      + +    
Sbjct: 64  AAAASGLPSLADDSGLAVNALAGAPGIYSARWAGQAKDFAFAMAKVQSALGEEKDR---- 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
               SA F+  L+LAWPDGH E F G V G IVWPP+G+ GFGYDPIF P     TFGEM
Sbjct: 120 ----SARFVCALALAWPDGHCETFEGVVEGDIVWPPKGENGFGYDPIFLPKDGILTFGEM 175

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
               K+                +SHRA AF   V  C 
Sbjct: 176 DAAAKHA---------------ISHRADAFTKLVAACF 198


>gi|281421638|ref|ZP_06252637.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella copri DSM 18205]
 gi|281404272|gb|EFB34952.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella copri DSM 18205]
          Length = 215

 Score =  161 bits (406), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 74/222 (33%), Positives = 110/222 (49%), Gaps = 24/222 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           +   IV A++N  K+ E+  ++     +++   +E ++ IPE TGN+ EENA+ K+    
Sbjct: 12  LMKRIVFATNNQHKLQEIRDILGSDYEVVSLKEIECDVDIPE-TGNTLEENALQKAQYVY 70

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
            +  +   +DD+GL ++ LDG PG+HSAR+AE    + D +  M K+   L  K      
Sbjct: 71  DHYHVSCFADDTGLEVEALDGAPGVHSARYAE--GTDHDSEANMAKLLRELDGKENRQAR 128

Query: 124 FRSAHFIS-----VLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
           FR+                    +  F G V+G I    RG  GFGYDPIF P GYD++F
Sbjct: 129 FRTVICYIEKQDVCPCGCTSIKKIHQFEGIVNGHIATEKRGTEGFGYDPIFVPEGYDQSF 188

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            E+ EE KNG               +SHRARA K  V+   +
Sbjct: 189 AELGEEIKNG---------------ISHRARAVKKLVEYLKK 215


>gi|134095310|ref|YP_001100385.1| putative HAM1 nucleoside-triphosphate diphosphatase [Herminiimonas
           arsenicoxydans]
 gi|133739213|emb|CAL62262.1| HAM1 protein homolog [Herminiimonas arsenicoxydans]
          Length = 194

 Score =  161 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 64/215 (29%), Positives = 102/215 (47%), Gaps = 21/215 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +++AS+N  K+ E  +L+ P+     +  E N+   EE   +F ENA+ K+  AA+
Sbjct: 1   MSRTLILASNNAGKLKEFSALLAPINFDLHTQSEFNVPEAEEPHVTFVENAIAKARHAAR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G PAL+DDSG+ ++ L G PG++SAR+A     ++  +      E  +    AH    
Sbjct: 61  LTGKPALADDSGVCVNALGGAPGVYSARYAGEPKSDQRNN------EKLIADLAAHADKS 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
              + + V      D       G+ +G ++  PRGQ GFGYDP F      +T  E+T E
Sbjct: 115 AYYYCVLVFVRHADDPQPVIADGRWNGEMLAEPRGQGGFGYDPYFWIPELQKTAAELTSE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EKN                LSHR +A +  ++   
Sbjct: 175 EKN---------------RLSHRGQALRALIEKLR 194


>gi|294085188|ref|YP_003551948.1| HAM1-like protein [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664763|gb|ADE39864.1| HAM1-like protein [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 204

 Score =  161 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 96/218 (44%), Positives = 127/218 (58%), Gaps = 21/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+  ++ +VIA+HN  K+ E+ + +    I   SA EL L  P+ET  SF  NA++K+  
Sbjct: 4   RRFTDSKLVIATHNPGKLPEIAAFLDGFDITLVSAGELGLDEPDETETSFTGNAILKARA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G+PAL+DDSGL +  L+G PGI+SARWA     ++DF MAM K+E+AL    A  
Sbjct: 64  AALASGLPALADDSGLAVVALNGDPGIYSARWAGQ---DKDFGMAMHKVEDAL---TATG 117

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F+  LS+ WPDGH E   G V G +VWPPRG  GFGYDPIF  +GYD TFGEM
Sbjct: 118 TTNRQAAFMCALSIVWPDGHDETVEGTVKGNLVWPPRGANGFGYDPIFVADGYDMTFGEM 177

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             + K+                + HRA AF   +  C 
Sbjct: 178 EPDIKHA---------------IGHRADAFAKLLQRCF 200


>gi|326387916|ref|ZP_08209522.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207962|gb|EGD58773.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 208

 Score =  161 bits (406), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 93/220 (42%), Positives = 127/220 (57%), Gaps = 21/220 (9%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M +L    +VIA+HN  K+ E+ +L+ P G+   SA EL L  P+ETG +F ENA++K+ 
Sbjct: 1   MPRLTPGKLVIATHNAGKLKEIRALLAPYGMDCISAGELGLPEPDETGTTFVENALLKAH 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE----RDFDMAMQKIENALRS 116
            AA+ A +PAL+DDSGL +  L G PG+++A WAE    E    RD+ MAM K+E  L  
Sbjct: 61  AAAQAANLPALADDSGLSVTALGGAPGVYTADWAEKGPREGGPGRDWYMAMGKVEGKLAE 120

Query: 117 KFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDR 176
                P    A F  VL++AWPDG    + G++ G + WPPRG+LGFGYDP+F   G+DR
Sbjct: 121 LGPDTPRD--AWFSCVLAIAWPDGGEAVYEGRIDGTLTWPPRGKLGFGYDPVFVARGHDR 178

Query: 177 TFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           TF E+   +K                 +SHRA AF   V 
Sbjct: 179 TFAELDPADK---------------QAISHRADAFAKLVA 203


>gi|145300322|ref|YP_001143163.1| HAM1 protein [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853094|gb|ABO91415.1| HAM1 protein [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 241

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 71/225 (31%), Positives = 108/225 (48%), Gaps = 28/225 (12%)

Query: 1   MRKL-----IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENA 55
           MR+L       N +V+A+ N  K+ E+ +++  + I      E  +   +ETG +F ENA
Sbjct: 34  MRRLFLRRCSMNKLVLATGNQKKVKELATMLADMKIQVIPQSEFAVPDADETGTTFVENA 93

Query: 56  MIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALR 115
           +IK+  AA+  G+PA++DDSGL +D+L G+PG++SAR+A +   ++      + I+  L 
Sbjct: 94  IIKARHAARITGLPAVADDSGLEVDLLHGRPGVYSARFAGAGASDK------ENIDKLLA 147

Query: 116 SKFAHDPAFRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNG 173
                    +SA F  VL       D           G+I+  PRGQ GFGYDP+F    
Sbjct: 148 ELKGAPDYLKSARFWCVLVYMRHADDPTPIICQASWEGMIIDEPRGQHGFGYDPVFFVPD 207

Query: 174 YDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           +D T  +M  E KN                LSHR +A        
Sbjct: 208 HDCTSAQMPSELKNQ---------------LSHRGQALTKLKAAL 237


>gi|253990757|ref|YP_003042113.1| deoxyribonucleotide triphosphate pyrophosphatase [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|211639088|emb|CAR67700.1| yggV HAM1-like protein [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253782207|emb|CAQ85371.1| yggV HAM1-like protein [Photorhabdus asymbiotica]
          Length = 198

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 76/216 (35%), Positives = 108/216 (50%), Gaps = 23/216 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +V+A+ N  K+ E+  L+   G+   +  ELN+   EETG +F ENA++K+  AA+
Sbjct: 1   MMQKVVLATGNPGKVRELAQLLADFGLDIVAQTELNVDSAEETGLTFIENAILKARHAAQ 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PA++DDSGL +D+L G PGI+SAR+A  N  ++      Q +E  L +        
Sbjct: 61  VTGLPAIADDSGLSVDILGGAPGIYSARYAGENASDQ------QNLEKLLDTMKDVPDDQ 114

Query: 125 RSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F  VL       D     F G+  GII   P G  GFGYDPIF       T  E+T
Sbjct: 115 RQAQFNCVLVYIRHAQDPTPLVFHGRWPGIIARKPTGNGGFGYDPIFYIPELGCTAAELT 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            E+KN                +SHR +A K  +D  
Sbjct: 175 GEQKNA---------------VSHRGQALKMMLDTL 195


>gi|170742382|ref|YP_001771037.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Methylobacterium sp. 4-46]
 gi|168196656|gb|ACA18603.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylobacterium sp. 4-46]
          Length = 210

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 101/219 (46%), Positives = 126/219 (57%), Gaps = 13/219 (5%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + +   +VIA+HN  K+ EM  L+ P G+   SA EL L  PEETG  F ENA IK+ 
Sbjct: 1   MGRRLTGRVVIATHNGGKLREMRELLAPFGVEAVSAGELGLAEPEETGVMFAENAAIKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA  AG+PA +DDSGL +D LDG PG+ SARWA  +          Q +E   R     
Sbjct: 61  AAASAAGLPAFADDSGLCVDALDGAPGLFSARWAGPSKD------FGQAMERVERELALR 114

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R AHF+S L LAWPDGH E F G+V G +VWPPRG  GFGYDP+F+P+    +FGE
Sbjct: 115 GATNRRAHFVSALVLAWPDGHEELFEGRVFGELVWPPRGSRGFGYDPMFKPDESPLSFGE 174

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           +  EEK+            +   LSHRARAF     +CL
Sbjct: 175 LGAEEKH-------GIDWANGRALSHRARAFLSLAASCL 206


>gi|296284092|ref|ZP_06862090.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Citromicrobium bathyomarinum JL354]
          Length = 208

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 85/217 (39%), Positives = 122/217 (56%), Gaps = 17/217 (7%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R++    +VIA+HN  K+ E+ +L+ P G+   SA  L L  P+ETG +F ENA++K+  
Sbjct: 3   RRIGSGKLVIATHNAGKLKEISALLAPYGVECISAGALGLPEPKETGTTFVENALLKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+++G+ +L+DDSGL +  LDG+PG+++A WAE    E +           +    A  
Sbjct: 63  AAESSGIVSLADDSGLSVAALDGRPGVYTADWAERQWFEGEPGRDWYMAMGKVEGLLAQQ 122

Query: 122 --PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
                RSA F   L+LAWPDG    + G   G + WPPRG+LGFGYDP+F PNG ++TF 
Sbjct: 123 GPDVDRSAAFHCTLALAWPDGEYAVYEGIAPGSLTWPPRGKLGFGYDPVFVPNGREQTFA 182

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           E+   EK+                +SHRA AF   V 
Sbjct: 183 EIEPAEKH---------------TISHRADAFAKLVA 204


>gi|269926915|ref|YP_003323538.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269790575|gb|ACZ42716.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 202

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 77/222 (34%), Positives = 113/222 (50%), Gaps = 22/222 (9%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTA 62
           +  + ++IAS N  K+ E   L+  LGI   S  +  +   PEETG++FEENA+IK+   
Sbjct: 1   MKLSKLLIASDNPGKLAEYQELLSGLGIEIVSMRDAGIERAPEETGSTFEENALIKARYC 60

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
               G+ +++DDSGL +  L G+PG+ S RWA     + + +  + +  N   S      
Sbjct: 61  WNMTGISSIADDSGLEVAALGGEPGVRSKRWAGEQISDAERNKLLIERLNKASSSNK--- 117

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
              SA F+ V++L    G+   F G+V G+I+  PRG  GFGYDPIF      +TF E+ 
Sbjct: 118 ---SARFVCVIALIDRYGNEHLFRGEVEGVIIDHPRGSHGFGYDPIFYLPELGKTFAELD 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
             EKN                +SHRARA +  VD   R  +K
Sbjct: 175 MLEKN---------------RVSHRARAAQLAVDWIKRNLDK 201


>gi|149184524|ref|ZP_01862842.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Erythrobacter sp. SD-21]
 gi|148831844|gb|EDL50277.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Erythrobacter sp. SD-21]
          Length = 208

 Score =  160 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 96/219 (43%), Positives = 132/219 (60%), Gaps = 21/219 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R++   ++VIA+HN  K+ E+ +L+ P G+   SA  L L  P ETG +F +NA++K+  
Sbjct: 3   RRIGSGSLVIATHNAGKLKEISALLDPYGVKCISAGSLGLPEPPETGTTFVQNALLKARA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE----RDFDMAMQKIENALRSK 117
           AA+ +G+PAL+DDSGL +D LDG+PG+++A WAE    E    RD+ MAM K+E  L+ K
Sbjct: 63  AAEASGLPALADDSGLSVDALDGRPGVYTADWAERQHFEGDPGRDWYMAMGKVEGMLQQK 122

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
            A     RS  F  VL+LAWPDG    + G   G + WPPRG+ GFGYDP+F P G D+T
Sbjct: 123 GAD--VDRSCAFHCVLALAWPDGEQVVYEGTAPGTLTWPPRGETGFGYDPVFVPKGRDQT 180

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           F E+  EEK+                +SHRA AF   V 
Sbjct: 181 FAEIAPEEKHA---------------ISHRADAFAKMVA 204


>gi|91774398|ref|YP_544154.1| Ham1-like protein [Methylobacillus flagellatus KT]
 gi|91708385|gb|ABE48313.1| Ham1-like protein [Methylobacillus flagellatus KT]
          Length = 202

 Score =  160 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 99/222 (44%), Gaps = 21/222 (9%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M  +    +VIAS N  K+ E+ +L+ PL I       LN+   EE   +F ENA+ K+ 
Sbjct: 1   MMGMPFQKLVIASGNQGKLKEIQTLLAPLSIEVLPQSALNVPEAEEPFVTFIENALAKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A++  G+PAL+DDSG+ ++ L G PG+HSAR+A     +   +         L+S    
Sbjct: 61  HASRYTGLPALADDSGICVNALQGAPGVHSARYAGEPKSDERNNQ------KLLQSLDGV 114

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
                  + + VL     D       G   G I+  PRG  GFGYDP+F      +T  E
Sbjct: 115 HDRHAYYYCVMVLVRHADDPQPLIAEGAWHGEILTAPRGSGGFGYDPLFLDAKTGQTAAE 174

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           ++ E KN                +SHR  A    V    R+ 
Sbjct: 175 LSAEIKN---------------RISHRGHALAKLVQQLERLA 201


>gi|325577280|ref|ZP_08147764.1| non-canonical purine NTP pyrophosphatase RdgB [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325160862|gb|EGC72983.1| non-canonical purine NTP pyrophosphatase RdgB [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 207

 Score =  160 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 70/221 (31%), Positives = 108/221 (48%), Gaps = 22/221 (9%)

Query: 1   MR-KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKS 59
           M+ K+++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+
Sbjct: 4   MKDKIMKQKIVLATGNKGKVKEMADVLADFGFEVIAQTDLGIESPEETGLTFVENAILKA 63

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
             A++ +G+PA++DDSGLV+D L+G PG++SAR+A  +  E       +  E  L     
Sbjct: 64  RYASEKSGLPAIADDSGLVVDALNGAPGLYSARYAGVDGDE----ADAKNREKLLAELAD 119

Query: 120 HDPAFRSAHF--ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                R A F    VL     D       G+  G I++  +G+ GFGYD +F     D T
Sbjct: 120 VPTERRQAKFVSTIVLLQHPSDPSPIIAQGECDGQIIYEEKGENGFGYDSLFFSPEKDCT 179

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           F E+   EK                 +SHRA+A        
Sbjct: 180 FAELETVEKKK---------------ISHRAKALAVLKSKL 205


>gi|238787375|ref|ZP_04631174.1| Nucleoside-triphosphatase [Yersinia frederiksenii ATCC 33641]
 gi|238724637|gb|EEQ16278.1| Nucleoside-triphosphatase [Yersinia frederiksenii ATCC 33641]
          Length = 210

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 73/217 (33%), Positives = 107/217 (49%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 14  MQKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQT 73

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A  +  ++      + +E  L +        R
Sbjct: 74  TGLPAIADDSGLAVDALGGAPGIYSARYAGIDASDQ------ENLEKLLVALKDIPDEQR 127

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 128 GAQFHCVLVYMRHAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPELGKTAAELTR 187

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 188 EEKHA---------------VSHRGQALKLMLDALRN 209


>gi|145589264|ref|YP_001155861.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047670|gb|ABP34297.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 196

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 59/213 (27%), Positives = 91/213 (42%), Gaps = 21/213 (9%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+AS+N  K+ E  +L+ PL        EL +   EE   +F ENA+ K+  A+  
Sbjct: 1   MKKLVLASNNAGKVREFQALLAPLNFQVIPQGELGIPSAEEPHYTFVENALAKARHASAA 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G+PAL+DDSG+    L G+PG+ SAR+A     +   +  +         + AH     
Sbjct: 61  SGLPALADDSGICAHALHGEPGVLSARYAGEQGDDAANNQKLIAALKEQSDREAHY---- 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
                 V+  +  D        +  G I+   +G  GFGYDP F       T  EM   +
Sbjct: 117 --VCALVMVRSENDPEPLIVQTRWYGKIIDEAKGSHGFGYDPFFFLPELQMTAAEMDPAQ 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN               L+SHR +A +  +   
Sbjct: 175 KN---------------LISHRGQALRELITQL 192


>gi|113866972|ref|YP_725461.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Ralstonia eutropha H16]
 gi|113525748|emb|CAJ92093.1| xanthosine triphosphate pyrophosphatase [Ralstonia eutropha H16]
          Length = 205

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 68/213 (31%), Positives = 99/213 (46%), Gaps = 18/213 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+AS+N  K+ E  +L+ PLG       EL +   EE   +F ENA+ K+  A++ 
Sbjct: 1   MQRLVLASNNAGKLREFGALLAPLGFDVVPQGELGIPEAEEPFATFVENALAKARHASRL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           AG+PAL+DDSG+ +  LDG PG++SAR+A+     R        + + L  K      + 
Sbjct: 61  AGLPALADDSGICVQALDGAPGVYSARYAQMAGQARSDAANNAHLVSQLAGKLNRHAHYY 120

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + V      D       G   G +V  PRG  GFGYDP F      +T  E++ EE
Sbjct: 121 ---CVLVFVRHAEDPCPIIAEGLWHGEVVDAPRGAGGFGYDPHFLLPHLGKTAAELSPEE 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN                +SHRA+A +  V   
Sbjct: 178 KN---------------TVSHRAQALRALVARL 195


>gi|311278129|ref|YP_003940360.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Enterobacter cloacae SCF1]
 gi|308747324|gb|ADO47076.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Enterobacter cloacae SCF1]
          Length = 197

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 74/217 (34%), Positives = 108/217 (49%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  ELN+   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELNVESAEETGLTFLENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  +R      Q +E  L +      A R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGVDATDR------QNLEKLLVALKDVPDAQR 114

Query: 126 SAHFIS--VLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F    V      D       G+  G+I   P G  GFGYDPIF   G  +T  E+T 
Sbjct: 115 QAQFHCALVYLRHAEDPTPIVCLGRWPGVITHAPSGNGGFGYDPIFYVPGEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  ++    
Sbjct: 175 EEKSA---------------ISHRGQALKQLLNALRN 196


>gi|238763265|ref|ZP_04624230.1| Nucleoside-triphosphatase [Yersinia kristensenii ATCC 33638]
 gi|238698538|gb|EEP91290.1| Nucleoside-triphosphatase [Yersinia kristensenii ATCC 33638]
          Length = 197

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 108/217 (49%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKIVLATGNPGKVRELANLLADFGLDVIAQTELGVESAEETGLTFIENAILKARHAAQT 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D LDG PGI+SAR+A     ++      + +E  L +      A R
Sbjct: 61  TGLPAIADDSGLAVDALDGAPGIYSARYAGIEASDQ------ENLEKLLVALKDIPNAQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 GAQFHCVLVYMRHAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPELGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKHA---------------VSHRGQALKLMLDALRN 196


>gi|220932374|ref|YP_002509282.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Halothermothrix orenii H 168]
 gi|219993684|gb|ACL70287.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Halothermothrix orenii H 168]
          Length = 202

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 72/216 (33%), Positives = 102/216 (47%), Gaps = 22/216 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +++AS N  KI E+   +  L I      + +L   EE G +F ENA+ K+ T A+
Sbjct: 1   MPLKLLVASGNQGKIREIKKYLNDLDIEIVGLDDFSLPPVEEDGETFYENALKKARTRAR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+  L+DDSGL +D L GKPG++SAR+A +   + D +         L          
Sbjct: 61  ETGLLTLADDSGLEVDYLQGKPGVYSARYAGAGASDEDNNK------KLLEELKGVPAGQ 114

Query: 125 RSAHFISVLSLAWPD-GHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           R A F  V+ L  P+ G   + +G   GII+  PRG  GFGYDP+F    Y +T  E+T 
Sbjct: 115 RGARFKCVMVLYDPELGEDISVTGSCEGIIMEKPRGDNGFGYDPLFYVPEYGKTMAELTL 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           E KN                +SHRARA         
Sbjct: 175 ETKNK---------------ISHRARALSKIKKVIK 195


>gi|283835285|ref|ZP_06355026.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Citrobacter youngae ATCC 29220]
 gi|291068443|gb|EFE06552.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Citrobacter youngae ATCC 29220]
          Length = 197

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 103/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVVAQTDLGVDSAEETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL ++ L G PGI+SAR++  +  +R      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVNALGGAPGIYSARYSGEDATDR------QNLEKLLHTLQDVPDDKR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGK--VSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL                   G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 QAQFHCVLVYMRHADDPTPVVCHGSWPGVIAHEPAGNGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLDALRN 196


>gi|225575047|ref|ZP_03783657.1| hypothetical protein RUMHYD_03129 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037717|gb|EEG47963.1| hypothetical protein RUMHYD_03129 [Blautia hydrogenotrophica DSM
           10507]
          Length = 201

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 71/219 (32%), Positives = 109/219 (49%), Gaps = 22/219 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSL 60
           R+ +   I+ A+ N  K+ E+  ++  L +   S  E  +     E G+SFEENA+IK+ 
Sbjct: 4   RRRLMKRIIFATGNEGKMREIRRIMEDLDVEIFSLKEAGIQADIVEDGSSFEENAVIKAK 63

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           T  +      L+DDSGL ID L+G+PGI+SAR+   +T  R  +  +             
Sbjct: 64  TVCELTNEVVLADDSGLEIDYLNGEPGIYSARYMGEDTSYRIKNQNLIDRL------AGV 117

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R+A F+  ++ A+PDG V+   G + GII +  RG+ GFGYDPIF    Y  +  E
Sbjct: 118 PQEKRTARFVCAVAAAYPDGTVKTARGTMEGIIGYEERGENGFGYDPIFFLPEYGCSSAE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           ++ EEKN                +SHR +A +   +  L
Sbjct: 178 LSMEEKNK---------------ISHRGKALEAIKEVLL 201


>gi|325981264|ref|YP_004293666.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Nitrosomonas sp. AL212]
 gi|325530783|gb|ADZ25504.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Nitrosomonas sp. AL212]
          Length = 200

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 63/213 (29%), Positives = 102/213 (47%), Gaps = 21/213 (9%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +VIAS+N  K+ E+ +L+ PL I      + ++    E   +F ENA+ K+  A++ +
Sbjct: 5   KQLVIASNNQGKLREISALLEPLTITVVPQSDFDVSEVNEPYGTFVENALTKARHASRCS 64

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSG+ +  L+G PG++SAR+A     +   +  + +       + A+      
Sbjct: 65  GLPALADDSGICVQALNGAPGVNSARYAGEPKSDARNNQKLIETLTQQTDRRAYY----- 119

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
            + + VL     D       G   G I+ PPRG+ GFGYDP F    + +T  E+  E+K
Sbjct: 120 -YCVIVLLRHADDPQPIIVDGSWHGEIIDPPRGEGGFGYDPYFYLPEFGKTSAELAAEQK 178

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           N                +SHR +A    VD   
Sbjct: 179 N---------------RISHRGQALAKLVDILR 196


>gi|194289072|ref|YP_002004979.1| deoxyribonucleotide triphosphate pyrophosphatase [Cupriavidus
           taiwanensis LMG 19424]
 gi|193222907|emb|CAQ68912.1| Nucleoside-triphosphate diphosphatase [Cupriavidus taiwanensis LMG
           19424]
          Length = 205

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 68/213 (31%), Positives = 99/213 (46%), Gaps = 18/213 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+AS+N  K+ E  +L+ PLG    +  EL +   EE   +F ENA+ K+  A++ 
Sbjct: 1   MRRLVLASNNPGKLREFGALLAPLGFDVVTQGELGIPEAEEPFATFVENALAKARHASRL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           AG+PAL+DDSG+ +  LDG PG++SAR+A+     R        + + L  K      + 
Sbjct: 61  AGLPALADDSGICVQALDGAPGVYSARYAQMAGQARSDTANNAYLVSQLAGKLNRHAYYY 120

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + V      D       G   G +V  PRG  GFGYDP F      +T  E+  EE
Sbjct: 121 ---CVLVFVRHAEDPCPIIAEGVWHGEVVDAPRGAGGFGYDPHFLLPALGKTAAELPPEE 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN                +SHRA+A +  V   
Sbjct: 178 KN---------------RVSHRAQALRALVARL 195


>gi|310817157|ref|YP_003965121.1| Ham1 family protein [Ketogulonicigenium vulgare Y25]
 gi|308755892|gb|ADO43821.1| Ham1 family protein [Ketogulonicigenium vulgare Y25]
          Length = 202

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 96/218 (44%), Positives = 127/218 (58%), Gaps = 19/218 (8%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L    +++A+HN  K+ E+ +L+   G+   S  + NL  P E+G +F ENA IK+  
Sbjct: 3   RRLERAKLLVATHNRGKLDEIRALLDVFGMDIVSNADFNLPEPVESGTTFVENARIKAHA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            AK  G+P L+DDSGL I+ LDG PG+++A W+E   G RDF MAM ++ + LR+  A  
Sbjct: 63  GAKATGLPTLADDSGLSIEALDGAPGVYTADWSEGPNG-RDFVMAMARVHDELRATGAAT 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
           P    A F   L LAWPDGH E F G+V G IV  PRG+ G GYDPIF P+G   TFGEM
Sbjct: 122 P--WRAKFCCTLVLAWPDGHDEVFEGEVHGQIV-APRGEHGHGYDPIFLPDGMTETFGEM 178

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            + EKN                +SHRA AF+  V  C 
Sbjct: 179 DQIEKN---------------FISHRANAFEKLVKGCF 201


>gi|253701666|ref|YP_003022855.1| nucleoside-triphosphatase [Geobacter sp. M21]
 gi|251776516|gb|ACT19097.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacter sp. M21]
          Length = 201

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 70/216 (32%), Positives = 106/216 (49%), Gaps = 22/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              +++AS N  K+ E + L+  +     S  +   L   EE G+SFE NA+ K+ +AA 
Sbjct: 1   MKELLVASGNKGKLREFEKLLEGVVETILSPADFPGLPEVEEDGDSFEANALKKARSAAL 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G P L+DDSGL +D L G+PG++SAR+A    G+   +  +      L+         
Sbjct: 61  FTGKPVLADDSGLCVDCLGGRPGVYSARFAGEGAGDAANNALL------LQEMAGAPREE 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+  F  V++L   DG  + F G + G I+  PRG+ GFGYDP+F    Y +TF E+  E
Sbjct: 115 RTGAFHCVIALCLHDGSCQTFDGMLKGEILEAPRGEGGFGYDPLFLVPEYGQTFSELPME 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            KN                +SHR RA +   +   +
Sbjct: 175 IKNA---------------ISHRGRAMQMLKEALQK 195


>gi|238798801|ref|ZP_04642271.1| Nucleoside-triphosphatase [Yersinia mollaretii ATCC 43969]
 gi|238717372|gb|EEQ09218.1| Nucleoside-triphosphatase [Yersinia mollaretii ATCC 43969]
          Length = 197

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 74/217 (34%), Positives = 109/217 (50%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKIVLATGNPGKVRELASLLADFGLDVVAQTELGVESAEETGLTFIENALLKARHAAQM 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A ++  ++      + ++  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALAGAPGIYSARFAGTDASDQ------ENLDKLLVTLKDVPDGQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 SAQFHCVLVYMRHADDPTPLVFHGQWPGVIAHQPAGTAGFGYDPIFYVPELGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKHA---------------VSHRGQALKLMLDALRN 196


>gi|226328808|ref|ZP_03804326.1| hypothetical protein PROPEN_02708 [Proteus penneri ATCC 35198]
 gi|225201994|gb|EEG84348.1| hypothetical protein PROPEN_02708 [Proteus penneri ATCC 35198]
          Length = 200

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 72/218 (33%), Positives = 110/218 (50%), Gaps = 23/218 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA+IK+  AAK
Sbjct: 3   LMQKVVLATGNPGKVKELASLLSDFGLDIVAQTELGVDSVEETGLTFVENALIKARHAAK 62

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PA++DDSG+ +D L G PGI+SAR+A  +  ++     + K+ NA++   A     
Sbjct: 63  VTGLPAIADDSGISVDALGGAPGIYSARYAGIDASDQ---QNLDKLLNAMKDIPAE---K 116

Query: 125 RSAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F  VL     +       F G   G++     G+ GFGYDPIF     + T  ++T
Sbjct: 117 RQAQFNCVLVYMRHENDPTPLIFHGIWHGVLSTEMHGEGGFGYDPIFFVPELNCTAAQLT 176

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +E+KN                 SHR +A K  +D    
Sbjct: 177 KEQKNQH---------------SHRGKALKLMLDALKN 199


>gi|170749349|ref|YP_001755609.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Methylobacterium radiotolerans JCM 2831]
 gi|170655871|gb|ACB24926.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylobacterium radiotolerans JCM 2831]
          Length = 209

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 102/219 (46%), Positives = 124/219 (56%), Gaps = 14/219 (6%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + +   +VIA+HN  K+ EM  L+ P GI   SA EL L  P+ETG  F ENA IK+ 
Sbjct: 1   MSRRLTGKVVIATHNAGKLTEMRELLAPFGIEAVSAGELGLPEPDETGTLFAENAAIKAQ 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G+PA +DDSGL +D LDG PGI SARWA            +    +        
Sbjct: 61  AAAEATGLPAFADDSGLCVDALDGAPGIFSARWAGPTKDFAGAMARIFAELDR------R 114

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             A R AHF+S L LAWPDGH E F G+V G +V   +G  GFGYDPIF+P+G+DRTFGE
Sbjct: 115 GAADRRAHFVSALVLAWPDGHTELFEGRVFGDLV-AAKGSAGFGYDPIFRPDGHDRTFGE 173

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           MT EEK+                LSHRARAF      CL
Sbjct: 174 MTAEEKH-------GVDWQKGRGLSHRARAFVELSRACL 205


>gi|225027841|ref|ZP_03717033.1| hypothetical protein EUBHAL_02101 [Eubacterium hallii DSM 3353]
 gi|224954788|gb|EEG35997.1| hypothetical protein EUBHAL_02101 [Eubacterium hallii DSM 3353]
          Length = 199

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 66/216 (30%), Positives = 105/216 (48%), Gaps = 22/216 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTA 62
           +++  ++ A+ N  K+ E+  ++  L     S  E  +     E G +FEENA+IK+ T 
Sbjct: 5   ILKKKLIFATGNKGKMKEIREILGDLDYEILSMKEAGVDVDIVEDGTTFEENAIIKAKTV 64

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            +  G   L+DDSGL +D L+ +PG++SAR+   NT  R  +  +    +          
Sbjct: 65  MEATGSLVLADDSGLEVDYLNKEPGVYSARYMGENTSYRIKNQIILDRLH------GVPD 118

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             RSA F+ V++ A+PDG VE     + G I   P G+ GFGYDPIF      +T  +++
Sbjct: 119 IVRSARFVCVIAAAFPDGRVETRRATIEGRIAQEPAGENGFGYDPIFYLPEKGKTTAQLS 178

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            EEKN                +SHR +A +   +  
Sbjct: 179 AEEKNE---------------ISHRGKALRQIKEIL 199


>gi|82701202|ref|YP_410768.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Nitrosospira multiformis ATCC 25196]
 gi|82409267|gb|ABB73376.1| Ham1-like protein [Nitrosospira multiformis ATCC 25196]
          Length = 197

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 67/215 (31%), Positives = 100/215 (46%), Gaps = 21/215 (9%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +VIAS+N  K+ E+  L+ PLGI        +    EE   +F ENA+ K+  A+KN
Sbjct: 1   MQKLVIASNNAGKLREIRLLLEPLGIEVLPQSAFDFPEAEEPHCTFVENALAKARHASKN 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PAL+DDSG+ +++L GKPGI SAR+A     +   +  + +       + A+     
Sbjct: 61  TGLPALADDSGICVNILGGKPGILSARYAGEPKSDERNNQRLVEALQNQSDRRAYY---- 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             + +  L     D       G   G I+  PRG  GFGYDP F     D+T  E+  E+
Sbjct: 117 --YCVIALLRHPEDPRPIIADGSWHGEILLNPRGNGGFGYDPYFFLANLDKTAAELPMEQ 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           KN                +SHR +A    V+   +
Sbjct: 175 KN---------------RISHRGKALAQLVERIRQ 194


>gi|212638434|ref|YP_002314954.1| nucleoside-triphosphatase [Anoxybacillus flavithermus WK1]
 gi|212559914|gb|ACJ32969.1| Inosine triphosphate pyrophosphatase [Anoxybacillus flavithermus
           WK1]
          Length = 211

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 73/223 (32%), Positives = 110/223 (49%), Gaps = 22/223 (9%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLT 61
           +     I++A+ N  K+ E   L    GI   S L  + +   EETG +F ENA++K+ T
Sbjct: 6   RSKMKRIIVATKNKGKVAEFQQLFSKKGIDVLSLLAYDDIPDVEETGTTFSENAILKATT 65

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            A       ++DDSGL++D L+G+PG++SAR+A     ++        IE  L+      
Sbjct: 66  IANMLHETVIADDSGLIVDALNGEPGVYSARYAGEGKNDQ------ANIEKVLKKLQGVP 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F   L++A P+G V    G   G I   P G+ GFGYDPIF      RT  ++
Sbjct: 120 FEQRTARFHCTLAVAKPNGDVTTVDGVCEGYITEEPVGENGFGYDPIFFVPEKQRTMAQL 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           T+EEKN                +SHRA+A +  +    ++ EK
Sbjct: 180 TKEEKNE---------------ISHRAKALQHLLHIWDKLFEK 207


>gi|87200078|ref|YP_497335.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87135759|gb|ABD26501.1| Ham1-like protein [Novosphingobium aromaticivorans DSM 12444]
          Length = 209

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 87/216 (40%), Positives = 118/216 (54%), Gaps = 17/216 (7%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           +L    +VIA+HN  K+ E+ +L+ P GI   SA  L L  P ETG +F ENA+IK+  A
Sbjct: 5   RLGSGKLVIATHNSGKLKEIQALLAPYGIECLSAGALGLPEPAETGTTFVENALIKARAA 64

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH-- 120
           A+ + +PAL+DDSGL +D L G PG+++A WAE++  E             +  K A   
Sbjct: 65  AEASQIPALADDSGLCVDALGGAPGVYTADWAEADVFEGGPRRDWYMAMGKVEGKLAELG 124

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R  HF  VL++AWPDG    + G+  G + WPPRG +GFGYDP+F P G  RTF E
Sbjct: 125 PETPRDCHFACVLAIAWPDGESVVYEGRAPGTLTWPPRGTMGFGYDPVFVPVGDTRTFAE 184

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +   EK+                +SHRA AF   V 
Sbjct: 185 LAPAEKHA---------------ISHRADAFAKLVA 205


>gi|238759332|ref|ZP_04620498.1| Nucleoside-triphosphatase [Yersinia aldovae ATCC 35236]
 gi|238702493|gb|EEP95044.1| Nucleoside-triphosphatase [Yersinia aldovae ATCC 35236]
          Length = 197

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 74/217 (34%), Positives = 111/217 (51%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+ +L+   G+   +  EL++   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKIVLATGNPGKVRELANLLADFGLDVVAQTELSVESAEETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A ++  ++      + +E  L +      A R
Sbjct: 61  TGLPAMADDSGLAVDALGGAPGIYSARYAGTDASDQ------ENLEKLLVALKDVPEAQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 AAQFHCVLVYMRHAQDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPELGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKHA---------------VSHRGQALKLMLDTLRN 196


>gi|238786242|ref|ZP_04630188.1| Nucleoside-triphosphatase [Yersinia bercovieri ATCC 43970]
 gi|238712857|gb|EEQ04923.1| Nucleoside-triphosphatase [Yersinia bercovieri ATCC 43970]
          Length = 197

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 72/217 (33%), Positives = 106/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKIVLATGNPGKVRELASLLADFGLDVVAQTDLGVESVEETGLTFIENAILKARHAAQT 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A ++  ++     +      +          R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARFAGADASDQQNLDKLLVTLKNI------PDEQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 SAQFHCVLVYMRHGDDPTPLVFHGQWPGVIARQPAGSAGFGYDPIFYLPELGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKHA---------------VSHRGQALKMMLDALRN 196


>gi|30248296|ref|NP_840366.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Nitrosomonas europaea ATCC 19718]
 gi|62900272|sp|Q82XJ3|NTPA_NITEU RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|30138182|emb|CAD84188.1| Ham1 family [Nitrosomonas europaea ATCC 19718]
          Length = 203

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 65/217 (29%), Positives = 98/217 (45%), Gaps = 21/217 (9%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            N IVIAS+N  K+ E+  L+ PLGI   +   L +   +E   +F ENA+ K+  A+  
Sbjct: 1   MNKIVIASNNAGKLAEISRLLAPLGIEVVTQSSLGVTEADEPHMTFVENALAKARHASLA 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PAL+DDSG+ +  L G PG+ SAR+A     +   +  + +  +    + A+     
Sbjct: 61  TGLPALADDSGICVSALRGDPGVFSARYAGEPRSDERNNRKLVEALHGQSDRRAYY---- 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             + + VL     D           G I+  P GQ GFGYDP F      +T  E++ EE
Sbjct: 117 --YCVIVLLRHGQDPQPVIIEDTWRGEIIAEPIGQGGFGYDPHFFLPELGKTAAELSIEE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           KN                +SHR +A    V      +
Sbjct: 175 KN---------------RISHRGKALARLVQMLSENE 196


>gi|89067430|ref|ZP_01154943.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanicola granulosus HTCC2516]
 gi|89046999|gb|EAR53053.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanicola granulosus HTCC2516]
          Length = 202

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 96/219 (43%), Positives = 127/219 (57%), Gaps = 18/219 (8%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MR+     +++A+HN  K+ E+  L+ P G+  TS  +  L  PEET  +F  NA IK+ 
Sbjct: 1   MRRFTGTELIVATHNRGKLEEIADLLSPYGVSLTSNADHELPEPEETEETFVGNARIKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A    G+PAL+DDSG+ ++ LDG PG+H+A WAE+  G RDF+MAM ++   L +  A 
Sbjct: 61  AAVAATGLPALADDSGISVEALDGAPGVHTADWAETPDG-RDFEMAMTRVWRELEALDAP 119

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +P  R A F   L LAWPDGH E F G + G IVWP RG  G G+DPIFQP G+D T GE
Sbjct: 120 EP--RRAAFRCTLVLAWPDGHDEMFEGVLPGRIVWPMRGTQGHGFDPIFQPEGHDVTLGE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M   EKN                +SHR RAF+  +  C 
Sbjct: 178 MDRWEKN---------------RISHRGRAFEQLIAGCF 201


>gi|51597527|ref|YP_071718.1| deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pseudotuberculosis IP 32953]
 gi|153948234|ref|YP_001399810.1| deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pseudotuberculosis IP 31758]
 gi|62900193|sp|Q666N1|NTPA_YERPS RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|51590809|emb|CAH22455.1| possible Xanthosine triphosphate pyrophosphatase [Yersinia
           pseudotuberculosis IP 32953]
 gi|152959729|gb|ABS47190.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia
           pseudotuberculosis IP 31758]
          Length = 197

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 73/216 (33%), Positives = 108/216 (50%), Gaps = 23/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQT 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A ++  ++      + +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQ------ENLEKLLAALQNVPEEKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 GAQFHCVLVYMRHAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPALGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EEK+                +SHR +A K  +D   
Sbjct: 175 EEKHA---------------VSHRGQALKLMLDALR 195


>gi|312114383|ref|YP_004011979.1| Ham1 family protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311219512|gb|ADP70880.1| Ham1 family protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 207

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 94/210 (44%), Positives = 122/210 (58%), Gaps = 18/210 (8%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           +VIA+HN  K+ E + L  P+G+   S+  L L  PEETG +F ENA +K++  A   G 
Sbjct: 12  LVIATHNKGKVREFEDLCAPMGVSVVSSAVLGLPEPEETGTTFAENARLKAVATAVATGK 71

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
            +L DDSGL +D LDG PGI+SARWA      RDF  AM+++E  L ++ A  P  R A 
Sbjct: 72  ISLGDDSGLAVDALDGAPGIYSARWAGEP---RDFGAAMRRVEAELVARGATAPDARRAQ 128

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F+ VL LA P G V+ F G V+G +VWPPRG  GFG+DP+F  +G D TFGEM    K+ 
Sbjct: 129 FVCVLCLANPAGEVQFFEGTVAGHLVWPPRGTNGFGFDPMFVADGRDITFGEMDPAAKHA 188

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                          +SHRA AF  F D  
Sbjct: 189 ---------------ISHRANAFAAFKDAL 203


>gi|290476323|ref|YP_003469227.1| 6-N-hydroxylaminopurine mutagenesis regulatory protein [Xenorhabdus
           bovienii SS-2004]
 gi|289175660|emb|CBJ82463.1| putative protein controls HAP (6-N-hydroxylaminopurine) mutagenesis
           (Ham1) [Xenorhabdus bovienii SS-2004]
          Length = 197

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 73/217 (33%), Positives = 106/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+  L+   G+   +  EL +   +ETG +F ENA+IK+  AA  
Sbjct: 1   MQKIVLATGNAGKVRELADLLTDFGLDIVAQTELGVDSADETGLTFIENAIIKARHAAAI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL ++ L G PGI+SAR+A  +  +R        +E  L +        R
Sbjct: 61  TGLPAIADDSGLSVNALGGAPGIYSARYAGIDASDR------DNLEKLLEAMRDIPDEKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+ SGII   P G  GFGYDPIF    +  T  E++ 
Sbjct: 115 QAQFNCVLVYLRHAEDPTPLIFHGRWSGIITHEPAGNGGFGYDPIFYVPEFGCTAAELSH 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           E+K+                +SHR +A K  ++  L 
Sbjct: 175 EQKSA---------------VSHRGQALKMLLEAMLN 196


>gi|170023076|ref|YP_001719581.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pseudotuberculosis YPIII]
 gi|169749610|gb|ACA67128.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Yersinia pseudotuberculosis YPIII]
          Length = 197

 Score =  158 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 73/216 (33%), Positives = 108/216 (50%), Gaps = 23/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQT 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A ++  ++      + +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQ------ENLEKLLAALQNVPDEKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 GAQFHCVLVYMRHAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPALGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EEK+                +SHR +A K  +D   
Sbjct: 175 EEKHA---------------VSHRGQALKLMLDALR 195


>gi|238020107|ref|ZP_04600533.1| hypothetical protein VEIDISOL_01988 [Veillonella dispar ATCC 17748]
 gi|237863631|gb|EEP64921.1| hypothetical protein VEIDISOL_01988 [Veillonella dispar ATCC 17748]
          Length = 191

 Score =  158 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 106/214 (49%), Gaps = 24/214 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALE-LNLIIPEETGNSFEENAMIKSLTAAK 64
              IV+A+ N  KI E       L I      + +++  PEETG +F ENA++K+   AK
Sbjct: 1   MEQIVLATGNKGKIREFSEAFSHLSIDCVPVKDVISIDEPEETGTTFMENALLKARYYAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSG+ +D L+G PG++SAR+A  +  ++  +  + +             + 
Sbjct: 61  ATNRPCLADDSGITVDALNGAPGVYSARYAGHHGDDQANNEKLIREL--------QGKSD 112

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+ H++  L+L +PDG      G   G++   P+G  GFGYDP F    +++T  E++ E
Sbjct: 113 RTGHYVCALALVYPDGREVTAEGYCDGLVQDEPKGDNGFGYDPYFYVPEFEKTMAELSIE 172

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK               + +SHR RA +  ++  
Sbjct: 173 EK---------------ETISHRGRALRKLINKL 191


>gi|240137078|ref|YP_002961547.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Methylobacterium extorquens AM1]
 gi|240007044|gb|ACS38270.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Methylobacterium extorquens AM1]
          Length = 211

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 101/219 (46%), Positives = 128/219 (58%), Gaps = 14/219 (6%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            +++   +VIA+HN  K+ EM  L+ P G+   SA EL L  P+ETG  F ENA IK+  
Sbjct: 4   HRILSGKVVIATHNAGKLVEMRELLAPFGVEAVSAGELGLPEPDETGTMFSENAAIKAHA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK +G+PA +DDSGL +D LDG PG+ SARWA  +         +    +         
Sbjct: 64  AAKASGLPAFADDSGLCVDALDGAPGLFSARWAGPDKDFSGAMARIAAELDT------RG 117

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R AHF+S L LAWPDGH E F G+V G +V  PRG LGFGYDP+F+P G DRTFGE+
Sbjct: 118 ATDRRAHFVSALVLAWPDGHTELFEGRVFGDLV-APRGSLGFGYDPMFRPEGMDRTFGEI 176

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           + EEK+            S + LSHRARAF      CLR
Sbjct: 177 SSEEKH-------GVDWQSGNALSHRARAFVQLAQACLR 208


>gi|162419754|ref|YP_001604772.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis Angola]
 gi|162352569|gb|ABX86517.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           Angola]
          Length = 219

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 73/216 (33%), Positives = 108/216 (50%), Gaps = 23/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 23  MQKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQT 82

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A ++  ++      + +E  L +        R
Sbjct: 83  TGLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQ------ENLEKLLVALQNVPDEKR 136

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 137 GAQFHCVLVYMRHAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPALGKTAAELTR 196

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EEK+                +SHR +A K  +D   
Sbjct: 197 EEKHA---------------VSHRGQALKLMLDALR 217


>gi|165937309|ref|ZP_02225873.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166010358|ref|ZP_02231256.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166212659|ref|ZP_02238694.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167421956|ref|ZP_02313709.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167426705|ref|ZP_02318458.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|270487543|ref|ZP_06204617.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Yersinia pestis KIM D27]
 gi|294502892|ref|YP_003566954.1| deoxyribonucleotide triphosphate pyrophosphatase [Yersinia pestis
           Z176003]
 gi|21960274|gb|AAM86881.1|AE013934_4 putative ribosomal protein [Yersinia pestis KIM 10]
 gi|45438103|gb|AAS63651.1| Xanthosine triphosphate pyrophosphatase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|165914783|gb|EDR33396.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165990844|gb|EDR43145.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166205951|gb|EDR50431.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166960093|gb|EDR56114.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167054308|gb|EDR64127.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|270336047|gb|EFA46824.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Yersinia pestis KIM D27]
 gi|294353351|gb|ADE63692.1| deoxyribonucleotide triphosphate pyrophosphatase [Yersinia pestis
           Z176003]
          Length = 223

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 73/216 (33%), Positives = 108/216 (50%), Gaps = 23/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 27  MQKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQT 86

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A ++  ++      + +E  L +        R
Sbjct: 87  TGLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQ------ENLEKLLVALQNVPDEKR 140

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 141 GAQFHCVLVYMRHAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPALGKTAAELTR 200

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EEK+                +SHR +A K  +D   
Sbjct: 201 EEKHA---------------VSHRGQALKLMLDALR 221


>gi|108806317|ref|YP_650233.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis Antiqua]
 gi|108813302|ref|YP_649069.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis Nepal516]
 gi|145597877|ref|YP_001161953.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis Pestoides F]
 gi|149367046|ref|ZP_01889079.1| hypothetical protein YPE_2324 [Yersinia pestis CA88-4125]
 gi|161484757|ref|NP_670630.2| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis KIM 10]
 gi|161511311|ref|NP_994774.2| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis biovar Microtus str. 91001]
 gi|165925126|ref|ZP_02220958.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|167399887|ref|ZP_02305405.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167468164|ref|ZP_02332868.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           FV-1]
 gi|218928117|ref|YP_002345992.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis CO92]
 gi|229837638|ref|ZP_04457800.1| dITP/XTP pyrophosphatase [Yersinia pestis Pestoides A]
 gi|229840864|ref|ZP_04461023.1| dITP/XTP pyrophosphatase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229842575|ref|ZP_04462730.1| dITP/XTP pyrophosphatase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229903765|ref|ZP_04518878.1| dITP/XTP pyrophosphatase [Yersinia pestis Nepal516]
 gi|22653761|sp|Q8ZHF4|NTPA_YERPE RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|108776950|gb|ABG19469.1| hypothetical protein YPN_3142 [Yersinia pestis Nepal516]
 gi|108778230|gb|ABG12288.1| hypothetical protein YPA_0320 [Yersinia pestis Antiqua]
 gi|115346728|emb|CAL19611.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145209573|gb|ABP38980.1| hypothetical protein YPDSF_0570 [Yersinia pestis Pestoides F]
 gi|149290660|gb|EDM40736.1| hypothetical protein YPE_2324 [Yersinia pestis CA88-4125]
 gi|165923326|gb|EDR40477.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|167050595|gb|EDR62003.1| non-canonical purine NTP pyrophosphatase RdgB [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|229679535|gb|EEO75638.1| dITP/XTP pyrophosphatase [Yersinia pestis Nepal516]
 gi|229690885|gb|EEO82939.1| dITP/XTP pyrophosphatase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229697230|gb|EEO87277.1| dITP/XTP pyrophosphatase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229704326|gb|EEO91337.1| dITP/XTP pyrophosphatase [Yersinia pestis Pestoides A]
 gi|262364868|gb|ACY61425.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pestis D182038]
 gi|320013973|gb|ADV97544.1| dITP/XTP pyrophosphatase [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 197

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 73/216 (33%), Positives = 108/216 (50%), Gaps = 23/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQT 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A ++  ++      + +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQ------ENLEKLLVALQNVPDEKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 GAQFHCVLVYMRHAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPALGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EEK+                +SHR +A K  +D   
Sbjct: 175 EEKHA---------------VSHRGQALKLMLDALR 195


>gi|295399426|ref|ZP_06809408.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|312110015|ref|YP_003988331.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. Y4.1MC1]
 gi|294978892|gb|EFG54488.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|311215116|gb|ADP73720.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. Y4.1MC1]
          Length = 201

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 66/217 (30%), Positives = 101/217 (46%), Gaps = 22/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              ++IA+ N  K  E  +L+   G+   S L+  +    EETG++F ENA++K+   A+
Sbjct: 1   MKQVIIATKNAGKTREFQALLAKKGVEVKSLLDFPDCPDVEETGSTFAENAILKAEAMAR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL ID L G+PG++SAR+A     ++      + I   L          
Sbjct: 61  YFHTTVIADDSGLAIDALHGRPGVYSARYAGEEKDDQ------KNIAKVLEELKGVPLEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P            G I   P+G+ GFGYDPIF      +T  E+++E
Sbjct: 115 RTARFHCALAVAAPGRRTAVVEATCEGYIAEEPKGENGFGYDPIFYVPQKGKTMAELSKE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EKN                +SHRA+A     +    I
Sbjct: 175 EKNQ---------------ISHRAKALAKLEEQWDEI 196


>gi|213962603|ref|ZP_03390864.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Capnocytophaga sputigena Capno]
 gi|213954598|gb|EEB65919.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Capnocytophaga sputigena Capno]
          Length = 193

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 64/213 (30%), Positives = 98/213 (46%), Gaps = 26/213 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAKN 65
             +V A+HN  K+ E+ +L+ P  I   S  ++       ET  + E NA++K     K+
Sbjct: 1   MKLVFATHNQHKLREIQALL-PSNIQLLSLDDIGCDEDIPETATTIEGNALLKVQYIQKH 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                 +DD+GL +  L+  PG++SAR+A  +  + D           L  +     + R
Sbjct: 60  YHCNVFADDTGLEVQALNNAPGVYSARYAGEHKSDAD--------NMQLLLRNMEGISHR 111

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F +V++L         F G   G I   P G  GFGYDPIF P   D+TF E+T++E
Sbjct: 112 EAQFKTVIALCLEGVV-YTFEGIAKGNIGTTPIGTNGFGYDPIFIPENSDKTFAELTQDE 170

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN                +SHR +AF+  +D  
Sbjct: 171 KN---------------CISHRGKAFEKLLDFL 188


>gi|186896651|ref|YP_001873763.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           pseudotuberculosis PB1/+]
 gi|186699677|gb|ACC90306.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Yersinia pseudotuberculosis PB1/+]
          Length = 197

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 73/216 (33%), Positives = 107/216 (49%), Gaps = 23/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQT 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A ++  ++        +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQ------DNLEKLLVALQNVPEEKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 GAQFHCVLVYMRHAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVPALGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EEK+                +SHR +A K  +D   
Sbjct: 175 EEKHA---------------VSHRGQALKLMLDALR 195


>gi|83589384|ref|YP_429393.1| Ham1-like protein [Moorella thermoacetica ATCC 39073]
 gi|83572298|gb|ABC18850.1| Ham1-like protein [Moorella thermoacetica ATCC 39073]
          Length = 201

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 77/218 (35%), Positives = 107/218 (49%), Gaps = 22/218 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAA 63
           + N +V+A+ N  K  E   L+  LG+   + L+     +P ETG++F +NA+ K+   A
Sbjct: 1   MINKLVLATKNAGKAREFRELLQDLGVEIETLLDFPGFNLPPETGSTFVDNALFKARLTA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
              G+PAL DDSGL +D L+G PG++SAR+A   T +R  +         L+        
Sbjct: 61  SMTGLPALGDDSGLEVDFLEGAPGVYSARFAGEPTDDRRNNA------KLLQLMEGVPWE 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F  VL+L   DG      G + G+I   PRG  GFGYDP+F    YD T  E+  
Sbjct: 115 RRTARFRCVLALVTEDGDTHLAEGTLEGLIATEPRGHQGFGYDPLFYLPEYDLTLAELGG 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           E KN                LSHRARA K       R+
Sbjct: 175 EVKNK---------------LSHRARAVKKMWPILRRL 197


>gi|17546879|ref|NP_520281.1| deoxyribonucleotide triphosphate pyrophosphatase [Ralstonia
           solanacearum GMI1000]
 gi|22653756|sp|Q8XXF4|NTPA_RALSO RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|17429179|emb|CAD15867.1| putative xanthosine triphosphate pyrophosphatase protein [Ralstonia
           solanacearum GMI1000]
          Length = 201

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 102/218 (46%), Gaps = 19/218 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS+N  K+ E ++L+ PLG+      EL +   EE   +F ENA+ K+  A++ 
Sbjct: 1   MRRIVLASNNPGKLAEFNALLAPLGLDVAPQGELGIPEAEEPHATFVENALAKARHASRL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           AG+PAL+DDSG+    L G PG++SAR+A+   G +       ++   L         + 
Sbjct: 61  AGLPALADDSGICAHALGGAPGVYSARYAQLAGGPKSDAANNARLVRELAGHADRGAHY- 119

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + V      D       G   G ++  PRG  GFGYDP F      +T  E+++ E
Sbjct: 120 --VCVLVYVRHADDPQPIIAEGSWFGEVIDAPRGDGGFGYDPHFLLPALGKTAAELSKAE 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           KN                +SHRA+A    V+   R+ E
Sbjct: 178 KNA---------------VSHRAQALAQLVERL-RLFE 199


>gi|83594969|ref|YP_428721.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Rhodospirillum rubrum ATCC 11170]
 gi|123739387|sp|Q2RN61|NTPA_RHORT RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|83577883|gb|ABC24434.1| Ham1-like protein [Rhodospirillum rubrum ATCC 11170]
          Length = 201

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 99/218 (45%), Positives = 127/218 (58%), Gaps = 23/218 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+L+E+ +V+ASHN  K+ E+  LI P G+   SA  L+L  PEETG+SF ENA++K+  
Sbjct: 5   RRLVESPLVVASHNAGKVREIAELIAPFGLEARSAASLDLPEPEETGSSFVENALLKAHA 64

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+  G+PAL+DDSGL +  L G PGI+SARWA            +  +          D
Sbjct: 65  AARATGLPALADDSGLAVSALGGDPGIYSARWAGPTKDFALAMATINHLLG--------D 116

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              RSAHF+  L+LAWPDGH E F G+V G++VWPPRG  GFGYDP+F   G   TFGEM
Sbjct: 117 NPDRSAHFVCALALAWPDGHAETFEGRVDGVLVWPPRGDQGFGYDPMFLGEGAAETFGEM 176

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
               K+                +SHRARAF   V  CL
Sbjct: 177 DPAAKHA---------------ISHRARAFALLVAACL 199


>gi|188579738|ref|YP_001923183.1| deoxyribonucleotide triphosphate pyrophosphatase [Methylobacterium
           populi BJ001]
 gi|179343236|gb|ACB78648.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylobacterium populi BJ001]
          Length = 211

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 109/219 (49%), Positives = 137/219 (62%), Gaps = 14/219 (6%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            +++   +VIA+HN  K+ EM  L+ P G+   SA EL L  P+ETG  F ENA IK+  
Sbjct: 4   HRILSGKVVIATHNAGKLVEMRELLAPFGVEAVSAGELGLPEPDETGTMFSENAAIKAHA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK +G+PA +DDSGL +D LDG PG+ SARWA      +DF  AM +I + L  + A  
Sbjct: 64  AAKASGLPAFADDSGLCVDALDGAPGLFSARWAGP---AKDFSGAMARIADELDRRGAT- 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R AHF+S L LAWPDGH E F G+V G +V  PRGQLGFGYDP+F+P G DRTFGE+
Sbjct: 120 --NRRAHFVSALVLAWPDGHTELFEGRVFGDLV-APRGQLGFGYDPMFRPEGMDRTFGEI 176

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           + EEK+            S + LSHRARAF      CLR
Sbjct: 177 SSEEKH-------GVDWQSGNALSHRARAFVELARACLR 208


>gi|254559086|ref|YP_003066181.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Methylobacterium extorquens DM4]
 gi|254266364|emb|CAX22128.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Methylobacterium extorquens DM4]
          Length = 211

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 108/219 (49%), Positives = 136/219 (62%), Gaps = 14/219 (6%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            +++   +VIA+HN  K+ EM  L+ P G+   SA EL L  P+ETG  F ENA IK+  
Sbjct: 4   HRILSGKVVIATHNAGKLVEMRELLAPFGVEAVSAGELGLPEPDETGTMFAENAAIKAHA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK +G+PA +DDSGL +D LDG PG+ SARWA     ++DF  AM +I   L  + A  
Sbjct: 64  AAKASGLPAFADDSGLCVDALDGAPGLFSARWAGP---DKDFSGAMARIAAELDKRGAT- 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R AHF+S L LAWPDGH E F G+V G +V  PRG LGFGYDP+F+P G DRTFGE+
Sbjct: 120 --DRRAHFVSALVLAWPDGHTELFEGRVFGDLV-APRGSLGFGYDPMFRPEGMDRTFGEI 176

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           + EEK+            S + LSHRARAF      CLR
Sbjct: 177 SSEEKH-------GVDWQSGNALSHRARAFVLLAQACLR 208


>gi|262172430|ref|ZP_06040108.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           mimicus MB-451]
 gi|261893506|gb|EEY39492.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           mimicus MB-451]
          Length = 200

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MKKIVLATGNQGKVREMADLLADFGFDVVAQSEFNVPEVAETGTTFIENAIIKARHAAKI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHAND------GDNLNKLLAAMQDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTAPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 VRK---------------KQLSHRGKALRKLFKAIEE 196


>gi|192361716|ref|YP_001980646.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Cellvibrio japonicus Ueda107]
 gi|190687881|gb|ACE85559.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Cellvibrio japonicus Ueda107]
          Length = 200

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 102/221 (46%), Gaps = 23/221 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            N IV+AS N  K+ E   L+   G       +      EETG +F ENA++K+  A  N
Sbjct: 1   MNKIVLASGNAGKLREFRQLLAGCGYDVVPQSDFFSESAEETGLTFVENAILKARFACLN 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PAL+DDSG+ +D L+G+PGI+SAR+A     +   +         L+         R
Sbjct: 61  TGLPALADDSGIEVDALNGRPGIYSARYAGEPGSDAANNA------KLLQELAGVPEQER 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A + +VL+      D       G   G I+  PRG+ GFGYDP+F    +     E+++
Sbjct: 115 GARYHAVLAFMRHAQDPTPILCHGVWEGRILTEPRGEGGFGYDPLFFVPSHHCASAELSK 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +EKN                +SHR +A +  +     +  +
Sbjct: 175 DEKN---------------RISHRGKAMQELLRALSALASR 200


>gi|197117593|ref|YP_002138020.1| nucleoside-triphosphatase [Geobacter bemidjiensis Bem]
 gi|197086953|gb|ACH38224.1| xanthosine/inosine triphosphate pyrophosphohydrolase [Geobacter
           bemidjiensis Bem]
          Length = 201

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 71/216 (32%), Positives = 106/216 (49%), Gaps = 22/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              +++AS N  K+ E + L+  +     S  +   L   EE G+SFE NA+ K+ +AA 
Sbjct: 1   MKELLVASGNKGKLREFEKLLEGVVETILSPADFPGLPEVEEDGDSFEANALKKARSAAL 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G P LSDDSGL +D L G+PG++SAR+A    G+   +         L+         
Sbjct: 61  FTGKPVLSDDSGLCVDHLGGRPGVYSARFAGEGAGDAANNA------RLLQEMAGVPREE 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+  F  V++L  PDG  + F G + G I+  PRG+ GFGYDP+F    + +TF E+  E
Sbjct: 115 RTGAFHCVIALCLPDGSCQTFDGMLKGEILDAPRGEGGFGYDPLFLVPEHGQTFSELPME 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            KN                +SHR RA +   +   +
Sbjct: 175 IKN---------------TISHRGRAMQMLKEALQK 195


>gi|253579969|ref|ZP_04857237.1| Ham1 family protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848968|gb|EES76930.1| Ham1 family protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 194

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 68/215 (31%), Positives = 107/215 (49%), Gaps = 22/215 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAK 64
              I+ A+ N DK+ E+  ++  + +   S  E  +     E G++FEENA+IK+ T  +
Sbjct: 1   MKKIIFATGNQDKMREIREILADMDVEVVSMKEAGIHADIVEDGSTFEENAVIKAKTICE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G   L+DDSGL ID L+ +PGI+SAR+   +T     + ++ +  N            
Sbjct: 61  LTGEITLADDSGLEIDYLNKEPGIYSARYMGEDTSYHIKNASLIERLN------GVPDEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+  ++ A+PDG V+   G + G I +  +G+ GFGYDPIF    Y  T  E++ E
Sbjct: 115 RTARFVCAVAAAFPDGSVKTVRGTMEGRIGYEEKGENGFGYDPIFYLPEYGCTSAELSGE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EKN                +SHR +A +   D   
Sbjct: 175 EKNK---------------ISHRGKALRAIKDELK 194


>gi|312794042|ref|YP_004026965.1| non-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312877643|ref|ZP_07737600.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795590|gb|EFR11962.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|312181182|gb|ADQ41352.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 204

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 69/221 (31%), Positives = 102/221 (46%), Gaps = 24/221 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL--NLIIPEETGNSFEENAMIKSLTAA 63
              +++A+ N  K  E+  LI        +      N+ I E  G++FEENA+ K+ T  
Sbjct: 1   MRKLLVATKNEGKAREIKQLIENYFDDVVTLNHFDGNINIIE-DGSTFEENALKKAKTVY 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
                P L+DDSGL +D L G+PG+ SAR+A     +        +I+  L         
Sbjct: 60  SLYRQPTLADDSGLEVDALGGRPGVMSARYAGERATDE------DRIKKLLDELKDVPED 113

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+ VL      G +    G   G I + PRG+ GFGYDP+F P+G+D+TF E+  
Sbjct: 114 KRGAQFVCVLVFIDQQGRIYQTKGICRGRIAFEPRGENGFGYDPVFVPDGFDKTFAELDS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           + KN                +SHRA+AF+        I  +
Sbjct: 174 QIKNQ---------------ISHRAKAFENLKKILGEIYNE 199


>gi|307547056|ref|YP_003899535.1| deoxyribonucleotide triphosphate pyrophosphatase [Halomonas
           elongata DSM 2581]
 gi|307219080|emb|CBV44350.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Halomonas elongata DSM 2581]
          Length = 252

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 67/214 (31%), Positives = 97/214 (45%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +  ++V+AS N  K+ E   L+ PLG       E  +   EETG +F ENA++K+  A++
Sbjct: 51  MSKHLVLASGNAGKLREFHQLLAPLGFEVRPQSEFAVDEVEETGLTFVENALLKAREASR 110

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G PAL+DDSGL ++ L G PGI+SAR+A     +   +    +      S        
Sbjct: 111 VSGAPALADDSGLAVEALQGHPGIYSARFAGEPKDDERNN----RHLLEALSDVPEGERQ 166

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                + VL     D           G I+  PRG+ GFGYDP+F       +  E+++ 
Sbjct: 167 ARYWCVLVLLRHAEDPVPLIVQRHWDGEILAHPRGEGGFGYDPLFWVPDQGMSAAELSDS 226

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                LSHR RA    VD  
Sbjct: 227 EKN---------------RLSHRGRALHALVDAL 245


>gi|123443631|ref|YP_001007603.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122090592|emb|CAL13461.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 197

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 73/217 (33%), Positives = 108/217 (49%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNPGKVRELATLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQT 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A ++  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYAGADASDQ------QNLEKLLVALKDIPDEQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 GAQFHCVLVYMRHAEDPTPLVFHGQWPGVIARQPSGTAGFGYDPIFYVPELGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKHA---------------VSHRGQALKLMLDALRN 196


>gi|262191067|ref|ZP_06049274.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae CT 5369-93]
 gi|297580595|ref|ZP_06942521.1| HAM1 family protein [Vibrio cholerae RC385]
 gi|262033043|gb|EEY51574.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae CT 5369-93]
 gi|297535011|gb|EFH73846.1| HAM1 family protein [Vibrio cholerae RC385]
          Length = 200

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVPEVAETGTTFIENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHASD------GDNLNKLLAAMQDVPNDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTSPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 VRK---------------KQLSHRGKALQKLFKAIEE 196


>gi|94309796|ref|YP_583006.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Cupriavidus metallidurans CH34]
 gi|93353648|gb|ABF07737.1| dITP/XTP pyrophosphatase [Cupriavidus metallidurans CH34]
          Length = 204

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 68/213 (31%), Positives = 101/213 (47%), Gaps = 18/213 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+AS+N  K+ E  +L+ PLG       EL +   EE   +F ENA+ K+  AA+ 
Sbjct: 1   MQRLVLASNNPGKLREFSALLSPLGFDVVPQGELGVPEAEEPFATFVENALTKARHAARL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            GMPAL+DDSG+ ++ LDG PG++SAR+A++    +        + + L  K      + 
Sbjct: 61  TGMPALADDSGICVEALDGAPGVYSARYAQTVGKPKSDAANNAHLISQLAGKLNRRAHYY 120

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + V+     D       G  +G +V  PRG  GFGYDP F      +T  E++ EE
Sbjct: 121 ---CVLVMVRHADDPRPIIAEGIWAGEVVDAPRGNGGFGYDPHFLLPSVGKTAAELSAEE 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN                +SHRA A +  V   
Sbjct: 178 KNA---------------ISHRALALQELVARL 195


>gi|15640483|ref|NP_230110.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           cholerae O1 biovar El Tor str. N16961]
 gi|153823177|ref|ZP_01975844.1| HAM1 family protein [Vibrio cholerae B33]
 gi|229509070|ref|ZP_04398558.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae B33]
 gi|229519738|ref|ZP_04409181.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae RC9]
 gi|229606250|ref|YP_002876898.1| deoxyribonucleotide triphosphate pyrophosphatase [Vibrio cholerae
           MJ-1236]
 gi|254291167|ref|ZP_04961963.1| HAM1 family protein [Vibrio cholerae AM-19226]
 gi|254850687|ref|ZP_05240037.1| nucleoside-triphosphatase [Vibrio cholerae MO10]
 gi|255744297|ref|ZP_05418250.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholera CIRS 101]
 gi|262147278|ref|ZP_06028077.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae INDRE 91/1]
 gi|22653779|sp|Q9KUQ9|NTPA_VIBCH RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|9654881|gb|AAF93629.1| HAM1 protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|126519303|gb|EAZ76526.1| HAM1 family protein [Vibrio cholerae B33]
 gi|150422861|gb|EDN14812.1| HAM1 family protein [Vibrio cholerae AM-19226]
 gi|229344427|gb|EEO09402.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae RC9]
 gi|229353995|gb|EEO18929.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae B33]
 gi|229368905|gb|ACQ59328.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae MJ-1236]
 gi|254846392|gb|EET24806.1| nucleoside-triphosphatase [Vibrio cholerae MO10]
 gi|255738237|gb|EET93629.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholera CIRS 101]
 gi|262031272|gb|EEY49887.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae INDRE 91/1]
          Length = 200

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 95/217 (43%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVPEAAETGTTFIENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+P ++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 61  TGLPTIADDSGLEVDYLNGAPGIYSARYAGEHASD------GDNLNKLLMAMQDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTAPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 VRK---------------KQLSHRGKALQKLFKAIEE 196


>gi|258620719|ref|ZP_05715754.1| HAM1 protein [Vibrio mimicus VM573]
 gi|258586917|gb|EEW11631.1| HAM1 protein [Vibrio mimicus VM573]
          Length = 200

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MKKIVLATGNQGKVREMADLLADFGFDVVAQSEFNVPEVAETGTTFIENAIIKARHAAKI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHAND------GDNLNKLLAAMQDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTAPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 VRK---------------KQLSHRGKALQKLFKAIEE 196


>gi|127512065|ref|YP_001093262.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Shewanella loihica PV-4]
 gi|126637360|gb|ABO23003.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella loihica PV-4]
          Length = 223

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 64/215 (29%), Positives = 95/215 (44%), Gaps = 21/215 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
             N IV+AS N  K+ E   ++   GI      + N+    ETG +F ENA+IK+  AA+
Sbjct: 24  KMNQIVLASGNKGKLKEFAEILAEFGIEVLPQSQFNVQEVPETGTTFVENAIIKARHAAQ 83

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+ A++DDSGL +D L+G PGI+SAR+      + D    +    N    + A     
Sbjct: 84  VTGLAAIADDSGLEVDALEGAPGIYSARYGGEGASDSDNYTKLLGALNDNDKRSA----- 138

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                I V      D           G I + P+G  G GYDP+F P  ++ +  E+  +
Sbjct: 139 -RFQCILVYMRHAKDPTPIICQASWEGSIGFEPKGDNGHGYDPVFIPMDHECSAAELRSD 197

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EKN                LSHR +A +  +    
Sbjct: 198 EKNA---------------LSHRGKAMQLLLSELK 217


>gi|82523946|emb|CAI78668.1| hypothetical protein [uncultured delta proteobacterium]
          Length = 202

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 103/218 (47%), Gaps = 22/218 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             IV AS N  K+ E+ +++  + I   S     N+    E G SF +NA+ K+ T ++ 
Sbjct: 1   MKIVFASRNEGKVKEIKNMLEEIDIELVSLNNYKNVPEIVEDGKSFFQNALKKAKTVSEI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G   L+DDSGL ++ L G+PGI+SAR+A    G+ + +         L          R
Sbjct: 61  TGEIVLADDSGLQVEALGGEPGIYSARYAGDQAGDDENN------NKLLAKLKDVPTEKR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           SA F  VL +  PD    +F GK  GII+   RG  GFGYDPIF    + +T  E+  E 
Sbjct: 115 SAFFCCVLVIYKPDNTHYSFEGKWRGIIIDERRGSNGFGYDPIFYVTEFKKTAAELPPEI 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           KN                +SHR +AF    ++   I +
Sbjct: 175 KNK---------------VSHRGQAFAKLKESLTEILK 197


>gi|315634898|ref|ZP_07890180.1| non-canonical purine NTP pyrophosphatase RdgB [Aggregatibacter
           segnis ATCC 33393]
 gi|315476450|gb|EFU67200.1| non-canonical purine NTP pyrophosphatase RdgB [Aggregatibacter
           segnis ATCC 33393]
          Length = 199

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 69/216 (31%), Positives = 101/216 (46%), Gaps = 21/216 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  AA+
Sbjct: 1   MKQKIVLATGNQGKVREMADVLADFGFEVIAQTDLGIDSPEETGLTFVENAILKARYAAE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+D L+G PG++SAR+A  +          +  E  L          
Sbjct: 61  KSGLPAIADDSGLVVDALNGAPGLYSARYAGVDG----EQADAKNREKLLAELANVPTEH 116

Query: 125 RSAHF--ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           RSA F    VL     D       G   G+I +  +G  GFGYD +F       TF E+ 
Sbjct: 117 RSAQFVSTIVLLQHPTDPSPIIAQGACHGVITFEEKGDNGFGYDSLFFSPETGCTFAELE 176

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
             EK                 +SHRARA        
Sbjct: 177 TAEKKK---------------ISHRARALSALKAQL 197


>gi|222528844|ref|YP_002572726.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor bescii DSM 6725]
 gi|222455691|gb|ACM59953.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor bescii DSM 6725]
          Length = 203

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 66/220 (30%), Positives = 99/220 (45%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
              +++A+ N  K  E+  LI        +  + +  +   E G +FEENA+ K+     
Sbjct: 1   MRKLLVATKNEGKAKEIKQLIGSYFDDVVTLNDFDSSVNIIEDGRTFEENALKKAKMIYT 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL +D L G+PG+ SAR+A     +        +I+  L          
Sbjct: 61  LYRQPTLADDSGLEVDALGGRPGVMSARYAGERATDE------DRIKKLLDELKNVPEDK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F+ VL      G +    G   G I + PRG+ GFGYDP+F P+G+D+TF E+   
Sbjct: 115 RGAQFVCVLVFIDQQGRIYQTKGICRGRIAFEPRGENGFGYDPVFVPDGFDKTFAELDSH 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
            KN                +SHRA+AF+        I  +
Sbjct: 175 IKNQ---------------ISHRAKAFENLKKILGEIYNE 199


>gi|121590726|ref|ZP_01678058.1| HAM1 family protein [Vibrio cholerae 2740-80]
 gi|121547457|gb|EAX57566.1| HAM1 family protein [Vibrio cholerae 2740-80]
          Length = 200

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVPEVAETGTTFIENAIIKARHAAKI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHASD------GDNLNKLLVAMQDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTAPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 VRK---------------KQLSHRGKALQKLFKAIEE 196


>gi|258625604|ref|ZP_05720486.1| HAM1 protein [Vibrio mimicus VM603]
 gi|258582106|gb|EEW06973.1| HAM1 protein [Vibrio mimicus VM603]
          Length = 200

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 72/217 (33%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MKKIVLATGNQGKVREMADLLADFGFDVVAQSEFNVPEVAETGTTFIENAIIKARHAAKI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHAND------GDNLNKLLAAMQDVPDEQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTAPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 VRK---------------KQLSHRGKALKKLFKAIEE 196


>gi|83648997|ref|YP_437432.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Hahella
           chejuensis KCTC 2396]
 gi|83637040|gb|ABC33007.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Hahella
           chejuensis KCTC 2396]
          Length = 199

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 77/218 (35%), Positives = 105/218 (48%), Gaps = 23/218 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+ASHN  KI E++ L+  L I   S  ELN+   EETG +F ENA++K+  AA  
Sbjct: 1   MQKIVLASHNAGKIKELNRLLGSLDITVVSQKELNIPSIEETGQTFIENAILKARHAAAV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G+PAL+DDSGL +D L G PGI+SAR+A  +  ++D +         L+         R
Sbjct: 61  SGLPALADDSGLEVDALQGAPGIYSARFAGESASDQDNNA------KLLQLLANTPTGAR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGK--VSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL+    +             G I     G  GFGYDP+F  +    T  E+T 
Sbjct: 115 TARFHCVLAFMRHEADPVPVICHGAWEGSIAEQASGGGGFGYDPLFWLSDRQCTSAELTP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EEKN                LSHR +A    V    R+
Sbjct: 175 EEKNA---------------LSHRGQAMAQLVAELTRL 197


>gi|258645722|ref|ZP_05733191.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Dialister invisus DSM 15470]
 gi|260403091|gb|EEW96638.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Dialister invisus DSM 15470]
          Length = 197

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 64/215 (29%), Positives = 106/215 (49%), Gaps = 22/215 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             +V+A+ N  KI E       +G       ++ ++  PEETG +F ENA+ K+   A+ 
Sbjct: 1   MKVVLATRNQGKIREFQKHFSEIGWEVIPIADIADIPEPEETGTTFRENALQKARYYAEA 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +P LSDDSG++ DVL  +PG++SAR+A  +  +   +  + ++    R +       R
Sbjct: 61  VNLPVLSDDSGIIADVLGNEPGVYSARYAGVHGNDEANNQKLVEVLRPYRGEA------R 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H++ V+++ WPDG      G+ +GII    +G  GFGYDP+F    + +T  E++ EE
Sbjct: 115 RGHYMCVIAVVWPDGREITAEGRCNGIIRDFYKGTGGFGYDPLFYLPEFGKTMAELSMEE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           KN                +SHR +A    +     
Sbjct: 175 KNK---------------ISHRGKAVDAMLKKLKE 194


>gi|147673291|ref|YP_001215982.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           cholerae O395]
 gi|153216270|ref|ZP_01950363.1| HAM1 family protein [Vibrio cholerae 1587]
 gi|262167150|ref|ZP_06034864.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae RC27]
 gi|124114359|gb|EAY33179.1| HAM1 family protein [Vibrio cholerae 1587]
 gi|146315174|gb|ABQ19713.1| HAM1 family protein [Vibrio cholerae O395]
 gi|227012309|gb|ACP08519.1| HAM1 protein [Vibrio cholerae O395]
 gi|262024450|gb|EEY43137.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae RC27]
          Length = 200

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVPEAAETGTTFIENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHASD------GDNLNKLLAAMQDVPDNQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHSDDPTPIVCHGKWEGKILTAPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 VRK---------------KQLSHRGKALQKLFKAIEE 196


>gi|146296020|ref|YP_001179791.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145409596|gb|ABP66600.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 204

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 74/220 (33%), Positives = 107/220 (48%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
              +++A+ N  K  E+  LI     +  +  + +  I   E G +FEENA+ KS T   
Sbjct: 1   MRKLLVATKNRGKAKEIKELIGDFFDIILTLSDFDENINIIEDGKTFEENALKKSKTIYS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
              +P L+DDSGL +D LDG+PG++SAR+A  N  +       +KI+  L          
Sbjct: 61  LYKLPTLADDSGLEVDALDGRPGVYSARYAGDNATDE------EKIKKLLEELKNIPEEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F+ VL+    +G +    G   G I + P+G  GFGYDPIF P GY+ TF E+  +
Sbjct: 115 RGAQFVCVLTFIDENGRMYQTRGVCRGKIGFAPKGLNGFGYDPIFIPEGYNATFAELESD 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EKN                +SHRARAF+        I  +
Sbjct: 175 EKN---------------RISHRARAFEKLKKILGEIYNE 199


>gi|170725688|ref|YP_001759714.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella woodyi ATCC 51908]
 gi|169811035|gb|ACA85619.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella woodyi ATCC 51908]
          Length = 200

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 98/217 (45%), Gaps = 24/217 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            +  V+AS N  K+ E   +    G+      + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MDKFVLASGNKGKLKEFSEIFSEYGVEVFPQSQFNVAEVPETGTTFVENAIIKARHAAQV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            GM A++DDSGL +D+L+G PGI+SAR+A    GE             L       P  R
Sbjct: 61  TGMAAIADDSGLEVDLLEGAPGIYSARYAGEGAGE-------TDNYIKLLDALKDKPQAR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  +L       D           G I +  +G  G GYDPIF PN +  +  E++ 
Sbjct: 114 TARFQCILVYMRHAKDPTPIICQAAWEGKISFEAKGDNGHGYDPIFIPNEHSCSAAELSS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEKN                LSHR +A    +D   R
Sbjct: 174 EEKN---------------RLSHRGKAMTLLIDAMRR 195


>gi|256819019|ref|YP_003140298.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Capnocytophaga ochracea DSM 7271]
 gi|256580602|gb|ACU91737.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Capnocytophaga ochracea DSM 7271]
          Length = 193

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 100/218 (45%), Gaps = 26/218 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKN 65
             +V A+HN  K+ E+ +L+ P  I   S  ++       ET  + E NA++K+    ++
Sbjct: 1   MKLVFATHNQHKLKEIQALL-PKNIELLSLSDIGCDDDIAETATTIEGNALLKAQYIKEH 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                 +DD+GL +  L+  PG++SAR+A  +  + D           L  K     + R
Sbjct: 60  YHCNVFADDTGLEVQALNNAPGVYSARYAGEHKSDAD--------NMYLLLKNMEGISHR 111

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F +V++L         F G   G I   P G  GFGYDPIF P G D+TF E+T+EE
Sbjct: 112 EAQFKTVIALCLDGAV-YTFEGIAKGRIGTTPMGTNGFGYDPIFIPEGSDQTFAELTQEE 170

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           KN                +SHR +AF   +    +  +
Sbjct: 171 KN---------------RISHRGKAFGKLLHFLNQNIQ 193


>gi|254429475|ref|ZP_05043182.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Alcanivorax sp. DG881]
 gi|196195644|gb|EDX90603.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Alcanivorax sp. DG881]
          Length = 196

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 101/214 (47%), Gaps = 19/214 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+AS N  K+ EM  L+ PL I   +  E ++   EETG++F ENA+IK+  A K+
Sbjct: 1   MEKLVLASGNAKKLAEMQHLLAPLNIEVVAQSEFDVPEAEETGSTFVENAIIKARNACKH 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +  L+G PGI SAR++     +   +  + ++   +  +        
Sbjct: 61  TGLPAIADDSGLEVAALNGSPGIFSARFSGVGASDAKNNALLVEMLTEIPEEA----RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + VL     D       G  +G IV  P+G+ GFGYDP F       T  ++  EE
Sbjct: 117 RYVALIVLMHHEDDATPLICQGSWNGRIVLEPQGEQGFGYDPHFFVEAKGCTAAQLPAEE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           KN                +SHR +A    ++   
Sbjct: 177 KNA---------------ISHRGKAMALLIEALK 195


>gi|229512518|ref|ZP_04401989.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae TMA 21]
 gi|229350411|gb|EEO15360.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae TMA 21]
          Length = 200

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVPEAAETGTTFIENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHASD------GDNLNKLLAAMQDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTAPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 VRK---------------KQLSHRGKALQKLFKAIEE 196


>gi|229530298|ref|ZP_04419686.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae 12129(1)]
 gi|229332071|gb|EEN97559.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae 12129(1)]
 gi|327483310|gb|AEA77717.1| Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Vibrio cholerae LMA3894-4]
          Length = 214

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 15  MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVPEAAETGTTFIENAIIKARHAAQI 74

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 75  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHASD------GDNLNKLLAAMQDVPDDQR 128

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 129 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTAPHGSNGFGYDPIFWVPEENCASAELEP 188

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 189 VRK---------------KQLSHRGKALQKLFKAIEE 210


>gi|299066245|emb|CBJ37429.1| Nucleoside-triphosphate diphosphatase [Ralstonia solanacearum
           CMR15]
          Length = 201

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 101/218 (46%), Gaps = 19/218 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS+N  K+ E  +L+ PLG+      EL +   EE   +F ENA+ K+  A++ 
Sbjct: 1   MRRIVLASNNPGKLAEFHALLAPLGLDVAPQGELGIPEAEEPHATFVENALAKARHASRL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           AG+PAL+DDSG+    L G PG++SAR+A+   G +       ++   L         + 
Sbjct: 61  AGLPALADDSGICAHALGGAPGVYSARYAQLAGGPKSDAANNARLVRELAGHANRGAHY- 119

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + V      D       G   G ++  PRG  GFGYDP F      +T  E+++ E
Sbjct: 120 --VCVLVYVRHADDPQPIIAEGSWFGEVIDAPRGDGGFGYDPHFLLPALGKTAAELSKAE 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           KN                +SHRA+A    V+   R+ E
Sbjct: 178 KNA---------------VSHRAQALAQLVERL-RLFE 199


>gi|170765987|ref|ZP_02900798.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia albertii TW07627]
 gi|170125133|gb|EDS94064.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia albertii TW07627]
          Length = 197

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 104/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLEIVAQTELGVDSAEETGLTFIENAILKARHAAKM 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++     +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQ---KNLQKLLETLKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGTWPGVITREPVGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|78043192|ref|YP_359185.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Carboxydothermus hydrogenoformans Z-2901]
 gi|77995307|gb|ABB14206.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 202

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 76/216 (35%), Positives = 109/216 (50%), Gaps = 22/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              IVIAS N  KI E  +L+  LG    S L+   +    E G +FE+NA  K++T + 
Sbjct: 1   MQRIVIASKNQGKIKEFSALLSSLGFSFVSLLDFPEIGEIPEKGTTFEDNARQKAVTVSN 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PAL+DDSGLV+D L G+PG+ SAR+A     +      ++ I+  L+         
Sbjct: 61  FTGLPALADDSGLVVDALGGRPGVFSARYAGEPKDD------LKNIQKLLKELEGVPWEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F++VL L +PDG +    G+  G I+   RG  GFGYDP+F    Y +T  E+  E
Sbjct: 115 RTARFVAVLCLYFPDGSLVTARGECEGYILEEMRGSGGFGYDPVFYLPDYGKTMAELPLE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            KN                +SHRARA +  +     
Sbjct: 175 IKNK---------------ISHRARALEELLRKLKE 195


>gi|297618202|ref|YP_003703361.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Syntrophothermus lipocalidus DSM 12680]
 gi|297146039|gb|ADI02796.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Syntrophothermus lipocalidus DSM 12680]
          Length = 201

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 72/220 (32%), Positives = 103/220 (46%), Gaps = 22/220 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAA 63
           +E  +V+A+ N  K+ E+  L+  +G+   S  +   +   EE G +F ENA+ K+ T A
Sbjct: 1   MERKLVLATRNGKKLQELKQLLDGMGVEMLSLEQFPEVPEVEEDGETFAENAIKKARTIA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  GM  L+DDSGL +D L G PG+HSAR+A  +  +   +         +         
Sbjct: 61  EVTGMVTLADDSGLEVDALGGSPGVHSARFAGEHGDDAANNA------KLMDLMRGVPEE 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F  V+++A P G V    G   G I   PRG  GFGYDP+F   GY RT  E+  
Sbjct: 115 KRGARFRCVVAVAVPWGEVHLAEGTCEGKIAHEPRGDWGFGYDPLFVVEGYGRTMAELPP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           E KN                +SHR RA +        + E
Sbjct: 175 EVKNS---------------ISHRGRALERARAILASLWE 199


>gi|209966226|ref|YP_002299141.1| HAM1 family protein [Rhodospirillum centenum SW]
 gi|226737270|sp|B6IVK5|NTPA_RHOCS RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|209959692|gb|ACJ00329.1| HAM1 family protein [Rhodospirillum centenum SW]
          Length = 203

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 91/218 (41%), Positives = 123/218 (56%), Gaps = 20/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R+   + +VIASHN  K+ E+  L+        SA EL+L  PEET  +F  NA +K+  
Sbjct: 5   RRFAGDTLVIASHNRGKVREIADLLAAHVRHFPSAAELDLPEPEETEATFIGNAALKARA 64

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G+PAL+DDSGL +D LDG PGI+SARWA     E+DF  AM+++   L    A D
Sbjct: 65  AALASGLPALADDSGLWVDALDGAPGIYSARWAGP---EKDFGAAMERVRRELE--AAAD 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
                A F+  L+LAWPDGHVE   G   G + +PPRG  GFGYDP+F P+G+  T+ E+
Sbjct: 120 RRGDRARFVCALALAWPDGHVEAVEGTAHGTLTFPPRGGKGFGYDPVFIPDGHACTYAEL 179

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
               K+                +SHRA AF+  +  C 
Sbjct: 180 DPAHKHA---------------ISHRADAFRQLLARCF 202


>gi|73542164|ref|YP_296684.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Ralstonia eutropha JMP134]
 gi|72119577|gb|AAZ61840.1| Ham1-like protein [Ralstonia eutropha JMP134]
          Length = 205

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 68/213 (31%), Positives = 96/213 (45%), Gaps = 18/213 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+AS+N  K+ E  +L+ PLG       EL +   EE   +F ENA+ K+  A+  
Sbjct: 1   MQRLVLASNNAGKLREFGALLAPLGFDVVPQGELGVPEAEEPFATFVENALAKARHASLL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           AGMPAL+DDSG+ +  LDG PG++SAR+A+     +        + + L  K      + 
Sbjct: 61  AGMPALADDSGICVQALDGAPGVYSARYAQMAGKSKSDQANNLHLISQLAGKLNRRAHYY 120

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + V      D       G   G +V  PRG  GFGYDP F      +T  E+  EE
Sbjct: 121 ---CVLVFVRHAADPCPIIAEGLWHGEVVDAPRGAGGFGYDPHFMLPDLGKTAAELPAEE 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN                +SHRA A +  V   
Sbjct: 178 KNA---------------VSHRALALRSLVARL 195


>gi|261210033|ref|ZP_05924331.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           sp. RC341]
 gi|260840798|gb|EEX67340.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           sp. RC341]
          Length = 200

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 97/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVPEVAETGTTFIENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         ++  L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHASD------GDNLKKLLVAMQDVPDEQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTAPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 VRK---------------KQLSHRGKALQKLFKAIEE 196


>gi|295097493|emb|CBK86583.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 197

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLNDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDFLGGAPGIYSARYSGVDATDQ------QNLEKLLVALKDVPDEQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL       D       G   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 TAQFHCVLVYMRHAEDPTPIVCHGSWPGVITREAAGNGGFGYDPIFFVPTEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR RA K  ++    
Sbjct: 175 EEKSA---------------ISHRGRALKLLLEALRN 196


>gi|229519842|ref|ZP_04409276.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae TM 11079-80]
 gi|229343130|gb|EEO08114.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae TM 11079-80]
          Length = 200

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 97/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVPEAAETGTTFIENAIIKARHAAKI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHASD------GDNLNKLLAAMQDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTAPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +   +    
Sbjct: 175 VRK---------------KQLSHRGKALQKLFNAIEE 196


>gi|311069328|ref|YP_003974251.1| nucleoside-triphosphatase [Bacillus atrophaeus 1942]
 gi|310869845|gb|ADP33320.1| nucleoside-triphosphatase [Bacillus atrophaeus 1942]
          Length = 195

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 70/214 (32%), Positives = 102/214 (47%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
               +IA+HN  K+ E   ++ P G    S  ++  L   EETG++FEENA++K+   AK
Sbjct: 1   MKEAIIATHNPGKVKEFKDILAPKGYDVKSLADIGFLEEIEETGHTFEENAVLKAEAVAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL +D L G PG++SAR+A     +         I   L+     +   
Sbjct: 61  AVNKMVIADDSGLSVDNLGGSPGVYSARYAGEQKDD------TANINKVLQELKGIEKEQ 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L+++ P    +   G V G I   P+G+ GFGYDPIF     D+T  E+T +
Sbjct: 115 RTARFRCALAVSIPGKETKTVEGHVEGYIAEEPKGENGFGYDPIFIVKDKDKTMAELTSD 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                +SHRA A K      
Sbjct: 175 EKNK---------------ISHRANALKKLSQLL 193


>gi|153826549|ref|ZP_01979216.1| HAM1 family protein [Vibrio cholerae MZO-2]
 gi|149739641|gb|EDM53855.1| HAM1 family protein [Vibrio cholerae MZO-2]
          Length = 200

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVPEAAETGTTFIENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHASD------GDNLNKLLVAMQDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTAPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 VRK---------------KQLSHRGKALQKLFKAIEE 196


>gi|312134723|ref|YP_004002061.1| non-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Caldicellulosiruptor owensensis OL]
 gi|311774774|gb|ADQ04261.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor owensensis OL]
          Length = 203

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 70/220 (31%), Positives = 104/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
              +++A+ N  K  E+  LI        +  + +  +   E G +FEENA+ K+     
Sbjct: 1   MRKLLVATKNEGKAKEIKQLIGSYFDDVVTLNDFDSSVNIIEDGRTFEENALKKAKMIYT 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G P L+DDSGL +D LDG+PG+ SAR+A  N  +        +I+  L    +     
Sbjct: 61  LYGQPTLADDSGLEVDALDGRPGVMSARYAGENATDE------DRIKKLLNELKSVPEDK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F+ VL      G +    G   G I + PRG+ GFGYDP+F P+G+DRTF E+  +
Sbjct: 115 RGAQFVCVLVFIDQQGRIYQTKGICRGKIAFEPRGENGFGYDPVFVPDGFDRTFAELDSQ 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
            KN                +SHRA+AF+        I  +
Sbjct: 175 IKNQ---------------ISHRAKAFENLKKILGEIYNE 199


>gi|121728583|ref|ZP_01681604.1| HAM1 family protein [Vibrio cholerae V52]
 gi|153828382|ref|ZP_01981049.1| HAM1 family protein [Vibrio cholerae 623-39]
 gi|121629139|gb|EAX61582.1| HAM1 family protein [Vibrio cholerae V52]
 gi|148876091|gb|EDL74226.1| HAM1 family protein [Vibrio cholerae 623-39]
          Length = 200

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVPEAAETGTTFIENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHASD------GDNLNKLLAAMQDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTSPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 VRK---------------KQLSHRGKALQKLFKAIEE 196


>gi|291528484|emb|CBK94070.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Eubacterium rectale M104/1]
          Length = 197

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 61/218 (27%), Positives = 102/218 (46%), Gaps = 24/218 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALE--LNLIIPEETGNSFEENAMIKSLTAA 63
              I+ A+ N DK+ E+  ++    +   S  E  +N+ I E  G +FE NA+IK+   A
Sbjct: 1   MTKIIFATGNKDKLREIKEILSDCDVDIRSMKEAGINVDIVE-DGKTFEYNALIKARAIA 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
            +     L+DDSGL ID L+ +PG++SAR+   +T     +  + +  +           
Sbjct: 60  AHTDAIVLADDSGLEIDYLNKEPGVYSARYMGEDTSYDIKNNNLIERLD------GVPKE 113

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+  ++   PDG        + G I W   G  GFGYDPIF  + Y  +  E+T 
Sbjct: 114 KRTARFVCAIAAVLPDGKELVTRQTMEGYIGWEIAGANGFGYDPIFYLDEYGCSSAELTP 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           ++KN                +SHR +A +   +  +++
Sbjct: 174 QQKNA---------------ISHRGKALRAMREMLVKV 196


>gi|332999701|gb|EGK19286.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri VA-6]
          Length = 197

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 69/215 (32%), Positives = 104/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++     +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQ---KNLQKLLETLKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITHEPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|238923301|ref|YP_002936816.1| ribonuclease Ph [Eubacterium rectale ATCC 33656]
 gi|238874975|gb|ACR74682.1| ribonuclease Ph [Eubacterium rectale ATCC 33656]
          Length = 197

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 61/218 (27%), Positives = 103/218 (47%), Gaps = 24/218 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALE--LNLIIPEETGNSFEENAMIKSLTAA 63
              I+ A+ N DK+ E+  ++    +   S  E  +N+ I E  G +FE+NA+IK+   A
Sbjct: 1   MTKIIFATGNKDKLREIKEILSDCDVDIRSMKEAGINVDIVE-DGKTFEDNALIKARAIA 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
            +     L+DDSGL ID L+ +PG++SAR+   +T     +  + +  +           
Sbjct: 60  AHTDAIVLADDSGLEIDYLNKEPGVYSARYMGEDTSYDIKNNNLIERLD------GVPKE 113

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+  ++   PDG        + G I W   G  GFGYDPIF  + Y  +  E+T 
Sbjct: 114 KRTARFVCAIAAVLPDGKELVTRQTMEGYIGWEIAGANGFGYDPIFYLDEYGCSSAELTP 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           ++KN                +SHR +A +   +  +++
Sbjct: 174 QQKNA---------------ISHRGKALRAMREMLVKV 196


>gi|218528483|ref|YP_002419299.1| deoxyribonucleotide triphosphate pyrophosphatase [Methylobacterium
           chloromethanicum CM4]
 gi|218520786|gb|ACK81371.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylobacterium chloromethanicum CM4]
          Length = 211

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 101/219 (46%), Positives = 128/219 (58%), Gaps = 14/219 (6%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            +++   +VIA+HN  K+ EM  L+ P G+   SA EL L  P+ETG  F ENA IK+  
Sbjct: 4   HRILSGKVVIATHNAGKLVEMRELLAPFGVKAVSAGELGLPEPDETGTMFSENAAIKAHA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK +G+PA +DDSGL +D LDG PG+ SARWA  +         +    +         
Sbjct: 64  AAKASGLPAFADDSGLCVDALDGAPGLFSARWAGPDKDFSGAMARIAAELDT------RG 117

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R AHF+S L LAWPDGH E F G+V G +V  PRG LGFGYDP+F+P G DRTFGE+
Sbjct: 118 ATDRRAHFVSALVLAWPDGHTELFEGRVFGDLV-QPRGNLGFGYDPMFRPEGIDRTFGEI 176

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           + EEK+            S + LSHRARAF      CLR
Sbjct: 177 SSEEKH-------GVDWQSGNALSHRARAFVLLAQACLR 208


>gi|71909463|ref|YP_287050.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Dechloromonas aromatica RCB]
 gi|71849084|gb|AAZ48580.1| Ham1-like protein [Dechloromonas aromatica RCB]
          Length = 195

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 66/213 (30%), Positives = 101/213 (47%), Gaps = 21/213 (9%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+AS+N  K+ E+++L+ PLG       +L +   EE   +F ENA+ K+  AA++
Sbjct: 1   MKKLVLASNNAKKMKELNALLAPLGFEVIPQGQLGIPEAEEPHCTFVENALAKARHAAEH 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G+PAL+DDSGL ++ L G PG+ SAR+A     +   +      E  L           
Sbjct: 61  SGLPALADDSGLCVEALHGAPGVLSARYAGDPKSDARNN------EKLLAHLKGQSNRKA 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             + + VL  A  D       G+  G I+   RG  GFGYDP+F     ++T  E+  E 
Sbjct: 115 HFYCVLVLVRAANDPQPIIAEGEWHGEILEAQRGADGFGYDPLFFVPSQNQTAAELDSEV 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN                LSHR RA +  ++  
Sbjct: 175 KNQ---------------LSHRGRAMQKLIERL 192


>gi|254295452|ref|YP_003061475.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Hirschia baltica ATCC 49814]
 gi|254043983|gb|ACT60778.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Hirschia baltica ATCC 49814]
          Length = 204

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 95/218 (43%), Positives = 123/218 (56%), Gaps = 21/218 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL    +V A+HN  K+ E+  L+ PLG    SA EL+L  PEETG +FE NA +K+L 
Sbjct: 8   RKLQPGRLVAATHNQGKVRELKDLLEPLGFEPVSAGELDLPEPEETGLTFEANAELKALA 67

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA  +G PAL+DDSGL +D L+G PGI+SARWA  +   +        +E   ++     
Sbjct: 68  AAIASGSPALADDSGLAVDALNGAPGIYSARWAGESKDFKL------AMEKVNQALEDEK 121

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            A RSA F+  L +AWPDG    F G+V G +VWPPRG+ GFGYD +F   G   TFGEM
Sbjct: 122 AAERSARFVCALCVAWPDGETVTFRGEVKGELVWPPRGENGFGYDAMFVAEGETITFGEM 181

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
               K+G               +SHRA AFK   +  L
Sbjct: 182 EPARKHG---------------MSHRANAFKLLTEAML 204


>gi|301154954|emb|CBW14417.1| dITP/XTP pyrophosphatase [Haemophilus parainfluenzae T3T1]
          Length = 199

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 67/216 (31%), Positives = 103/216 (47%), Gaps = 21/216 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLADFGFEVIAQTDLGIESPEETGLTFVENAILKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+D L+G PG++SAR+A  +  E       +  E  L          
Sbjct: 61  KSGLPAIADDSGLVVDALNGAPGLYSARYAGVDGDE----ADAKNREKLLAELADVPTEC 116

Query: 125 RSAHF--ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F    VL     D       G+  G I++  +G+ GFGYD +F       TF E+ 
Sbjct: 117 RQAKFVSTIVLLQHPSDPSPIIAQGECDGQIIYEEKGENGFGYDSLFFSPEKGCTFAELE 176

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
             EK                 +SHRA+A        
Sbjct: 177 TVEKKK---------------ISHRAKALAVLKSKL 197


>gi|157374366|ref|YP_001472966.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Shewanella sediminis HAW-EB3]
 gi|157316740|gb|ABV35838.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Shewanella sediminis HAW-EB3]
          Length = 200

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 66/217 (30%), Positives = 96/217 (44%), Gaps = 24/217 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            +  V+AS N  K+ E   +    G+      + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MDKFVLASGNKGKLKEFSEIFAQYGVQVLPQSQFNVEEVPETGTTFVENAIIKARHAAEV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D+LDG+PGI+SAR+A                   L          R
Sbjct: 61  TGLAAIADDSGLEVDLLDGQPGIYSARYAGEEAS-------ATDNYEKLLEALKETKEGR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  +L       D           G I +  +G  G GYDPIF PN +  T  E++ 
Sbjct: 114 TARFQCILVYMRHAKDPTPIICQASWEGRIGFEVKGVNGHGYDPIFIPNEHQCTAAELSS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +EKN                LSHR +A    +D   +
Sbjct: 174 DEKN---------------RLSHRGKAMSQLIDAMQK 195


>gi|146293786|ref|YP_001184210.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella putrefaciens CN-32]
 gi|145565476|gb|ABP76411.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella putrefaciens CN-32]
 gi|319427158|gb|ADV55232.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella putrefaciens 200]
          Length = 205

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 69/216 (31%), Positives = 100/216 (46%), Gaps = 24/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  K+ E + ++   G+      + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MQQIVLASGNKGKLAEFEQMLAVYGVEVLPQNQFNVTEVAETGTTFVENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D+L G PGI+SAR+A  N  ++D  +        L       PA R
Sbjct: 61  TGLAAIADDSGLEVDLLQGAPGIYSARYAGENAKDQDNVLK-------LLETLKDQPAPR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D           G I +  +G+ G GYDPIF P  +  +  EM+ 
Sbjct: 114 RARFQCVLVYMRHAKDPTPIICQASWEGHIGFEQKGENGHGYDPIFIPEQHTCSAAEMSS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           +EKN                LSHR +A    +    
Sbjct: 174 DEKNA---------------LSHRGKALTQLLAAMK 194


>gi|163784851|ref|ZP_02179630.1| hypothetical protein HG1285_11672 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879879|gb|EDP73604.1| hypothetical protein HG1285_11672 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 208

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 64/220 (29%), Positives = 102/220 (46%), Gaps = 17/220 (7%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTA 62
           +  + ++IA+ N  K+ E   L+  +GI   S  ++   I  EE   +F ENA+ K+   
Sbjct: 1   MQIDKVLIATTNKGKLKEFKQLLSNIGIEVLSLEDMKEKIDVEENKKTFLENAIKKAKEY 60

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESN-TGERDFDMAMQKIENALRSKFAHD 121
           AK   +P +++D+GL ++ L   PG++SAR+ +    G+        K       +    
Sbjct: 61  AKFYKIPVIAEDAGLEVEELGRYPGVYSARFYDIEFGGKEPVKDNKDKANINKLLRLLEG 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F+SV+    P+       G   G I   P G+ GFGYDPIF P GY +T  ++
Sbjct: 121 KENRKARFVSVIVFYNPEDFGIWAEGYCKGKIAKKPVGEGGFGYDPIFIPEGYKKTMAQL 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           T EEKN                +SHR +A +  +    +I
Sbjct: 181 TSEEKNK---------------ISHRGKAVRKLISILKKI 205


>gi|229824722|ref|ZP_04450791.1| hypothetical protein GCWU000182_00070 [Abiotrophia defectiva ATCC
           49176]
 gi|229791051|gb|EEP27165.1| hypothetical protein GCWU000182_00070 [Abiotrophia defectiva ATCC
           49176]
          Length = 196

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 72/217 (33%), Positives = 110/217 (50%), Gaps = 22/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAK 64
            + IV A+ N  KI E+  ++    +   S  E+N+    EE G +FEEN++IK+   +K
Sbjct: 1   MDKIVFATTNAGKIKEIKEILSDFDVEVVSMKEMNITADIEENGATFEENSLIKARAVSK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PAL+DDSGL +D L+G+PGI+SAR+   +T     +  +       + +       
Sbjct: 61  LTGLPALADDSGLEVDYLNGEPGIYSARYLGRDTDYDYKNNYIIDKLKEAKGEE------ 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           RSA F+ V+SL  PDG      G + G I +  +G+ GFGYDPIF    Y +T  E++ E
Sbjct: 115 RSARFVCVISLVLPDGREFVKKGVMEGRIGYEIKGENGFGYDPIFFLPEYGKTSAEISAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EKN                +SHR +A     +    +
Sbjct: 175 EKNK---------------ISHRGKALSAMKELIASL 196


>gi|120598142|ref|YP_962716.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella sp. W3-18-1]
 gi|120558235|gb|ABM24162.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella sp. W3-18-1]
          Length = 205

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 69/216 (31%), Positives = 100/216 (46%), Gaps = 24/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  K+ E + ++   G+      + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MQQIVLASGNKGKLAEFEQMLAVYGVEVLPQNQFNVTEVAETGTTFVENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D+L G PGI+SAR+A  N  ++D  +        L       PA R
Sbjct: 61  TGLAAIADDSGLEVDLLQGAPGIYSARYAGENAKDQDNVLK-------LLETLKDQPAPR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D           G I +  +G+ G GYDPIF P  +  +  EM+ 
Sbjct: 114 RARFQCVLVYMRHAKDPTPIICQASWEGQIGFEQKGENGHGYDPIFIPEQHTCSAAEMSN 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           +EKN                LSHR +A    +    
Sbjct: 174 DEKNA---------------LSHRGKALTQLLAAMK 194


>gi|153802610|ref|ZP_01957196.1| HAM1 family protein [Vibrio cholerae MZO-3]
 gi|153819168|ref|ZP_01971835.1| HAM1 family protein [Vibrio cholerae NCTC 8457]
 gi|227080666|ref|YP_002809217.1| HAM1 protein [Vibrio cholerae M66-2]
 gi|229507094|ref|ZP_04396600.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae BX 330286]
 gi|298501013|ref|ZP_07010814.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Vibrio
           cholerae MAK 757]
 gi|124121873|gb|EAY40616.1| HAM1 family protein [Vibrio cholerae MZO-3]
 gi|126510313|gb|EAZ72907.1| HAM1 family protein [Vibrio cholerae NCTC 8457]
 gi|227008554|gb|ACP04766.1| HAM1 protein [Vibrio cholerae M66-2]
 gi|229355839|gb|EEO20759.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae BX 330286]
 gi|297540261|gb|EFH76321.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Vibrio
           cholerae MAK 757]
          Length = 200

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVPEAAETGTTFIENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHASD------GDNLNKLLVAMQDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTSPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 VRK---------------KQLSHRGKALQKLFKAIEE 196


>gi|206890045|ref|YP_002249628.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|226737274|sp|B5YHP2|NTPA_THEYD RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|206741983|gb|ACI21040.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 204

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 76/215 (35%), Positives = 106/215 (49%), Gaps = 22/215 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKN 65
             IVIAS N  KI E+  ++  L I   S  +   L   +E G +F+ENA+ K+    + 
Sbjct: 1   MKIVIASRNRKKIEELKRILQGLEITILSVNDFPELEEVKEDGLTFDENALKKARYVCQQ 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PALSDDSGL ++ L G+PG+ SAR+A     +         I+  L          R
Sbjct: 61  TGLPALSDDSGLEVEALGGRPGVRSARYAGDEASDD------DNIKKLLEELAGVPSEKR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F+  ++L +PDG    F G V G I   PRG  GFGYDP+F P G+ +TF EM+  E
Sbjct: 115 TAQFVCCIALVFPDGKEYIFWGYVRGKISEIPRGTQGFGYDPVFIPEGFKKTFAEMSPHE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K               D +SHR  A     D  ++
Sbjct: 175 K---------------DKISHRKEALDKLRDFLIK 194


>gi|261878958|ref|ZP_06005385.1| ribonuclease PH/Ham1 protein [Prevotella bergensis DSM 17361]
 gi|270334413|gb|EFA45199.1| ribonuclease PH/Ham1 protein [Prevotella bergensis DSM 17361]
          Length = 203

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 70/220 (31%), Positives = 110/220 (50%), Gaps = 20/220 (9%)

Query: 7   NNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             IV A++N +K+ E+  ++     I++ + +  ++ IPE TG++ EENA  K+     N
Sbjct: 1   MKIVFATNNPNKLREIREILGSDFEIVSLADIGCHVDIPE-TGDTLEENARQKAEYIMTN 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +   +DD+GL ++ L G PG+HSAR+AE    + D +  M K+ + L  K      FR
Sbjct: 60  YHINCFADDTGLEVEALGGAPGVHSARYAE--GTDHDSEANMAKLLHELEGKENRTARFR 117

Query: 126 SAHFI-SVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           +   +  V   +  +     F G+V G I     G  GFGYDPIF P GYD++F E+ EE
Sbjct: 118 TVISLLEVKGESPSNYREIQFEGEVRGRIDTSKHGSSGFGYDPIFIPEGYDKSFAELGEE 177

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
            KN                +SHRA+A     D   ++  +
Sbjct: 178 VKNQ---------------ISHRAKAVMKLADYLRQLAAR 202


>gi|302871437|ref|YP_003840073.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302574296|gb|ADL42087.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 203

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 72/220 (32%), Positives = 102/220 (46%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
              ++IA+ N  K  EM  LI        +  + +  +   E G +FEENA+ K+     
Sbjct: 1   MRKLLIATKNEGKAKEMKQLIGSYFDDVVTLNDFDGSVNIIEDGRTFEENALKKARVIYT 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL +D LDGKPG+ SAR+A  N  +        +I+  L          
Sbjct: 61  LYRQPTLADDSGLEVDALDGKPGVMSARYAGENATDE------DRIKKLLDELKDVPDDK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F+ VL      G +    G   G I + PRG+ GFGYDP+F P+G+DRTF E+  +
Sbjct: 115 RGAQFVCVLVFIDKQGRIYQTKGICRGKIAFEPRGENGFGYDPVFVPDGFDRTFAELDSQ 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
            KN                +SHRA+AF+        I  +
Sbjct: 175 IKNQ---------------ISHRAKAFENLKKILGEIYNE 199


>gi|225849641|ref|YP_002729875.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Persephonella marina EX-H1]
 gi|225646615|gb|ACO04801.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Persephonella marina EX-H1]
          Length = 207

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 61/221 (27%), Positives = 99/221 (44%), Gaps = 17/221 (7%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTA 62
           +  + I++A+ N  K+ E   L   LGI   S  ++   I  EE   +F ENA+ K+   
Sbjct: 1   MRIDKILVATTNKGKLKEFKKLFGDLGIQILSLDDMPEKIKVEEDRETFLENAVKKAKEY 60

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESN-TGERDFDMAMQKIENALRSKFAHD 121
                +P +++D+GL ++ L   PG++SAR+   +  G      ++ +           D
Sbjct: 61  GDFYKIPVIAEDAGLEVEALKNYPGVYSARFYSIDFGGVYQIKESIDRTNIEKLLDLLKD 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F+SV+    P+       G   G I   P G+ GFGYDP+F P GY +T  E+
Sbjct: 121 EKNRKARFVSVVVFYIPEDFGLWTEGYCYGKIAEKPEGEKGFGYDPVFIPEGYKKTMAEL 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
             EEKN                +SHR +A +  ++    + 
Sbjct: 181 DLEEKN---------------RISHRGKAVRKLMEKLRYLL 206


>gi|56421200|ref|YP_148518.1| nucleoside-triphosphatase [Geobacillus kaustophilus HTA426]
 gi|62900155|sp|Q5KWI6|NTPA_GEOKA RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|56381042|dbj|BAD76950.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
          Length = 204

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 102/217 (47%), Gaps = 22/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              IVIA+ N  K+ E  +L    G+   S L+  +     ETG++F ENA++K+  A++
Sbjct: 1   MKEIVIATKNAGKVREFAALFAKRGVEVKSLLDFPDAPDVAETGSTFAENAVLKAEAASR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P ++DDSGLV+D L G+PG+HSAR+A  +  +       + I   LR         
Sbjct: 61  RLKRPVIADDSGLVVDALGGRPGVHSARYAGEDKNDA------RNIAKLLRELDGVPMEQ 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P            G I   PRG+ GFGYDP+F      +T  E+  E
Sbjct: 115 RTARFHCALAVAIPGRPTAVVEATCDGYIAEAPRGEGGFGYDPVFYLPERGKTMAELAPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EKN                +SHRA+A     +    I
Sbjct: 175 EKNQ---------------ISHRAKALTKLDEQWEEI 196


>gi|237729885|ref|ZP_04560366.1| nucleoside triphosphate phosphohydrolase [Citrobacter sp. 30_2]
 gi|226908491|gb|EEH94409.1| nucleoside triphosphate phosphohydrolase [Citrobacter sp. 30_2]
          Length = 197

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 68/217 (31%), Positives = 103/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   +ETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSADETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL ++ L G PGI+SAR++  +  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVNALGGAPGIYSARYSGEDATDQ------QNLEKLLHTLQDIPDDKR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGK--VSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL                   G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 QAQFHCVLVYMRHADDPTPVVCHGSWPGVITREPAGNGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLDALRN 196


>gi|170679994|ref|YP_001745115.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli SMS-3-5]
 gi|215488252|ref|YP_002330683.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218555513|ref|YP_002388426.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli IAI1]
 gi|293416215|ref|ZP_06658855.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Escherichia coli B185]
 gi|312964783|ref|ZP_07779023.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 2362-75]
 gi|331684581|ref|ZP_08385173.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli H299]
 gi|170517712|gb|ACB15890.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli SMS-3-5]
 gi|215266324|emb|CAS10755.1| dITP/XTP pyrophosphatase [Escherichia coli O127:H6 str. E2348/69]
 gi|218362281|emb|CAQ99902.1| dITP/XTP pyrophosphatase [Escherichia coli IAI1]
 gi|291432404|gb|EFF05386.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Escherichia coli B185]
 gi|312290339|gb|EFR18219.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 2362-75]
 gi|323966471|gb|EGB61904.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli M863]
 gi|327251722|gb|EGE63408.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli STEC_7v]
 gi|331078196|gb|EGI49402.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli H299]
          Length = 197

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 105/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  ++     +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQ---KNLQKLLETLKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|262403918|ref|ZP_06080475.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           sp. RC586]
 gi|262349880|gb|EEY99016.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           sp. RC586]
          Length = 200

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 97/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVPEAAETGTTFIENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         ++  L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHASD------GDNLKKLLVAMQDVPDEQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTAPHGSNGFGYDPIFWVPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 VRK---------------KQLSHRGKALQKLFKAIEE 196


>gi|331664537|ref|ZP_08365443.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli TA143]
 gi|331058468|gb|EGI30449.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli TA143]
          Length = 197

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 69/215 (32%), Positives = 105/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  ++     +QK+   ++          
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQ---KNLQKLLETMKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|24114209|ref|NP_708719.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           flexneri 2a str. 301]
 gi|30064270|ref|NP_838441.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           flexneri 2a str. 2457T]
 gi|82545423|ref|YP_409370.1| deoxyribonucleotide triphosphate pyrophosphatase [Shigella boydii
           Sb227]
 gi|110806862|ref|YP_690382.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           flexneri 5 str. 8401]
 gi|157162415|ref|YP_001459733.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli HS]
 gi|170018805|ref|YP_001723759.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli ATCC 8739]
 gi|187730440|ref|YP_001881727.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           boydii CDC 3083-94]
 gi|193067450|ref|ZP_03048418.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli E110019]
 gi|254038004|ref|ZP_04872062.1| non-canonical purine NTP pyrophosphatase [Escherichia sp. 1_1_43]
 gi|256019244|ref|ZP_05433109.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           sp. D9]
 gi|260845624|ref|YP_003223402.1| dITP/XTP pyrophosphatase [Escherichia coli O103:H2 str. 12009]
 gi|301328108|ref|ZP_07221249.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 78-1]
 gi|312972804|ref|ZP_07786977.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 1827-70]
 gi|332280352|ref|ZP_08392765.1| nucleoside-triphosphatase rdgB [Shigella sp. D9]
 gi|62900276|sp|Q83JS0|RDGB_SHIFL RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|24053356|gb|AAN44426.1| putative ribosomal protein [Shigella flexneri 2a str. 301]
 gi|30042527|gb|AAP18251.1| putative ribosomal protein [Shigella flexneri 2a str. 2457T]
 gi|81246834|gb|ABB67542.1| putative ribosomal protein [Shigella boydii Sb227]
 gi|110616410|gb|ABF05077.1| putative ribosomal protein [Shigella flexneri 5 str. 8401]
 gi|157068095|gb|ABV07350.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli HS]
 gi|169753733|gb|ACA76432.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli ATCC 8739]
 gi|187427432|gb|ACD06706.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Shigella boydii CDC 3083-94]
 gi|192959407|gb|EDV89842.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli E110019]
 gi|226839628|gb|EEH71649.1| non-canonical purine NTP pyrophosphatase [Escherichia sp. 1_1_43]
 gi|257760771|dbj|BAI32268.1| dITP/XTP pyrophosphatase [Escherichia coli O103:H2 str. 12009]
 gi|281602290|gb|ADA75274.1| Nucleoside-triphosphatase rdgB [Shigella flexneri 2002017]
 gi|300845412|gb|EFK73172.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 78-1]
 gi|310332746|gb|EFP99959.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 1827-70]
 gi|313648004|gb|EFS12450.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri 2a str. 2457T]
 gi|320174050|gb|EFW49220.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           dysenteriae CDC 74-1112]
 gi|320184301|gb|EFW59113.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           flexneri CDC 796-83]
 gi|323173832|gb|EFZ59461.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli LT-68]
 gi|323941960|gb|EGB38139.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli E482]
 gi|332091347|gb|EGI96435.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella boydii 3594-74]
 gi|332102704|gb|EGJ06050.1| nucleoside-triphosphatase rdgB [Shigella sp. D9]
 gi|332344854|gb|AEE58188.1| non-canonical purine NTP pyrophosphatase RdgB [Escherichia coli
           UMNK88]
 gi|332752997|gb|EGJ83381.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri 4343-70]
 gi|332753798|gb|EGJ84177.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri K-671]
 gi|332754579|gb|EGJ84945.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri 2747-71]
 gi|332765371|gb|EGJ95589.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri 2930-71]
 gi|332999874|gb|EGK19457.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri K-218]
 gi|333000456|gb|EGK20037.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri K-272]
 gi|333015149|gb|EGK34492.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri K-304]
 gi|333015294|gb|EGK34636.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella flexneri K-227]
          Length = 197

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 69/215 (32%), Positives = 104/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++     +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQ---KNLQKLLETLKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|325268324|ref|ZP_08134957.1| ribonuclease PH/Ham1 protein [Prevotella multiformis DSM 16608]
 gi|324989466|gb|EGC21416.1| ribonuclease PH/Ham1 protein [Prevotella multiformis DSM 16608]
          Length = 196

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 72/218 (33%), Positives = 111/218 (50%), Gaps = 25/218 (11%)

Query: 5   IENNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           +   IV A++N  K+ E+  ++     I++ + +  +  IPE TG + +ENA  KS    
Sbjct: 1   MNMKIVFATNNRHKLEEIKEILGKDFEIVSLAEIGCHEDIPE-TGLTLQENARQKSTYVV 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           ++      +DD+GL +D L G+PG+ SAR+AE    + D +  M+K+ + +         
Sbjct: 60  EHYRQNCFADDTGLEVDALGGEPGVRSARYAE--GTDHDSEANMRKLLSKMAGVE----- 112

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F +V+SL         F G+V G I     G  GFGYDPIF P GYD++F E+ E
Sbjct: 113 NRTARFRTVISLIIDGVE-HQFEGRVDGRIATEKHGSEGFGYDPIFIPEGYDKSFAELGE 171

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           E KN                +SHRARA K   ++  +I
Sbjct: 172 EVKNK---------------ISHRARAVKKLAEHLRKI 194


>gi|261418319|ref|YP_003252001.1| nucleoside-triphosphatase [Geobacillus sp. Y412MC61]
 gi|319767721|ref|YP_004133222.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. Y412MC52]
 gi|261374776|gb|ACX77519.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. Y412MC61]
 gi|317112587|gb|ADU95079.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. Y412MC52]
          Length = 204

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 103/217 (47%), Gaps = 22/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              IVIA+ N  K+ E  +L    G+   S L+  +     ETG++F ENA++K+  A++
Sbjct: 1   MKEIVIATKNAGKVREFAALFAKRGVEVKSLLDFPDAPDVAETGSTFAENAVLKAEAASR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P ++DDSGLV+D L G+PG+HSAR+A  +  +       + I   LR         
Sbjct: 61  RLKRPVIADDSGLVVDALGGRPGVHSARYAGEDKNDA------RNIAKLLRELDGVPMEQ 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P            G I   PRG+ GFGYDP+F    + +T  E+  E
Sbjct: 115 RTARFHCALAVAIPGRPTAVVEATCDGYIAEAPRGEGGFGYDPVFYLPEWGKTMAELAPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EKN                +SHRA+A     +    I
Sbjct: 175 EKNQ---------------ISHRAKALTKLDEQWEEI 196


>gi|26249375|ref|NP_755415.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli CFT073]
 gi|91212336|ref|YP_542322.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli UTI89]
 gi|110643103|ref|YP_670833.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli 536]
 gi|117625181|ref|YP_854169.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli APEC O1]
 gi|191171826|ref|ZP_03033372.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli F11]
 gi|194436702|ref|ZP_03068802.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli 101-1]
 gi|218559945|ref|YP_002392858.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia coli
           S88]
 gi|218691078|ref|YP_002399290.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli ED1a]
 gi|227888509|ref|ZP_04006314.1| nucleoside-triphosphatase [Escherichia coli 83972]
 gi|237706393|ref|ZP_04536874.1| nucleoside-triphosphatase rdgB [Escherichia sp. 3_2_53FAA]
 gi|256024537|ref|ZP_05438402.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia sp. 4_1_40B]
 gi|300925050|ref|ZP_07140968.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 182-1]
 gi|300940764|ref|ZP_07155310.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 21-1]
 gi|300980106|ref|ZP_07174849.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 45-1]
 gi|300995465|ref|ZP_07181113.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 200-1]
 gi|301027295|ref|ZP_07190641.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 69-1]
 gi|301027721|ref|ZP_07191031.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 196-1]
 gi|301049251|ref|ZP_07196224.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 185-1]
 gi|306812142|ref|ZP_07446340.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli NC101]
 gi|331648709|ref|ZP_08349797.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli M605]
 gi|331659089|ref|ZP_08360031.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli TA206]
 gi|34222570|sp|Q8FE27|RDGB_ECOL6 RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|26109783|gb|AAN81988.1|AE016766_76 HAM1 protein homolog [Escherichia coli CFT073]
 gi|91073910|gb|ABE08791.1| HAM1-like protein [Escherichia coli UTI89]
 gi|110344695|gb|ABG70932.1| hypothetical protein YggV [Escherichia coli 536]
 gi|115514305|gb|ABJ02380.1| putative ribosomal protein [Escherichia coli APEC O1]
 gi|190907861|gb|EDV67454.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli F11]
 gi|194424184|gb|EDX40171.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli 101-1]
 gi|218366714|emb|CAR04471.1| dITP/XTP pyrophosphatase [Escherichia coli S88]
 gi|218428642|emb|CAR09571.2| dITP/XTP pyrophosphatase [Escherichia coli ED1a]
 gi|226899433|gb|EEH85692.1| nucleoside-triphosphatase rdgB [Escherichia sp. 3_2_53FAA]
 gi|227834778|gb|EEJ45244.1| nucleoside-triphosphatase [Escherichia coli 83972]
 gi|281179963|dbj|BAI56293.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|294492596|gb|ADE91352.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli IHE3034]
 gi|299879157|gb|EFI87368.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 196-1]
 gi|300298947|gb|EFJ55332.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 185-1]
 gi|300304827|gb|EFJ59347.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 200-1]
 gi|300395101|gb|EFJ78639.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 69-1]
 gi|300409363|gb|EFJ92901.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 45-1]
 gi|300418796|gb|EFK02107.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 182-1]
 gi|300454464|gb|EFK17957.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 21-1]
 gi|305854180|gb|EFM54618.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli NC101]
 gi|307554936|gb|ADN47711.1| non-canonical purine NTP pyrophosphatase [Escherichia coli ABU
           83972]
 gi|307625472|gb|ADN69776.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli UM146]
 gi|315289498|gb|EFU48893.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 110-3]
 gi|315293932|gb|EFU53284.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 153-1]
 gi|315295643|gb|EFU54966.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 16-3]
 gi|320195073|gb|EFW69702.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli WV_060327]
 gi|323188652|gb|EFZ73937.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli RN587/1]
 gi|323951608|gb|EGB47483.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli H252]
 gi|323957322|gb|EGB53044.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli H263]
 gi|323960753|gb|EGB56374.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli H489]
 gi|324011795|gb|EGB81014.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 60-1]
 gi|330908989|gb|EGH37503.1| nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Escherichia coli AA86]
 gi|331042456|gb|EGI14598.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli M605]
 gi|331053671|gb|EGI25700.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli TA206]
          Length = 197

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 68/215 (31%), Positives = 104/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++     +QK+   ++          
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQ---KNLQKLLETMKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|239827936|ref|YP_002950560.1| nucleoside-triphosphatase [Geobacillus sp. WCH70]
 gi|239808229|gb|ACS25294.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacillus sp. WCH70]
          Length = 202

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 102/218 (46%), Gaps = 22/218 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAA 63
           +   ++IA+ NV K  E   L+   GI   S L+  N    EETG++F ENA++K+   A
Sbjct: 1   MMKQVIIATKNVGKAREFQELLEKKGIEVKSLLDFPNCPDVEETGSTFAENAVLKAEAMA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
                  ++DDSGL ID LDG+PG++SAR+A     ++      + I   L         
Sbjct: 61  HYFHAIVIADDSGLSIDALDGRPGVYSARYAGEEKNDQ------KNIAKVLEELKGIPFE 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F   L++A P        G   G I   P+G+ GFGYDPIF      +T  E+++
Sbjct: 115 KRTARFHCALAVAAPGRRTTVVEGTCEGYITEVPKGENGFGYDPIFYVPQKGKTMAELSK 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EEKN                +SHRA+A          I
Sbjct: 175 EEKNQ---------------ISHRAKALAKLEKQWDEI 197


>gi|152981292|ref|YP_001353023.1| xanthosine triphosphate pyrophosphatase [Janthinobacterium sp.
           Marseille]
 gi|151281369|gb|ABR89779.1| xanthosine triphosphate pyrophosphatase [Janthinobacterium sp.
           Marseille]
          Length = 194

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 61/215 (28%), Positives = 99/215 (46%), Gaps = 21/215 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +++AS+N  K+ E  +L+  +     +  E N+   EE   +F ENA+ K+  AA+
Sbjct: 1   MSRTLILASNNAGKLKEFSALLSSINFDVHAQGEFNVPEAEEPHVTFVENAIAKARHAAR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G PAL+DDSG+ ++ L G PG++SAR+A     ++  +      E  +     H    
Sbjct: 61  LTGKPALADDSGVCVNALGGAPGVYSARYAGEPKSDQRNN------EKLIADLAVHADKS 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
              + + V      D       G+ +G ++  PRGQ GFGYD  F      +T  E+T E
Sbjct: 115 AYYYCVLVFVRHADDPQPVIAEGRWNGEMLAEPRGQGGFGYDAYFWLPEQQKTAAELTAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EKN                LSHR +A +  ++   
Sbjct: 175 EKN---------------RLSHRGQALRALIEKLR 194


>gi|291561938|emb|CBL40745.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [butyrate-producing bacterium SS3/4]
          Length = 200

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 101/217 (46%), Gaps = 22/217 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAA 63
           +E+ IV A+ N  K+ E+  ++  LG    S  E  + I   E G++F  NA+IK+    
Sbjct: 1   MEHKIVFATSNAGKMREIREILKDLGAEILSMKEAGVDIDIVEDGDTFAANALIKAKAVW 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G   L+DDSGLVID L+G+PG++SAR+    T     +  +    +           
Sbjct: 61  EKTGGIVLADDSGLVIDALNGEPGVYSARYMGEKTSYEIKNWNLIHRLD------GVPEK 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+ V++   PDG      G + G+I   P G  GFGYDPI     Y +T  E+T 
Sbjct: 115 KRTARFVCVIAAVLPDGRTLTAEGTMEGVIAHEPAGAGGFGYDPILMLPEYGKTSAEITM 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +EKN                +SHR +A +        
Sbjct: 175 DEKNA---------------ISHRGKALRAMKKRLAE 196


>gi|324115031|gb|EGC08996.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           fergusonii B253]
          Length = 197

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 71/215 (33%), Positives = 106/215 (49%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  ++     +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQ---KNLQKLLETLKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G  SG+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWSGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|332162815|ref|YP_004299392.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318604344|emb|CBY25842.1| nucleoside 5-triphosphatase RdgB (dHAPTP, dITP,XTP-specific)
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325667045|gb|ADZ43689.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330859005|emb|CBX69363.1| nucleoside-triphosphatase [Yersinia enterocolitica W22703]
          Length = 197

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 107/217 (49%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ +L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNPGKVRELATLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQT 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A ++  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYAGADASDQ------QNLEKLLVALKDIPDEQR 114

Query: 126 SAHFIS--VLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F    V      D     F G+  G+I   P G  GFGYDP+F      +T  E+T 
Sbjct: 115 GAQFHCVLVYMPHAEDPTPLVFHGQWPGVIARQPSGTAGFGYDPVFYVPELGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKHA---------------VSHRGQALKLMLDALRN 196


>gi|114046765|ref|YP_737315.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella sp. MR-7]
 gi|117919638|ref|YP_868830.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella sp. ANA-3]
 gi|113888207|gb|ABI42258.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella sp. MR-7]
 gi|117611970|gb|ABK47424.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella sp. ANA-3]
          Length = 205

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 102/217 (47%), Gaps = 24/217 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  K+ E D ++   G+      + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MQQIVLASGNKGKLAEFDQMLAAYGVKVLPQSQFNVSEVAETGTTFVENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D+L G PGI+SAR+A  N  ++D  +        L      +PA R
Sbjct: 61  TGLAAIADDSGLEVDLLQGAPGIYSARYAGENAKDQDNVLK-------LLDTLKDNPAPR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL       D           G I +  RG  G GYDPIF P  +D +  +M+ 
Sbjct: 114 TARFQCVLVYMRHAKDPTPIICQASWEGQIDFVQRGDNGHGYDPIFIPEHHDCSAAQMSS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +EKN                LSHR +A    +     
Sbjct: 174 DEKNA---------------LSHRGKALVQLIAAMQE 195


>gi|293449284|ref|ZP_06663705.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Escherichia coli B088]
 gi|291322374|gb|EFE61803.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Escherichia coli B088]
 gi|323946548|gb|EGB42571.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli H120]
          Length = 197

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 106/215 (49%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  ++     +QK+   L+    +     
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQ---KNLQKLLETLKDVPDNQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGMITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|24374869|ref|NP_718912.1| HAM1 protein [Shewanella oneidensis MR-1]
 gi|62900298|sp|Q8EBY7|NTPA_SHEON RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|24349567|gb|AAN56356.1|AE015773_1 HAM1 protein [Shewanella oneidensis MR-1]
          Length = 205

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 100/217 (46%), Gaps = 24/217 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  K+ E D ++   G+      + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MQQIVLASGNKGKLAEFDQMLAAYGVKVLPQSQFNVSEVAETGTTFVENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  A++DDSGL +D+L G PGI+SAR+A  N  ++D  +        L       PA R
Sbjct: 61  TGHAAIADDSGLEVDLLQGVPGIYSARYAGENAKDQDNVLK-------LLDTLKDYPAPR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL       D           G I +  RG  G GYDPIF P  +D +  +M+ 
Sbjct: 114 TARFQCVLVYMRHAKDPTPIICQASWEGQIDFVQRGDNGHGYDPIFIPEHHDCSAAQMSS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +EKN                LSHR +A    +     
Sbjct: 174 DEKN---------------TLSHRGKALVQLITAMQE 195


>gi|325299391|ref|YP_004259308.1| Nucleoside-triphosphatase rdgB [Bacteroides salanitronis DSM 18170]
 gi|324318944|gb|ADY36835.1| Nucleoside-triphosphatase rdgB [Bacteroides salanitronis DSM 18170]
          Length = 195

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 109/217 (50%), Gaps = 27/217 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTA 62
           ++  +V A++N  K+ E+ +++    +   S  ++N    IPE T ++ E NA +K+   
Sbjct: 1   MKKKLVFATNNAHKLEEIRAILGDK-LEILSLNDINCHADIPE-TADTLEGNARLKAGYI 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            +N GM   +DD+GL ++ L G PGI+SAR+A     +   +  M+K+ + +  K     
Sbjct: 59  YQNYGMDCFADDTGLEVEALGGAPGIYSARYAGGEGHDS--EANMRKLLSEMEGKENRRA 116

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
            FR+A  +        +G    F G V G I+   RG  GFGYDP+FQP GY  TF EM 
Sbjct: 117 RFRTAICL------IENGKEHLFEGIVQGNIIEARRGTAGFGYDPVFQPEGYAETFAEMG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            EEKN                +SHRARA +  V+   
Sbjct: 171 NEEKNK---------------ISHRARAVQQLVEYLR 192


>gi|218550201|ref|YP_002383992.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia
           fergusonii ATCC 35469]
 gi|218357742|emb|CAQ90386.1| dITP/XTP pyrophosphatase [Escherichia fergusonii ATCC 35469]
 gi|325498511|gb|EGC96370.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia
           fergusonii ECD227]
          Length = 197

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 106/215 (49%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  ++     +QK+   ++          
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQ---KNLQKLLETMKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G  SG+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWSGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|300928103|ref|ZP_07143648.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 187-1]
 gi|300463869|gb|EFK27362.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 187-1]
          Length = 197

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 105/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  ++     +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQ---KNLQKLLETLKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGMITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|331654466|ref|ZP_08355466.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli M718]
 gi|331047848|gb|EGI19925.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli M718]
          Length = 197

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 105/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  ++     +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQ---KNLQKLLETLKDVPDEQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|296104618|ref|YP_003614764.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295059077|gb|ADF63815.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 197

 Score =  155 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 103/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLNDFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDFLGGAPGIYSARYSGVDATDQ------QNLEKLLVALKDVPDEQR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGK--VSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL                   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 TAQFHCVLVYMRHAEDPTPVVCHGSWPGVITREAAGNGGFGYDPIFFVPTEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR RA K  ++    
Sbjct: 175 EEKSA---------------ISHRGRALKLLLEALRN 196


>gi|320656643|gb|EFX24539.1| dITP/XTP pyrophosphatase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
          Length = 197

 Score =  155 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 71/215 (33%), Positives = 106/215 (49%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G+PGI+SAR++  +  ++     +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDVLGGEPGIYSARYSGEDATDQ---KNLQKLLETLKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|37525145|ref|NP_928489.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|62900255|sp|Q7N7H2|NTPA_PHOLL RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|36784571|emb|CAE13471.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 197

 Score =  155 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 73/217 (33%), Positives = 104/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+  L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNPGKVRELAQLLADFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAQV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D+L G PGI+SAR+A  N  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLSVDILGGAPGIYSARYAGENATDQ------QNLEKLLDTMKDIPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  G I     G  GFGYDPIF       T  E+T 
Sbjct: 115 QAQFNCVLVYIRHAEDPTPLVFHGRWPGFIAHKSAGNGGFGYDPIFYIPELGCTAAELTG 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           E+KN                +SHR +A K  +D    
Sbjct: 175 EQKNA---------------VSHRGQALKMMLDTLRN 196


>gi|85708631|ref|ZP_01039697.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Erythrobacter sp. NAP1]
 gi|85690165|gb|EAQ30168.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Erythrobacter sp. NAP1]
          Length = 211

 Score =  155 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 93/221 (42%), Positives = 130/221 (58%), Gaps = 23/221 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RKL   ++VIA+HN  K+ E+ +L+ P G+   SA  L L  P ETG +F +NA+IK+ +
Sbjct: 3   RKLGGGSLVIATHNPGKLKEISALLDPYGMKCISAGSLGLPEPPETGTTFAQNALIKARS 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGE----RDFDMAMQKIENALRSK 117
           AA+ +G+ AL+DDSGL +D L G+PG+++A WAE    E    RD+ MAM K+E  L+  
Sbjct: 63  AAEASGLAALADDSGLSVDALGGRPGVYTADWAERQWFEGDPGRDWYMAMGKVEGMLQQL 122

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQP--NGYD 175
                  R+A F  VL++AWPDG    + GK  G + WPPRG++GFGYDP+F P     D
Sbjct: 123 GPDT--DRTAAFHCVLAVAWPDGEHAVYEGKCPGSLTWPPRGEMGFGYDPVFVPSARDGD 180

Query: 176 RTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +TF E+   EK+                +SHRA AF   V 
Sbjct: 181 QTFAEIDPSEKHA---------------ISHRADAFAKLVA 206


>gi|218701664|ref|YP_002409293.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli IAI39]
 gi|218706469|ref|YP_002413988.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli UMN026]
 gi|293406461|ref|ZP_06650387.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia coli
           FVEC1412]
 gi|298382198|ref|ZP_06991795.1| nucleoside-triphosphatase rdgB [Escherichia coli FVEC1302]
 gi|300900229|ref|ZP_07118413.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 198-1]
 gi|218371650|emb|CAR19489.1| dITP/XTP pyrophosphatase [Escherichia coli IAI39]
 gi|218433566|emb|CAR14469.1| dITP/XTP pyrophosphatase [Escherichia coli UMN026]
 gi|291426467|gb|EFE99499.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia coli
           FVEC1412]
 gi|298277338|gb|EFI18854.1| nucleoside-triphosphatase rdgB [Escherichia coli FVEC1302]
 gi|300356245|gb|EFJ72115.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 198-1]
          Length = 197

 Score =  155 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 69/215 (32%), Positives = 104/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++     +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQ---KNLQKLLETLKDVPDEQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGMITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|74313511|ref|YP_311930.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           sonnei Ss046]
 gi|73856988|gb|AAZ89695.1| putative ribosomal protein [Shigella sonnei Ss046]
 gi|323167994|gb|EFZ53683.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella sonnei 53G]
          Length = 197

 Score =  155 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 69/215 (32%), Positives = 104/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARYAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++     +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQ---KNLQKLLETLKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|322418586|ref|YP_004197809.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacter sp. M18]
 gi|320124973|gb|ADW12533.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Geobacter sp. M18]
          Length = 207

 Score =  155 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 74/216 (34%), Positives = 112/216 (51%), Gaps = 22/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              +++AS N  K+ E   L+  +     S  +   L   EE G++FE NA+ K+L+AA+
Sbjct: 1   MKELLVASGNKGKLREFGELLRGVVDTILSPADFPELPEVEEDGDTFEANAIKKALSAAR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G P L+DDSGL +D L G+PG+ SAR+A  +  + D +  +      LR         
Sbjct: 61  FTGKPVLADDSGLCVDYLGGRPGVFSARFAGESASDADNNALL------LRELAGVPSEN 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F  V++L  PDG  ++F G + G+I+  PRG+ GFGYDP+F    Y +TF E+  E
Sbjct: 115 RTAAFHCVIALCLPDGSCQSFDGMLPGVILEAPRGEGGFGYDPLFLVPEYGQTFSELPME 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            KN               ++SHR RA +   +   R
Sbjct: 175 IKN---------------VISHRGRAMQMLKEALER 195


>gi|15803493|ref|NP_289526.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 EDL933]
 gi|15833084|ref|NP_311857.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia coli
           O157:H7 str. Sakai]
 gi|168760096|ref|ZP_02785103.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4501]
 gi|168785812|ref|ZP_02810819.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC869]
 gi|168797529|ref|ZP_02822536.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC508]
 gi|217326851|ref|ZP_03442934.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. TW14588]
 gi|261226266|ref|ZP_05940547.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256476|ref|ZP_05949009.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. FRIK966]
 gi|291284275|ref|YP_003501093.1| Nucleoside-triphosphatase rdgB [Escherichia coli O55:H7 str.
           CB9615]
 gi|22653754|sp|Q8XCU5|RDGB_ECO57 RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|12517500|gb|AAG58085.1|AE005525_11 putative ribosomal protein [Escherichia coli O157:H7 str. EDL933]
 gi|13363302|dbj|BAB37253.1| putative ribosomal protein [Escherichia coli O157:H7 str. Sakai]
 gi|189369422|gb|EDU87838.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4501]
 gi|189373992|gb|EDU92408.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC869]
 gi|189379716|gb|EDU98132.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC508]
 gi|209760018|gb|ACI78321.1| putative ribosomal protein [Escherichia coli]
 gi|209760020|gb|ACI78322.1| putative ribosomal protein [Escherichia coli]
 gi|209760022|gb|ACI78323.1| putative ribosomal protein [Escherichia coli]
 gi|209760024|gb|ACI78324.1| putative ribosomal protein [Escherichia coli]
 gi|217319218|gb|EEC27643.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. TW14588]
 gi|290764148|gb|ADD58109.1| Nucleoside-triphosphatase rdgB [Escherichia coli O55:H7 str.
           CB9615]
 gi|320189303|gb|EFW63962.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. EC1212]
 gi|320640600|gb|EFX10139.1| dITP/XTP pyrophosphatase [Escherichia coli O157:H7 str. G5101]
 gi|320645847|gb|EFX14832.1| dITP/XTP pyrophosphatase [Escherichia coli O157:H- str. 493-89]
 gi|320651147|gb|EFX19587.1| dITP/XTP pyrophosphatase [Escherichia coli O157:H- str. H 2687]
 gi|320662162|gb|EFX29563.1| dITP/XTP pyrophosphatase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320667237|gb|EFX34200.1| dITP/XTP pyrophosphatase [Escherichia coli O157:H7 str. LSU-61]
 gi|326338958|gb|EGD62773.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. 1044]
 gi|326343160|gb|EGD66928.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. 1125]
          Length = 197

 Score =  155 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 71/215 (33%), Positives = 105/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  ++     +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQ---KNLQKLLETLKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|254448519|ref|ZP_05061979.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [gamma
           proteobacterium HTCC5015]
 gi|198261902|gb|EDY86187.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [gamma
           proteobacterium HTCC5015]
          Length = 200

 Score =  155 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 99/218 (45%), Gaps = 23/218 (10%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTA 62
           K+  N +V+AS N  K+ EM +L+  LG+        N    +ETG SF ENA+IK+  A
Sbjct: 2   KIRSNKLVLASGNQGKLKEMQALLESLGLEVLPQSNFNTPEADETGLSFVENAIIKARNA 61

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           AK +G  +++DDSGL +D L G PGI+SAR++     +   +         L        
Sbjct: 62  AKYSGWVSVADDSGLEVDFLKGAPGIYSARYSGPEATDETNNK------KLLYELRGIPE 115

Query: 123 AFRSAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             R A F   L+L   +             G I+  P+G+ GFGYDP+F       +  E
Sbjct: 116 GQRGARFHCALALVRHEDDPAPLIVHRTWEGRILESPQGEQGFGYDPLFFVPSEGCSSAE 175

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           +  E KN                +SHR +A +  ++  
Sbjct: 176 LDRELKN---------------RISHRGQAMQALLEKL 198


>gi|119475404|ref|ZP_01615757.1| putative deoxyribonucleotide triphosphate pyrophosphatase [marine
           gamma proteobacterium HTCC2143]
 gi|119451607|gb|EAW32840.1| putative deoxyribonucleotide triphosphate pyrophosphatase [marine
           gamma proteobacterium HTCC2143]
          Length = 199

 Score =  155 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 69/216 (31%), Positives = 96/216 (44%), Gaps = 23/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS NV K+ E   L+   G       + N+   EETG +F ENA+IK+  AA+ 
Sbjct: 1   MQKIVLASGNVGKLKEFQQLLSGCGFDVVPQSDFNVPEAEETGLTFVENAIIKARNAAQY 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +  L+G+PGI+SAR++  N  +   +         L          R
Sbjct: 61  TGLPAIADDSGLEVAALNGQPGIYSARFSGPNATDETNNT------KLLSELTNIPKHQR 114

Query: 126 SAHFIS--VLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            AH+    V      D       G+  G I+   RG  GFGYDP+F    Y  +  EM  
Sbjct: 115 LAHYQCLLVFIRHATDSTPIICQGRWDGAILLEARGVGGFGYDPLFWVADYSCSAAEMEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             KN                +SHR RA    +D   
Sbjct: 175 AIKN---------------TISHRGRAMAALLDQLK 195


>gi|145635166|ref|ZP_01790871.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae PittAA]
 gi|145267587|gb|EDK07586.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae PittAA]
          Length = 195

 Score =  155 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 102/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A D   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHIAQDKRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECHGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETA 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A     +  
Sbjct: 177 EKKK---------------ISHRAKALNILKNKL 195


>gi|323978751|gb|EGB73832.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli TW10509]
          Length = 197

 Score =  155 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 106/215 (49%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  ++     +QK+   L+    +     
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQ---KNLQKLLETLKDVPDNQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPVGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|157155704|ref|YP_001464307.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli E24377A]
 gi|191167916|ref|ZP_03029719.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli B7A]
 gi|193063581|ref|ZP_03044670.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli E22]
 gi|194426340|ref|ZP_03058895.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli B171]
 gi|194431748|ref|ZP_03064039.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Shigella dysenteriae 1012]
 gi|209920413|ref|YP_002294497.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli SE11]
 gi|218696552|ref|YP_002404219.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli 55989]
 gi|260869641|ref|YP_003236043.1| dITP/XTP pyrophosphatase [Escherichia coli O111:H- str. 11128]
 gi|300815576|ref|ZP_07095800.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 107-1]
 gi|300824811|ref|ZP_07104915.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 119-7]
 gi|300906482|ref|ZP_07124177.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 84-1]
 gi|300921296|ref|ZP_07137665.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 115-1]
 gi|301306563|ref|ZP_07212625.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 124-1]
 gi|307310425|ref|ZP_07590073.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli W]
 gi|309794043|ref|ZP_07688468.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 145-7]
 gi|331669700|ref|ZP_08370546.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli TA271]
 gi|331678948|ref|ZP_08379622.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli H591]
 gi|157077734|gb|ABV17442.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli E24377A]
 gi|190902001|gb|EDV61747.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli B7A]
 gi|192930858|gb|EDV83463.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli E22]
 gi|194415648|gb|EDX31915.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli B171]
 gi|194420104|gb|EDX36182.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Shigella dysenteriae 1012]
 gi|195183147|dbj|BAG66692.1| putative ribosomal protein [Escherichia coli O111:H-]
 gi|209913672|dbj|BAG78746.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218353284|emb|CAU99247.1| dITP/XTP pyrophosphatase [Escherichia coli 55989]
 gi|257765997|dbj|BAI37492.1| dITP/XTP pyrophosphatase [Escherichia coli O111:H- str. 11128]
 gi|300401725|gb|EFJ85263.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 84-1]
 gi|300411758|gb|EFJ95068.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 115-1]
 gi|300522718|gb|EFK43787.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 119-7]
 gi|300531505|gb|EFK52567.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 107-1]
 gi|300838181|gb|EFK65941.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 124-1]
 gi|306909320|gb|EFN39815.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli W]
 gi|308122450|gb|EFO59712.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 145-7]
 gi|315062260|gb|ADT76587.1| dITP/XTP pyrophosphatase [Escherichia coli W]
 gi|315256846|gb|EFU36814.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 85-1]
 gi|320181041|gb|EFW55962.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           boydii ATCC 9905]
 gi|320202618|gb|EFW77188.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli EC4100B]
 gi|323162600|gb|EFZ48447.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli E128010]
 gi|323180414|gb|EFZ65966.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 1180]
 gi|323377156|gb|ADX49424.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli KO11]
 gi|324017227|gb|EGB86446.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 117-3]
 gi|331063368|gb|EGI35281.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli TA271]
 gi|331073778|gb|EGI45099.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli H591]
 gi|332087623|gb|EGI92750.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella dysenteriae 155-74]
          Length = 197

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 104/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  +      +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATD---LKNLQKLLETLKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|312128052|ref|YP_003992926.1| non-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311778071|gb|ADQ07557.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 203

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 69/220 (31%), Positives = 101/220 (45%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
              +++A+ N  K  E+  LI        +  + +  I   E G +FEENA+ K+     
Sbjct: 1   MRKLLVATKNEGKAKEIKQLIGSYFDDVVTLNDFDSSINIIEDGRTFEENALKKAKMIYT 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL +D L G+PG+ SAR+A  N  +        +I+  L          
Sbjct: 61  LFRQPTLADDSGLEVDALGGRPGVMSARYAGENATDE------DRIKKLLDELKDVPEEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F+ VL      G +    G   G I + PRG+ GFGYDP+F P+G+DRTF E+  +
Sbjct: 115 RCAQFVCVLIFIDQQGRIYQTKGICRGKIAFEPRGENGFGYDPVFVPDGFDRTFAELDSQ 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
            KN                +SHRA+AF+        I  +
Sbjct: 175 IKNQ---------------ISHRAKAFENLKKILGEIYNE 199


>gi|221632750|ref|YP_002521972.1| non-canonical purine NTP pyrophosphatase [Thermomicrobium roseum
           DSM 5159]
 gi|221155492|gb|ACM04619.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermomicrobium roseum DSM 5159]
          Length = 210

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 89/216 (41%), Positives = 122/216 (56%), Gaps = 22/216 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           +  + IV+A+ N  KI E+ SL+ P  +   SA  L + +P ETG +F ENA++K+  AA
Sbjct: 1   MPTHRIVLATANPGKIRELRSLLPP-NVEVVSAPALGIRLPPETGETFVENALLKARVAA 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           + +G+ AL+DDSGL +D L G+PG+HSAR+A  +  +       Q I   LR       +
Sbjct: 60  QESGLIALADDSGLEVDALGGRPGVHSARYAGEHADDA------QNIARLLRELRDVPLS 113

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F +V+++  PDG      G V G I   PRG+ GFGYDP+F P GYDRTF EMT 
Sbjct: 114 QRTARFRAVVAIVAPDGREAVVEGTVEGCIAEKPRGRGGFGYDPVFIPCGYDRTFAEMTL 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EEKN                LSHRA+A +  V   L
Sbjct: 174 EEKN---------------RLSHRAQALQRAVPILL 194


>gi|229525147|ref|ZP_04414552.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae bv. albensis VL426]
 gi|229338728|gb|EEO03745.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           cholerae bv. albensis VL426]
          Length = 200

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVPEAAETGTTFIENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         +   L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYAGEHASD------GDNLNKLLAAMQDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL L     D       GK  G I+  P G  GFGYDPIF     +    E+  
Sbjct: 115 SARFHCVLVLMRHADDPTPIVCHGKWEGKILTAPHGSNGFGYDPIFWAPEENCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 VRK---------------KQLSHRGKALQKLFKAIEE 196


>gi|261342371|ref|ZP_05970229.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Enterobacter cancerogenus ATCC 35316]
 gi|288315006|gb|EFC53944.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Enterobacter cancerogenus ATCC 35316]
          Length = 197

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 103/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLNDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAQF 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDYLGGAPGIYSARYSGEDATDQ------QNLEKLLVALKDVPDDQR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGK--VSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL                   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 TAQFHCVLVYLRHAEDPTPVVCHGSWPGVIAREAAGSGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR RA K  ++    
Sbjct: 175 EEKSA---------------ISHRGRALKLLLEALRN 196


>gi|229844961|ref|ZP_04465098.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae 6P18H1]
 gi|229812095|gb|EEP47787.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae 6P18H1]
          Length = 195

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 102/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A D   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHIAQDKRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECHGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETA 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A     +  
Sbjct: 177 EKKK---------------ISHRAKALSVLKNKL 195


>gi|160878527|ref|YP_001557495.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Clostridium phytofermentans ISDg]
 gi|160427193|gb|ABX40756.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium phytofermentans ISDg]
          Length = 193

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 69/214 (32%), Positives = 103/214 (48%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
              I+ A+ N  K+ E+  ++  L     S  E  + I  EETG +FEENA+IK+ T  +
Sbjct: 1   MRKIIFATSNEGKMREIRMILKDLDYEVVSMKEAGIDISIEETGTTFEENAIIKAKTIME 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G   L+DDSGL +D L+  PG++SAR+   +T     +       + L          
Sbjct: 61  MTGEIVLADDSGLEVDYLEKAPGVYSARYLGEDTSYDIKN------NHILSLLEGVAEEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           RSA F+ V++ AWP+G ++     + G I +   G+ GFGYDPIF    Y  T  E+T E
Sbjct: 115 RSARFVCVIACAWPNGEIKVKRATIEGNIGYEIAGENGFGYDPIFVVPEYGCTTAELTAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           +KN                +SHRA+A     +  
Sbjct: 175 QKN---------------TISHRAKALNAMKEEL 193


>gi|323183525|gb|EFZ68922.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 1357]
 gi|324119749|gb|EGC13629.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli E1167]
          Length = 197

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 104/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  +      +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATD---LKNLQKLLETLKDVQDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|152979529|ref|YP_001345158.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Actinobacillus succinogenes 130Z]
 gi|150841252|gb|ABR75223.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Actinobacillus succinogenes 130Z]
          Length = 199

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 69/218 (31%), Positives = 103/218 (47%), Gaps = 21/218 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  AAK
Sbjct: 1   MKQKIVLATGNQGKVKEMADVLADFGFEVIAQTDLGIESPEETGLTFVENAVLKARYAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+A  +  E          +  LR         
Sbjct: 61  ASGLPAIADDSGLVVPALNGAPGLYSARYAGVDGDE----ADALNRQKLLREMANLTDEG 116

Query: 125 RSAHF--ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F    VL     D       G+  G+I+   +G  GFGYD +F       TF E+ 
Sbjct: 117 RQAKFVSCIVLLRHETDPTPVIAEGECPGMIIHEEKGDNGFGYDSLFFSPEKGCTFAELE 176

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             EK                 +SHRARA     +   +
Sbjct: 177 TAEKKK---------------ISHRARALAVLKEKLSK 199


>gi|260857087|ref|YP_003230978.1| dITP/XTP pyrophosphatase [Escherichia coli O26:H11 str. 11368]
 gi|257755736|dbj|BAI27238.1| dITP/XTP pyrophosphatase [Escherichia coli O26:H11 str. 11368]
          Length = 197

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 104/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  +      +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATD---LKNLQKLLETLKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTHEE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|152998329|ref|YP_001343164.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Marinomonas sp. MWYL1]
 gi|150839253|gb|ABR73229.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Marinomonas sp. MWYL1]
          Length = 204

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 74/218 (33%), Positives = 105/218 (48%), Gaps = 23/218 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   IV+AS+N  KI E ++L+  +GI      E N+   EETG SF ENA++K+  A  
Sbjct: 1   MNKTIVLASNNAGKIKEFNALLGDMGIDIKPQSEFNVEEAEETGLSFIENAILKARNACA 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           + G+PAL+DDSG+ +D LDG PGI+SAR+A  +      +  +      L          
Sbjct: 61  HTGLPALADDSGIEVDYLDGAPGIYSARFAGEHGDNDANNKLL------LEKLEGVPELE 114

Query: 125 RSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R+A F  VL+      D   + F G   G I+    GQ GFGYDPIF       +   + 
Sbjct: 115 RTARFHCVLAYMRHKDDPTPQVFHGVWEGRILTSAEGQEGFGYDPIFYVPECACSAASLP 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +E KN                +SHRA+A K    N  +
Sbjct: 175 KEVKNQ---------------ISHRAKALKQLFANFQQ 197


>gi|300113392|ref|YP_003759967.1| non-canonical purine NTP pyrophosphatase [Nitrosococcus watsonii
           C-113]
 gi|299539329|gb|ADJ27646.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Nitrosococcus watsonii C-113]
          Length = 200

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 105/217 (48%), Gaps = 19/217 (8%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           +    IV+ASHN  K+ E+  ++  LG+   S    ++    E+G SF ENA++K+ TA 
Sbjct: 1   MSSAKIVLASHNPGKLREIGEVLNELGMEAISQSAFSVPEAVESGLSFVENALLKARTAT 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           ++ G+ A++DDSGL +D L G+PGIHSAR+A     ++     ++K+   L+      P 
Sbjct: 61  QHTGLAAIADDSGLEVDALGGQPGIHSARYAGPKATDQ---KNLEKLLKNLKEVP-EQPF 116

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
                 + V    W D       G   G I+  P+G  GFGYDPIF    +  T  E++ 
Sbjct: 117 HARYQCVIVYMRHWQDPTPLICQGTWEGQILLAPQGNGGFGYDPIFYLPQHHCTAAELSP 176

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            EKN                LSHR +A +  +D    
Sbjct: 177 PEKN---------------RLSHRGKALRALLDVLRE 198


>gi|168264451|ref|ZP_02686424.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168463710|ref|ZP_02697627.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|200388967|ref|ZP_03215579.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|195633550|gb|EDX51964.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|199606065|gb|EDZ04610.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205347034|gb|EDZ33665.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
          Length = 197

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA+IK+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAIIKARHAAKM 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  N  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQ------QNLEKLLHTLRDVPDDKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 QARFHCVLVYLRHAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLDALRN 196


>gi|300690923|ref|YP_003751918.1| nucleoside-triphosphate diphosphatase [Ralstonia solanacearum
           PSI07]
 gi|299077983|emb|CBJ50624.1| Nucleoside-triphosphate diphosphatase [Ralstonia solanacearum
           PSI07]
          Length = 201

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 102/218 (46%), Gaps = 19/218 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS+N  K+ E ++L+ PLG+  T   EL +   EE   +F ENA+ K+  A++ 
Sbjct: 1   MRRIVLASNNPGKLAEFNTLLAPLGMDVTPQGELGIPEAEEPHATFVENALAKARHASRL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           AG+PAL+DDSG+    L G PG++SAR+A+     +       ++   L         + 
Sbjct: 61  AGLPALADDSGICAHALGGAPGVYSARYAQLAGEPKSDAANNARLVRELTGHTDRGAHY- 119

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + V      D       G   G ++  PRG  GFGYDP F      +T  E+++ E
Sbjct: 120 --VCVLVYVRHADDPQPIIAEGNWFGEVIDAPRGDGGFGYDPHFLLPDLGKTAAELSKAE 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           KN                +SHRA+A    V+   R+ E
Sbjct: 178 KNA---------------VSHRAQALAQLVERL-RLFE 199


>gi|205354026|ref|YP_002227827.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|205273807|emb|CAR38802.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326629139|gb|EGE35482.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
          Length = 197

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 74/217 (34%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKM 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  N  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQ------QNLEKLLHTLRDVPDDKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 QARFHCVLVYLRHAEDPTPIVCHGSWPGVITRQEAGNGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLDALRN 196


>gi|68248866|ref|YP_247978.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae 86-028NP]
 gi|68057065|gb|AAX87318.1| predicted xanthosine triphosphate pyrophosphatase [Haemophilus
           influenzae 86-028NP]
          Length = 195

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 102/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A D   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHVAKDQRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETA 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A     +  
Sbjct: 177 EKKK---------------ISHRAKALNILKNKL 195


>gi|325859777|ref|ZP_08172907.1| non-canonical purine NTP pyrophosphatase RdgB [Prevotella denticola
           CRIS 18C-A]
 gi|325482703|gb|EGC85706.1| non-canonical purine NTP pyrophosphatase RdgB [Prevotella denticola
           CRIS 18C-A]
          Length = 196

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 110/218 (50%), Gaps = 25/218 (11%)

Query: 5   IENNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           +   IV A++N  K+ E+  ++     I++ + +  +  IPE TG + +ENA  KS    
Sbjct: 1   MNMKIVFATNNKHKLEEIKEILGKDFEIVSLAEIGCHEDIPE-TGLTLQENARQKSTYVV 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           ++      +DD+GL +D L G+PG+HSAR+AE    + D +  M K+ + +         
Sbjct: 60  EHYRQNCFADDTGLEVDALGGEPGVHSARYAE--GTDHDSEANMHKLLSKMAGVE----- 112

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F +V+SL         F G+V G I     G  GFGYDPIF P GYD++F E+ E
Sbjct: 113 NRTARFRTVISLIIDGVE-HQFEGRVDGHIATEKHGSEGFGYDPIFIPEGYDKSFAELGE 171

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           E KN                +SHRA+A K   +   ++
Sbjct: 172 EVKNK---------------ISHRAKAVKKLAEYLRKV 194


>gi|16766404|ref|NP_462019.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|56415041|ref|YP_152116.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|161506345|ref|YP_001573457.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|161616067|ref|YP_001590032.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Paratyphi B
           str. SPB7]
 gi|167990370|ref|ZP_02571470.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168234346|ref|ZP_02659404.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168236171|ref|ZP_02661229.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family protein
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168242906|ref|ZP_02667838.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168819867|ref|ZP_02831867.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|194442220|ref|YP_002042362.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194448347|ref|YP_002047091.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194472795|ref|ZP_03078779.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194736901|ref|YP_002116051.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197250440|ref|YP_002148017.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197262335|ref|ZP_03162409.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197363970|ref|YP_002143607.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|198243603|ref|YP_002217078.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|207858364|ref|YP_002245015.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|238909901|ref|ZP_04653738.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Tennessee
           str. CDC07-0191]
 gi|22653762|sp|Q8ZM45|RDGB_SALTY RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|62900167|sp|Q5PMK9|RDGB_SALPA RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|16421656|gb|AAL21978.1| putative xanthosine triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|56129298|gb|AAV78804.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|160867692|gb|ABX24315.1| hypothetical protein SARI_04542 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161365431|gb|ABX69199.1| hypothetical protein SPAB_03868 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194400883|gb|ACF61105.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194406651|gb|ACF66870.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194459159|gb|EDX47998.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194712403|gb|ACF91624.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197095447|emb|CAR61006.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197214143|gb|ACH51540.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197240590|gb|EDY23210.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197290664|gb|EDY30018.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family protein
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197938119|gb|ACH75452.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|205331210|gb|EDZ17974.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205331687|gb|EDZ18451.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205338196|gb|EDZ24960.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205343452|gb|EDZ30216.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|206710167|emb|CAR34523.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|267995268|gb|ACY90153.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 14028S]
 gi|301159658|emb|CBW19177.1| HAM1 protein homolog [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312914125|dbj|BAJ38099.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. T000240]
 gi|320087535|emb|CBY97300.1| Nucleoside-triphosphatase rdgB Nucleoside triphosphate
           phosphohydrolase; NTPase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321225776|gb|EFX50830.1| Nucleoside 5-triphosphatase RdgB dHAPTP, dITP, XTP-specific
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322613500|gb|EFY10441.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315996572]
 gi|322621092|gb|EFY17950.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-1]
 gi|322624156|gb|EFY20990.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-3]
 gi|322628105|gb|EFY24894.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-4]
 gi|322633224|gb|EFY29966.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-1]
 gi|322636198|gb|EFY32906.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-2]
 gi|322639536|gb|EFY36224.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 531954]
 gi|322647531|gb|EFY44020.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. NC_MB110209-0054]
 gi|322648715|gb|EFY45162.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. OH_2009072675]
 gi|322653770|gb|EFY50096.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. CASC_09SCPH15965]
 gi|322657876|gb|EFY54144.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 19N]
 gi|322663979|gb|EFY60178.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 81038-01]
 gi|322669010|gb|EFY65161.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MD_MDA09249507]
 gi|322672996|gb|EFY69103.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 414877]
 gi|322678013|gb|EFY74076.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 366867]
 gi|322681189|gb|EFY77222.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 413180]
 gi|322687881|gb|EFY83848.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 446600]
 gi|322716096|gb|EFZ07667.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323131459|gb|ADX18889.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 4/74]
 gi|323194923|gb|EFZ80110.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609458-1]
 gi|323199627|gb|EFZ84717.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556150-1]
 gi|323202626|gb|EFZ87666.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609460]
 gi|323207887|gb|EFZ92833.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 507440-20]
 gi|323212561|gb|EFZ97378.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556152]
 gi|323214956|gb|EFZ99704.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB101509-0077]
 gi|323222686|gb|EGA07051.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB102109-0047]
 gi|323225429|gb|EGA09661.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB110209-0055]
 gi|323230556|gb|EGA14674.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB111609-0052]
 gi|323235093|gb|EGA19179.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009083312]
 gi|323239132|gb|EGA23182.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009085258]
 gi|323244510|gb|EGA28516.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315731156]
 gi|323247125|gb|EGA31091.1| dITP/XTP pyrophosphatase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253392|gb|EGA37221.1| dITP/XTP pyrophosphatase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256301|gb|EGA40037.1| dITP/XTP pyrophosphatase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262523|gb|EGA46079.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008284]
 gi|323267381|gb|EGA50865.1| dITP/XTP pyrophosphatase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269215|gb|EGA52670.1| dITP/XTP pyrophosphatase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326624850|gb|EGE31195.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           3246]
 gi|332989970|gb|AEF08953.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. UK-1]
          Length = 197

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 74/217 (34%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKM 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  N  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQ------QNLEKLLHTLRDVPDDKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 QARFHCVLVYLRHAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLDALRN 196


>gi|224584896|ref|YP_002638695.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|224469424|gb|ACN47254.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
          Length = 197

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 74/217 (34%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKM 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  N  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQ------QNLEKLLHTLRDVPDDKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 QARFHCVLVYLRHAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAELTL 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLDALRN 196


>gi|291525411|emb|CBK90998.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Eubacterium rectale DSM 17629]
          Length = 197

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 61/218 (27%), Positives = 103/218 (47%), Gaps = 24/218 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALE--LNLIIPEETGNSFEENAMIKSLTAA 63
              I+ A+ N DK+ E+  ++    +   S  E  +N+ I E  G +FE+NA+IK+   A
Sbjct: 1   MTKIIFATGNKDKLREIKEILSDCDVDIRSMKEAGINVDIVE-DGKNFEDNALIKARAIA 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
            +     L+DDSGL ID L+ +PG++SAR+   +T     +  + +  +           
Sbjct: 60  AHTDAIVLADDSGLEIDYLNKEPGVYSARYMGEDTSYDIKNNNLIERLD------GVPKE 113

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+  ++   PDG        + G I W   G  GFGYDPIF  + Y  +  E+T 
Sbjct: 114 KRTARFVCAIAAVLPDGKELVTRQTMEGYIGWEIAGANGFGYDPIFYLDEYGCSSAELTP 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           ++KN                +SHR +A +   +  +++
Sbjct: 174 QQKNA---------------ISHRGKALRAMREMLVKV 196


>gi|332086883|gb|EGI92019.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella boydii 5216-82]
          Length = 197

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 106/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  +      ++ ++  L +        R
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATD------LKNLQKLLETLKDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 QARFHCVLIYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLDALRN 196


>gi|134300518|ref|YP_001114014.1| nucleoside-triphosphatase [Desulfotomaculum reducens MI-1]
 gi|172044339|sp|A4J7Y6|NTPA_DESRM RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|134053218|gb|ABO51189.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfotomaculum reducens MI-1]
          Length = 201

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 70/216 (32%), Positives = 108/216 (50%), Gaps = 22/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             +V+A++N  K+ E+  L+ P G    S  E       EE GN+F +NA+ K+L AA+ 
Sbjct: 1   MKLVLATNNKGKVKELAELLKPCGYQVVSIGEFPGFTEVEEDGNTFADNAIKKALAAAEF 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  AL+DDSGL +D L G PG++SAR+A     +   +         L          R
Sbjct: 61  TGELALADDSGLEVDALKGAPGVYSARFAGEPKDDTANNA------KLLSLLEGVPQDHR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F  V+++A P+G +    G   G+I+   +G+ GFGYDP+F    Y +TF E+  E+
Sbjct: 115 TARFRCVIAIAEPNGRIHTAEGSCEGVILRELKGEGGFGYDPLFYVPEYKQTFAELDMEK 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           KN                +SHR +A K  ++   R+
Sbjct: 175 KNS---------------ISHRGKALKKAMEILNRL 195


>gi|156975838|ref|YP_001446745.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           harveyi ATCC BAA-1116]
 gi|156527432|gb|ABU72518.1| hypothetical protein VIBHAR_03583 [Vibrio harveyi ATCC BAA-1116]
          Length = 200

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 99/217 (45%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A     ++      + +E  L++      A R
Sbjct: 61  TGLPAIADDSGLEVDFLKGAPGIYSARYAGEKASDQ------ENLEKLLKAMEGVPEAKR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G+ GFGYDPIF     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGKALKSLFAQLSE 196


>gi|260599283|ref|YP_003211854.1| dITP/XTP pyrophosphatase [Cronobacter turicensis z3032]
 gi|260218460|emb|CBA33597.1| Nucleoside-triphosphatase rdgB [Cronobacter turicensis z3032]
          Length = 202

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 75/222 (33%), Positives = 109/222 (49%), Gaps = 23/222 (10%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M+      +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+ 
Sbjct: 1   MQDYAMQKVVLATGNAGKVRELASLLQEFGLDVVAQTELGVESAEETGLTFIENAILKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G  A++DDSGL +D L G PGI+SAR+A S+  ++      + +E  L +    
Sbjct: 61  HAAQVTGFAAIADDSGLSVDALGGAPGIYSARYAGSDASDQ------ENLEKLLVALHDV 114

Query: 121 DPAFRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
               R A F  VL       D     F G  SG+I   P GQ GFGYDPIF      +T 
Sbjct: 115 PDEQRQAQFHCVLVYMRHADDPTPLVFHGVWSGVITRAPAGQGGFGYDPIFFIPTLGKTA 174

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            E+T EEK+                +SHR +A K  ++    
Sbjct: 175 AELTREEKSA---------------ISHRGQALKLLLEAMRN 201


>gi|52081337|ref|YP_080128.1| nucleoside-triphosphatase [Bacillus licheniformis ATCC 14580]
 gi|52786715|ref|YP_092544.1| YsnA [Bacillus licheniformis ATCC 14580]
 gi|319647245|ref|ZP_08001467.1| nucleoside-triphosphatase [Bacillus sp. BT1B_CT2]
 gi|62900190|sp|Q65GG3|NTPA_BACLD RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|52004548|gb|AAU24490.1| conserved protein YsnA [Bacillus licheniformis ATCC 14580]
 gi|52349217|gb|AAU41851.1| YsnA [Bacillus licheniformis ATCC 14580]
 gi|317390592|gb|EFV71397.1| nucleoside-triphosphatase [Bacillus sp. BT1B_CT2]
          Length = 196

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 74/216 (34%), Positives = 105/216 (48%), Gaps = 22/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAK 64
              ++IA+ N  K+ E  +++ P G    S L++      EETG +FEENA+IK+ T +K
Sbjct: 1   MKEVIIATKNEGKVREFKAMLEPRGYDVKSLLDIGYTPEIEETGQTFEENAVIKAETISK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G   ++DDSGL +D L G PG++SAR+     GE   D+A  K    L+     +   
Sbjct: 61  ETGKIVIADDSGLSVDYLGGSPGVYSARY----AGEEKNDLANLKKL--LKELEGVEKED 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           RSA F   L++  P    +   G V G I   PRG  GFGYDP+F     D+T  E++  
Sbjct: 115 RSARFRCALAICIPGQETKTVEGSVEGYITEEPRGTNGFGYDPVFLVKDKDQTMAELSSG 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EKN                +SHRA A K       +
Sbjct: 175 EKNK---------------ISHRAEALKKLSALLDQ 195


>gi|224023504|ref|ZP_03641870.1| hypothetical protein BACCOPRO_00206 [Bacteroides coprophilus DSM
           18228]
 gi|224016726|gb|EEF74738.1| hypothetical protein BACCOPRO_00206 [Bacteroides coprophilus DSM
           18228]
          Length = 192

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 103/216 (47%), Gaps = 25/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAK 64
              +V A++N  K+ E+ +++    +   S  +++      ET ++ E NA +K+    +
Sbjct: 1   MKKLVFATNNAHKLEEIRAILGDQ-VEVLSLKDIHCEADIPETADTLEGNAALKAEYVYR 59

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           N G+   +DD+GL ++ L+G PGI+SAR+A     +   +  M+K+ + +  +      F
Sbjct: 60  NYGLDCFADDTGLEVEALNGAPGIYSARYAGGEGHDS--EANMKKLLHEMEGQDNRRAQF 117

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A  +         G    F G V G I+   RG  GFGYDP+F P GY  TF EM  E
Sbjct: 118 RTAICL------IEGGKEHLFEGVVRGEIIRHRRGTSGFGYDPVFVPEGYTETFAEMGNE 171

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EKN                +SHRARA +       +
Sbjct: 172 EKNK---------------ISHRARAVQKLCAYLKK 192


>gi|330991185|ref|ZP_08315138.1| Nucleoside-triphosphatase [Gluconacetobacter sp. SXCC-1]
 gi|329761771|gb|EGG78262.1| Nucleoside-triphosphatase [Gluconacetobacter sp. SXCC-1]
          Length = 206

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 95/213 (44%), Positives = 122/213 (57%), Gaps = 23/213 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + +V+A+HN  KI E  +L+   GI   SA +L+L  PEET +SF  NA IK++ AAK A
Sbjct: 12  DTLVLATHNKGKIAEFAALLGGYGIHVRSAGDLSLPEPEETADSFAGNAAIKAVAAAKAA 71

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +PAL+DDSG  +  L G PGI SARWA     ++D+  AM++I   +          R 
Sbjct: 72  NLPALADDSGFCVSALGGAPGIFSARWAGP---DKDYPDAMRRIHEQIGDSPD-----RG 123

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A FISVL LAWPDG  E F G++ G +VWPP G  G GYDPIF P    RTF +MT+ +K
Sbjct: 124 AWFISVLCLAWPDGQTETFEGRIDGHVVWPPHGTNGHGYDPIFAPGDGARTFADMTDTQK 183

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           N                +SHR  AF  F D CL
Sbjct: 184 NA---------------ISHRGLAFALFRDACL 201


>gi|114571549|ref|YP_758229.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Maricaulis maris MCS10]
 gi|114342011|gb|ABI67291.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Maricaulis maris MCS10]
          Length = 197

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 85/214 (39%), Positives = 115/214 (53%), Gaps = 21/214 (9%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           ++    V+ASHN  KI EM+ ++ P G+   SA +L+L  PEET  +F  NA +K+  A 
Sbjct: 1   MVRETWVLASHNAGKIKEMEQILAPFGVTLKSAADLDLPEPEETETTFRGNAALKARAAC 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G+P ++DDSGL +D L G PGI+SARWA             + ++            
Sbjct: 61  EATGLPCVADDSGLAVDALGGDPGIYSARWAGEPRD------FQRAMQRVDTELSRAGVP 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+  ++LA P   V  F G+V G IVWPPRG  GFGYDPIFQP G+D TFGEM+ 
Sbjct: 115 DRTARFVCTIALARPGSEVRFFEGEVVGEIVWPPRGAGGFGYDPIFQPLGHDITFGEMSA 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           + K                 LSHRARA    +  
Sbjct: 175 DGK---------------RQLSHRARALDAMIAA 193


>gi|188996621|ref|YP_001930872.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sulfurihydrogenibium sp. YO3AOP1]
 gi|226737271|sp|B2V8P5|NTPA_SULSY RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|188931688|gb|ACD66318.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 206

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 64/222 (28%), Positives = 107/222 (48%), Gaps = 22/222 (9%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAKN 65
             I++A+ N  K+ E+  L+  L I   S  +++     EE   +F ENA+ K+ + AK 
Sbjct: 1   MKILLATTNEGKVRELRQLLKDLDIEILSLKDMDKKLEVEEDKETFLENAIKKATSYAKF 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGER-----DFDMAMQKIENALRSKFAH 120
             +P +++DSGL +D L+G PGI+SAR+ +   G+        +++  +  N    +   
Sbjct: 61  YKLPVIAEDSGLEVDALNGLPGIYSARFFDIEFGKEVLKEIPENLSKDEKNNLKLLRLLE 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +   R A + + L   +   +     G   G I + P G  GFGYDPIF P GY++T  +
Sbjct: 121 NQTNRKARYKTALV-FYNFDYGIWTEGVCEGQIAYKPEGNQGFGYDPIFIPEGYNKTMAQ 179

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           +T EEKN                +SHR +A    V+   ++ 
Sbjct: 180 LTPEEKNK---------------ISHRGKAVSKLVEILKKVL 206


>gi|301168913|emb|CBW28507.1| dITP/XTP pyrophosphatase [Haemophilus influenzae 10810]
          Length = 195

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 102/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A D   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHIAQDQRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECHGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETA 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A     +  
Sbjct: 177 EKKK---------------ISHRAKALSVLKNKL 195


>gi|315606938|ref|ZP_07881944.1| nucleoside-triphosphatase [Prevotella buccae ATCC 33574]
 gi|315251319|gb|EFU31302.1| nucleoside-triphosphatase [Prevotella buccae ATCC 33574]
          Length = 206

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 96/218 (44%), Gaps = 24/218 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAKN 65
             IV A++N  K+ E+  ++   G    S  E+       ETG + EENA+ K+     +
Sbjct: 1   MKIVFATNNAHKLKEIREILGN-GFEVVSLAEIGCHEDIPETGETLEENALQKAQYVYDH 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +   +DD+GL ++ LDG PG+HSAR+AE    + + +  M K+   L  K      FR
Sbjct: 60  YHISCFADDTGLEVEALDGAPGVHSARYAE--GTDHNSEANMAKLLRQLDGKDNRKARFR 117

Query: 126 SAHF-----ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +                    +  F G V G I     G  GFGYDP+F P GYD++F E
Sbjct: 118 TVIALIEKKDVCPCGCTSIPQIHRFEGIVEGRIATEKHGSEGFGYDPLFVPEGYDKSFAE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           + E  KN                +SHRARA     +  
Sbjct: 178 LGEHVKN---------------TISHRARAVAKLAEYL 200


>gi|226311378|ref|YP_002771272.1| nucleoside-triphosphatase [Brevibacillus brevis NBRC 100599]
 gi|226094326|dbj|BAH42768.1| nucleoside-triphosphatase [Brevibacillus brevis NBRC 100599]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 97/214 (45%), Gaps = 22/214 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKN 65
             +V+A+ N  K+ E + L    G    S  E + +    E  ++FE NA+ K++  +  
Sbjct: 5   KKVVLATRNQGKVKEFNRLFADAGWEGISLAEFDGVPEVVEDKDTFEGNALKKAIEISTY 64

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             MPAL DDSGL +D L+G+PG++SAR+A  +  +       Q     L          R
Sbjct: 65  LNMPALGDDSGLEVDALEGRPGVYSARFAGEDATDE------QNWRKLLNELEEVSTEER 118

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F   L+L  P       +G   G+I   P+G  GFGYDP+F     D+   E+  EE
Sbjct: 119 TARFRCTLALVIPGEEPIIATGACEGVIAREPKGTNGFGYDPVFYVPSMDKMMAELMPEE 178

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           KN                +SHRARA +  +    
Sbjct: 179 KNQ---------------ISHRARAMQQLLAILK 197


>gi|237807735|ref|YP_002892175.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Tolumonas auensis DSM 9187]
 gi|237499996|gb|ACQ92589.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Tolumonas auensis DSM 9187]
          Length = 196

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 66/217 (30%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+++L+  L        E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MEKVVLATGNKKKVEELNALLADLDYAVVPQSEFNVESVPETGTTFVENAIIKARHAARV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSG+ +D L G+PG++SAR+A  +  +         +E  L          R
Sbjct: 61  TGLPAIADDSGIEVDALLGRPGVYSARYAGEDASDE------DNLEKLLEDMNGVPAVLR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA +  VL       D           G +   P G+ GFGYDPIF     D T  E+  
Sbjct: 115 SARYWCVLVYMRHADDPTPIICQASWEGSLATEPTGENGFGYDPIFNVPDLDCTAAELDP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             KN                LSHR +A    V     
Sbjct: 175 ATKNS---------------LSHRGKALAKLVKALQE 196


>gi|146312999|ref|YP_001178073.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Enterobacter sp. 638]
 gi|145319875|gb|ABP62022.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Enterobacter sp. 638]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLNDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAQV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++      Q ++  L +      A R
Sbjct: 61  TGLPAIADDSGLAVDSLGGAPGIYSARYSGVDATDQ------QNLQKLLETLKDVPDAQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 QAQFHCVLVYMRHAEDPTPIVCHGSWPGVIARESAGNGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR RA K  ++    
Sbjct: 175 EEKSA---------------ISHRGRALKLLLEALRN 196


>gi|261248234|emb|CBG26071.1| HAM1 protein homolog [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 74/217 (34%), Positives = 104/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKM 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  N  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQ------QNLEKLLHTLRDVPDDKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 QARFHCVLVYLRHAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK                 +SHR +A K  +D    
Sbjct: 175 EEK---------------RAISHRGQALKLLLDALRN 196


>gi|302390318|ref|YP_003826139.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermosediminibacter oceani DSM 16646]
 gi|302200946|gb|ADL08516.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermosediminibacter oceani DSM 16646]
          Length = 198

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 72/215 (33%), Positives = 108/215 (50%), Gaps = 21/215 (9%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             ++VIA+ N  K+ E   ++  + +   S L+   I  EE+G++FEENA++K+    + 
Sbjct: 1   MMDLVIATKNRGKLKEFKEMLSDIPLNIISLLDFPGIEVEESGSTFEENAVMKAKKVLEL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ +L DDSGL +  L G+PG+H+AR+A    G+      +  I   L          R
Sbjct: 61  TGIASLGDDSGLEVAALGGRPGVHTARFAGPGAGD------VDNINKLLNELKGVPWEKR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F+  L  A PDG V    G + G+I + PRG +GFGYDP+F      +T  E T EE
Sbjct: 115 QARFVCCLCFALPDGRVFVEYGYLKGLITFEPRGTMGFGYDPVFFVPELGKTLAEATPEE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           KN                +SHRARA +    + L+
Sbjct: 175 KNA---------------VSHRARATEKIRKHILQ 194


>gi|262042606|ref|ZP_06015762.1| non-canonical purine NTP pyrophosphatase RdgB [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|259040040|gb|EEW41155.1| non-canonical purine NTP pyrophosphatase RdgB [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 104/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLEDFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGVDASDQ------QNLEKLLDALKDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E++ 
Sbjct: 115 QAQFHCVLVYLRHAEDPTPLVCHGSWPGVITRQAAGHGGFGYDPIFFVPSEGKTAAELSR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  ++    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLEALRN 196


>gi|152971906|ref|YP_001337015.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|238896485|ref|YP_002921223.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Klebsiella pneumoniae NTUH-K2044]
 gi|329998594|ref|ZP_08303178.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Klebsiella sp. MS 92-3]
 gi|150956755|gb|ABR78785.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|238548805|dbj|BAH65156.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|328538613|gb|EGF64713.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Klebsiella sp. MS 92-3]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 104/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLEDFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGVDASDQ------QNLEKLLDALKDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E++ 
Sbjct: 115 QAQFHCVLVYLRHAEDPTPLVCHGSWPGVITRQAAGHGGFGYDPIFFVPSEGKTAAELSR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  ++    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLEALRN 196


>gi|238795056|ref|ZP_04638649.1| Nucleoside-triphosphatase [Yersinia intermedia ATCC 29909]
 gi|238725604|gb|EEQ17165.1| Nucleoside-triphosphatase [Yersinia intermedia ATCC 29909]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 74/217 (34%), Positives = 109/217 (50%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+ +L+   G+   +  EL +   +ETG +F ENA++K+  AA+ 
Sbjct: 1   MQKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESADETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A ++  ++        +E  L +      A R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARFAGTDASDQ------DNLEKLLVALKDVPDAKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL       D     F G+  G+I   P G  GFGYDPIF      +T  E+T 
Sbjct: 115 SAQFHCVLVYMRHAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYIPALSKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKHA---------------VSHRGQALKLMLDALRN 196


>gi|145639829|ref|ZP_01795430.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae PittII]
 gi|145271047|gb|EDK10963.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae PittII]
          Length = 195

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 102/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A D   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHVAQDKRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETA 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A     +  
Sbjct: 177 EKKK---------------ISHRAKALSVLKNKL 195


>gi|163849852|ref|YP_001637895.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Methylobacterium extorquens PA1]
 gi|163661457|gb|ABY28824.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylobacterium extorquens PA1]
          Length = 211

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 107/219 (48%), Positives = 135/219 (61%), Gaps = 14/219 (6%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            +++   +VIA+HN  K+ EM  L+ P G+   SA EL L  P+ETG  F ENA IK+  
Sbjct: 4   HRILSGKVVIATHNAGKLVEMRELLAPFGVEAVSAGELGLPEPDETGTMFSENAAIKAHA 63

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK +G+PA +DDSGL +D LDG PG+ SARWA     ++DF  AM +I   L  + A  
Sbjct: 64  AAKASGLPAFADDSGLCVDALDGAPGLFSARWAGP---DKDFSGAMARIAAELDKRGAT- 119

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R AHF+S L LAWPDGH E F G+V G +V  P G LGFGYDP+F+P G DRTFGE+
Sbjct: 120 --DRRAHFVSALVLAWPDGHTELFEGRVFGDLV-APLGSLGFGYDPMFRPEGMDRTFGEI 176

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           + EEK+            S + LSHRARAF      CLR
Sbjct: 177 SSEEKH-------GVDWQSGNALSHRARAFVLLAQACLR 208


>gi|323701931|ref|ZP_08113600.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfotomaculum nigrificans DSM 574]
 gi|323533017|gb|EGB22887.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfotomaculum nigrificans DSM 574]
          Length = 201

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 67/216 (31%), Positives = 107/216 (49%), Gaps = 22/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             +V+A+ N  K+ E+ +++  +     SA +       EE G++F+ NA+ K+  AA+ 
Sbjct: 1   MKLVLATSNQGKVKELAAMLKDMDFEVVSARDYPGFPEVEEDGDTFKANAIKKARAAAQF 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  +L+DDSGL +D L+G PG++SAR+A     +   +         L+      PA R
Sbjct: 61  TGELSLADDSGLEVDALNGAPGVYSARFAGEPKDDAANNR------KLLKLMENVPPARR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +  F  V+++A PDG +    G   GII+   +G  GFGYDP+F    Y +TF E+   E
Sbjct: 115 TGRFRCVIAIARPDGEIYTVDGTCEGIILEELKGDGGFGYDPLFYVPAYQKTFAELDLAE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           KN                +SHR +A +  V    R+
Sbjct: 175 KN---------------TISHRGKALEKAVAILKRL 195


>gi|168747554|ref|ZP_02772576.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4113]
 gi|168753906|ref|ZP_02778913.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4401]
 gi|168766961|ref|ZP_02791968.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4486]
 gi|168773407|ref|ZP_02798414.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4196]
 gi|168781813|ref|ZP_02806820.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4076]
 gi|195937092|ref|ZP_03082474.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. EC4024]
 gi|208806883|ref|ZP_03249220.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4206]
 gi|208812337|ref|ZP_03253666.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4045]
 gi|208819503|ref|ZP_03259823.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4042]
 gi|209399636|ref|YP_002272434.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4115]
 gi|254794906|ref|YP_003079743.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O157:H7 str. TW14359]
 gi|187770849|gb|EDU34693.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4196]
 gi|188017871|gb|EDU55993.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4113]
 gi|189000591|gb|EDU69577.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4076]
 gi|189358429|gb|EDU76848.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4401]
 gi|189363708|gb|EDU82127.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4486]
 gi|208726684|gb|EDZ76285.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4206]
 gi|208733614|gb|EDZ82301.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4045]
 gi|208739626|gb|EDZ87308.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4042]
 gi|209161036|gb|ACI38469.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli O157:H7 str. EC4115]
 gi|209760026|gb|ACI78325.1| putative ribosomal protein [Escherichia coli]
 gi|254594306|gb|ACT73667.1| dITP/XTP pyrophosphatase [Escherichia coli O157:H7 str. TW14359]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 104/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SA ++  +  ++     +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSACYSGEDATDQ---KNLQKLLETLKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|242238223|ref|YP_002986404.1| deoxyribonucleotide triphosphate pyrophosphatase [Dickeya dadantii
           Ech703]
 gi|242130280|gb|ACS84582.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Dickeya
           dadantii Ech703]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 71/215 (33%), Positives = 106/215 (49%), Gaps = 23/215 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+  L+   G    +   LN+   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKLVLATGNAGKVRELAGLLADFGFDVVAQTALNVDNAEETGLTFIENAILKARHAARK 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A  +  +R      Q +E  L++        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYAGHDATDR------QNLEKLLQALENVPDEQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G+  G+I   P G+ GFGYDPIFQ     +T  +++ 
Sbjct: 115 RASFHCVLVYLRHADDPTPLVCHGRWQGMITRAPAGEGGFGYDPIFQVPSLGKTAAQLSR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EEK+                 SHR +A +  +D  
Sbjct: 175 EEKHAH---------------SHRGQALRLLLDAL 194


>gi|269960449|ref|ZP_06174822.1| HAM1 protein [Vibrio harveyi 1DA3]
 gi|269834876|gb|EEZ88962.1| HAM1 protein [Vibrio harveyi 1DA3]
          Length = 200

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 99/217 (45%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A     ++      + +E  L++      A R
Sbjct: 61  TGLPAIADDSGLEVDFLKGAPGIYSARYAGEKASDQ------ENLEKLLKAMEGVPEAER 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G+ GFGYDPIF     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGKALKSLFAQLSE 196


>gi|153835261|ref|ZP_01987928.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Vibrio
           harveyi HY01]
 gi|148868236|gb|EDL67376.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Vibrio
           harveyi HY01]
          Length = 200

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 98/217 (45%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A     ++      + +E  L +      A R
Sbjct: 61  TGLPAIADDSGLEVDFLKGAPGIYSARYAGEKASDQ------ENLEKLLTAMEGVPEADR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G+ GFGYDPIF     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGKALKSLFAQLSE 196


>gi|283788524|ref|YP_003368389.1| hypothetical protein ROD_50321 [Citrobacter rodentium ICC168]
 gi|282951978|emb|CBG91705.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAQA 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++      Q +E  LR+        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGEDASDQ------QNLEKLLRTMQEIPDDKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 QARFHCVLVYLRHADDPTPLVCHGSWPGVIAREAAGSGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  ++    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLEALRN 196


>gi|157148504|ref|YP_001455823.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Citrobacter koseri ATCC BAA-895]
 gi|157085709|gb|ABV15387.1| hypothetical protein CKO_04330 [Citrobacter koseri ATCC BAA-895]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 72/217 (33%), Positives = 106/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVIAQTELGVDSAEETGLTFIENAILKARHAAKA 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++     ++K+ + LR         R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQ---RNLEKLLHTLREVPDE---KR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 QARFHCVLVYMRHAEDPTPLVCHGSWPGMITREAAGNGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLDALRN 196


>gi|119470550|ref|ZP_01613253.1| putative inosine/xanthosine triphosphatase [Alteromonadales
           bacterium TW-7]
 gi|119446251|gb|EAW27528.1| putative inosine/xanthosine triphosphatase [Alteromonadales
           bacterium TW-7]
          Length = 199

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 101/214 (47%), Gaps = 21/214 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +V+A+ N  K+ E+ +++ PL I      + N+    ETG +F ENA+IK+  AAK
Sbjct: 1   MNKTLVLATGNPGKVSELANMLSPLSINVVPQSDFNVGEVAETGTTFVENAIIKARHAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             GMPA++DDSGL +D L+G PG++SAR+A     ++        I+  L     +    
Sbjct: 61  ITGMPAIADDSGLEVDGLNGAPGVYSARFAGQGASDQ------DNIDKLLNDLGNNPNRK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                + VL     D      S    G I     G+ GFGYDPIF     + T  E+T+ 
Sbjct: 115 ARFWCVLVLMRHADDPTPLICSASWEGEITQTQHGEGGFGYDPIFYVPSLECTSAELTKA 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           +KN                +SHR +A +  ++  
Sbjct: 175 QKNA---------------VSHRGQALQALLNEL 193


>gi|259502882|ref|ZP_05745784.1| ribonuclease PH/Ham1 protein [Lactobacillus antri DSM 16041]
 gi|259169133|gb|EEW53628.1| ribonuclease PH/Ham1 protein [Lactobacillus antri DSM 16041]
          Length = 199

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 76/215 (35%), Positives = 108/215 (50%), Gaps = 23/215 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +VIA++N  K  E   ++ P  +   +  +      +E G SFEENA IK+ TA  
Sbjct: 1   MMATLVIATNNAGKAREYREMLAPFQVTVKTLADFPPFPIDEDGTSFEENAFIKAQTAVA 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+P ++DDSGLV+D L+G PGIHSAR+A  +    +           LR       A 
Sbjct: 61  KLGLPVMADDSGLVVDALNGAPGIHSARYAGDHDDAANNAKL-------LRELAGVPAAQ 113

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGY-DRTFGEMTE 183
           R+AHF + +    PDG     +G+V G I+  PRGQ GFGYDP+F P  +  R+  E+T 
Sbjct: 114 RTAHFYTTIIALKPDGAKLETTGRVDGHILTEPRGQNGFGYDPLFMPEEFAGRSMAELTP 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            EKN                +SHR RA +  +D  
Sbjct: 174 AEKN---------------RISHRGRALRALMDQF 193


>gi|237748600|ref|ZP_04579080.1| ribonuclease PH/Ham1 protein [Oxalobacter formigenes OXCC13]
 gi|229379962|gb|EEO30053.1| ribonuclease PH/Ham1 protein [Oxalobacter formigenes OXCC13]
          Length = 194

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 96/214 (44%), Gaps = 21/214 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   I+IAS N  K+ E   ++ P G + +   E N+   +E   SF ENA+ K+   ++
Sbjct: 1   MSKEIIIASGNPGKLREFRQMLEPAGYIVSPQSEFNVSEADEPYFSFVENALNKARHVSR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G PAL+DDSGL  D L G PG+ SAR+A     +   +  +        +K A+    
Sbjct: 61  LTGKPALADDSGLCADALGGSPGVFSARYAGEPKSDLRNNQKLVADLAPYTNKAANF--- 117

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
              + + V   +  D       GK  G I+  P+G+ GFGYDP F      +T  E+  E
Sbjct: 118 ---YCVLVYVRSADDPQPVIADGKWPGEIIDVPKGENGFGYDPHFWIPELKKTAAELPPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            KN                LSHR +A +  ++  
Sbjct: 175 LKNS---------------LSHRGKALRALMEKL 193


>gi|312622867|ref|YP_004024480.1| non-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203334|gb|ADQ46661.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 204

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 68/220 (30%), Positives = 99/220 (45%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
              + +A+ N  K  E+  LI        +    +  I   E G +FEENA+ K+ T   
Sbjct: 1   MRKLFVATKNEGKAKEIKQLIGSYFDDVVTLNHFDSSINIIEDGRTFEENALKKAKTIYA 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 L+DDSGL +D L G+PG+ SAR+A     +        +I+  L        + 
Sbjct: 61  LYRQVTLADDSGLEVDALGGRPGVMSARYAGERATDE------DRIKKLLDELKDVPESK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F+ VL      G +    G   G I + PRG+ GFGYDPIF P+G+D+TF E+  +
Sbjct: 115 RGAQFVCVLVFIDQQGRIYQTKGICRGRIAFEPRGKNGFGYDPIFVPDGFDKTFAELDSQ 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
            KN                +SHRA+AF+        I  +
Sbjct: 175 IKNQ---------------ISHRAKAFESLKKILGEIYNE 199


>gi|251794009|ref|YP_003008741.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Aggregatibacter aphrophilus NJ8700]
 gi|247535408|gb|ACS98654.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Aggregatibacter aphrophilus NJ8700]
          Length = 223

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 102/219 (46%), Gaps = 21/219 (9%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R  ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  
Sbjct: 22  RAKMKQKIVLATGNKGKVKEMADVLSDFGFEVVAQTDLGIDSPEETGLTFVENAILKARY 81

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA+ +G+PA++DDSGLV+D L+G PG++SAR+A  +          +  E  L       
Sbjct: 82  AAEKSGLPAIADDSGLVVDALNGAPGLYSARYAGVDG----EQADAKNREKLLAELANVP 137

Query: 122 PAFRSAHF--ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
              R A F    VL     D       G+  G+I +  +G  GFGYD +F       TF 
Sbjct: 138 AEQRKAKFVSTIVLLQHPTDPSPIIAQGECHGVIAFEEKGDNGFGYDSLFFSPETGCTFA 197

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           E+   EK                 +SHRARA        
Sbjct: 198 ELETVEKKK---------------ISHRARALAMLKTKL 221


>gi|270669477|ref|ZP_06222607.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Haemophilus influenzae HK1212]
 gi|270316561|gb|EFA28399.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Haemophilus influenzae HK1212]
          Length = 195

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 102/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A D   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHVAQDKRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F   G   TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECHGVIGFEEKGENGFGYDSLFFSPGQGCTFAELETV 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A        
Sbjct: 177 EKKK---------------ISHRAKALSVLKSKL 195


>gi|204928158|ref|ZP_03219358.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|204322480|gb|EDZ07677.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
          Length = 197

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 74/217 (34%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKM 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  N  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQ------QNLEKLLHTLRDVPDDKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 QARFHCVLVYLRHAEDPTPIVCHGSWPGVINRQAVGNGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLDALRN 196


>gi|212636427|ref|YP_002312952.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella piezotolerans WP3]
 gi|212557911|gb|ACJ30365.1| HAM1 protein [Shewanella piezotolerans WP3]
          Length = 199

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 100/217 (46%), Gaps = 25/217 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            N IV+AS N  K+ E   L+   G+   +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MNQIVLASGNKGKLKEFSELMADYGVEILAQSEFNVSEVAETGTTFVENAIIKARHAAEI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  A++DDSGL +D L G PGI+SAR+A     ++     + K  +        +   R
Sbjct: 61  TGHAAIADDSGLEVDFLQGAPGIYSARYAGEGAKDQQNYTKLLKALD--------NQTQR 112

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL       D           G I + P G  G GYDPIF P  +  +  E++ 
Sbjct: 113 SARFQCVLVYMRHAKDPTPIICQASWEGSIGFSPLGDNGHGYDPIFIPAEHKCSAAELSS 172

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +EKN               LLSHR +A    ++   +
Sbjct: 173 DEKN---------------LLSHRGKALVLLIEAMKQ 194


>gi|145632502|ref|ZP_01788236.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae 3655]
 gi|148825461|ref|YP_001290214.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae PittEE]
 gi|144986697|gb|EDJ93249.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae 3655]
 gi|148715621|gb|ABQ97831.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae PittEE]
          Length = 195

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 102/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A D   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHIAQDQRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETA 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A     +  
Sbjct: 177 EKKK---------------ISHRAKALSVLKNKL 195


>gi|315224414|ref|ZP_07866244.1| nucleoside-triphosphatase [Capnocytophaga ochracea F0287]
 gi|314945617|gb|EFS97636.1| nucleoside-triphosphatase [Capnocytophaga ochracea F0287]
          Length = 193

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 63/218 (28%), Positives = 99/218 (45%), Gaps = 26/218 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAKN 65
             +V A+HN  K+ E+ + + P  I   S  ++       ET  + E NA++K+    ++
Sbjct: 1   MKLVFATHNQHKLKEIQAFL-PKNIELLSLSDIGCNDDIAETATTIEGNALLKAQYIKEH 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                 +DD+GL +  L+  PG++SAR+A  +  + D           L  K     + R
Sbjct: 60  YHCNVFADDTGLEVQALNNAPGVYSARYAGEHKSDAD--------NMYLLLKNMEGISHR 111

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F ++++L         F G   G I   P G  GFGYDPIF P G D+TF E+T+EE
Sbjct: 112 EAQFKTIIALCLDGSI-YTFEGIAKGRIGTTPVGTNGFGYDPIFIPEGSDQTFAELTQEE 170

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           KN                +SHR +AF   +    +  +
Sbjct: 171 KN---------------RISHRGKAFGKLLHFLNQNIQ 193


>gi|16130855|ref|NP_417429.1| dITP/XTP pyrophosphatase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89109731|ref|AP_003511.1| dITP/XTP pyrophosphatase [Escherichia coli str. K-12 substr. W3110]
 gi|170082506|ref|YP_001731826.1| dITP/XTP pyrophosphatase [Escherichia coli str. K-12 substr. DH10B]
 gi|188496240|ref|ZP_03003510.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli 53638]
 gi|238902076|ref|YP_002927872.1| dITP/XTP pyrophosphatase [Escherichia coli BW2952]
 gi|253772208|ref|YP_003035039.1| deoxyribonucleotide triphosphate pyrophosphatase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|301643692|ref|ZP_07243731.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 146-1]
 gi|307139639|ref|ZP_07498995.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli H736]
 gi|331643647|ref|ZP_08344778.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli H736]
 gi|1723866|sp|P52061|RDGB_ECOLI RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|882483|gb|AAA69121.1| ORF_o197 [Escherichia coli str. K-12 substr. MG1655]
 gi|1789324|gb|AAC75991.1| dITP/XTP pyrophosphatase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|85675764|dbj|BAE77017.1| dITP/XTP pyrophosphatase [Escherichia coli str. K12 substr. W3110]
 gi|169890341|gb|ACB04048.1| dITP/XTP pyrophosphatase [Escherichia coli str. K-12 substr. DH10B]
 gi|188491439|gb|EDU66542.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli 53638]
 gi|238860781|gb|ACR62779.1| dITP/XTP pyrophosphatase [Escherichia coli BW2952]
 gi|253323252|gb|ACT27854.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|260448003|gb|ACX38425.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli DH1]
 gi|301077894|gb|EFK92700.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 146-1]
 gi|309703309|emb|CBJ02645.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|315137551|dbj|BAJ44710.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli DH1]
 gi|315614884|gb|EFU95522.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Escherichia coli 3431]
 gi|323936043|gb|EGB32338.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli E1520]
 gi|331037118|gb|EGI09342.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli H736]
          Length = 197

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 69/215 (32%), Positives = 105/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +PA++DDSGL +DVL G PGI+SAR++  +  ++     +QK+   ++          
Sbjct: 61  TALPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQ---KNLQKLLETMKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|323669737|emb|CBJ94861.1| conserved hypothetical protein [Salmonella bongori]
 gi|327412907|emb|CAX67921.1| conserved hypothetical protein [Salmonella bongori]
          Length = 197

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 102/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  N  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGENATDQ------QNLEKLLHTLHDVPDDKR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGK--VSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL                   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 QAQFHCVLVYLRHAEDPTPVVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLDALRN 196


>gi|302877638|ref|YP_003846202.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Gallionella capsiferriformans ES-2]
 gi|302580427|gb|ADL54438.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Gallionella capsiferriformans ES-2]
          Length = 196

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 102/214 (47%), Gaps = 20/214 (9%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            N +VIAS+N  K+ E   ++ PLGI   +  +L +   EE   +F ENA+ K+  A++ 
Sbjct: 1   MNKLVIASNNAGKLREFSHMLQPLGIEVVTQSQLGITEAEEPHVTFIENALAKARHASRL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G+PAL+DDSG+ ++ L G PG++SAR+A  N          +  E  LR          
Sbjct: 61  SGLPALADDSGICVEALGGAPGVYSARYAGDN-----PKSDGRNNEKLLRDMQGVTDRRA 115

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             + + VL     D       G+  G I    RG+ GFGYDP+F     ++   E+T EE
Sbjct: 116 HYYCVLVLVRHADDPQPVIAEGEWHGEIAHEERGEGGFGYDPMFWLPQLNKMSSELTHEE 175

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           K+                +SHR +A K  + +  
Sbjct: 176 KHA---------------ISHRGQAMKVLLQHLK 194


>gi|183596317|ref|ZP_02958345.1| hypothetical protein PROSTU_00052 [Providencia stuartii ATCC 25827]
 gi|188023921|gb|EDU61961.1| hypothetical protein PROSTU_00052 [Providencia stuartii ATCC 25827]
          Length = 197

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 103/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K++E+  L+   G+   +   L +   EETG +F ENA++K+  A++ 
Sbjct: 1   MQKVVLATGNPGKVNELADLLRDFGMDIVAQTSLGVESAEETGLTFIENAILKARHASQQ 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSG+ +D L G PGI+SAR+A     +       Q +   L +  +     R
Sbjct: 61  TGLPAIADDSGISVDALGGAPGIYSARYAGEEATDE------QNLHKLLDAMKSVPDGER 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  GII   P GQ GFGYDPIF     + T  E+T+
Sbjct: 115 QAQFNCVLVYLRHAEDPTPLVFHGRWHGIITHEPSGQGGFGYDPIFYVPELNCTSAELTK 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            EK                 +SHR +A    +D    
Sbjct: 175 SEK---------------QAISHRGKALAMLLDALKN 196


>gi|327312863|ref|YP_004328300.1| non-canonical purine NTP pyrophosphatase RdgB [Prevotella denticola
           F0289]
 gi|326945526|gb|AEA21411.1| non-canonical purine NTP pyrophosphatase RdgB [Prevotella denticola
           F0289]
          Length = 194

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 71/216 (32%), Positives = 110/216 (50%), Gaps = 25/216 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             IV A++N  K+ E+  ++     I++ + +  +  IPE TG + +ENA  KS    ++
Sbjct: 1   MKIVFATNNKHKLEEIKEILGKDFEIVSLAEIGCHEDIPE-TGLTLQENARQKSTYVVEH 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                 +DD+GL +D L G+PG+HSAR+AE    + D +  M+K+ + +          R
Sbjct: 60  YRQNCFADDTGLEVDALGGEPGVHSARYAE--GTDHDSEANMRKLLSKMAGVE-----NR 112

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F +V+SL         F G+V G I     G  GFGYDPIF P GYD++F E+ EE 
Sbjct: 113 TARFRTVISLIIDGVE-HQFEGRVDGRIATEKHGSEGFGYDPIFIPEGYDKSFAELGEEV 171

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           KN                +SHRA+A K   +   ++
Sbjct: 172 KNK---------------ISHRAKAVKKLAEYLRKV 192


>gi|148827416|ref|YP_001292169.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae PittGG]
 gi|148718658|gb|ABQ99785.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae PittGG]
          Length = 195

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 102/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A +   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHIAQEQRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETA 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A     +  
Sbjct: 177 EKKK---------------ISHRAKALSVLKNKL 195


>gi|292490866|ref|YP_003526305.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Nitrosococcus halophilus Nc4]
 gi|291579461|gb|ADE13918.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Nitrosococcus halophilus Nc4]
          Length = 200

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 69/211 (32%), Positives = 103/211 (48%), Gaps = 19/211 (9%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMP 69
           V+AS+N  K+ EM  ++  L +   S     +    ETG SF ENA+IK+  AA++ G+ 
Sbjct: 7   VLASNNPGKLREMGEILSELRMEVISQSAFKVPEVAETGLSFVENALIKARNAARHTGLA 66

Query: 70  ALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHF 129
           A++DDSGL +D LDG+PGIHSAR+A  N  +++    + +            P       
Sbjct: 67  AIADDSGLEVDALDGQPGIHSARYAGPNATDQENLEKLLENLK----TVPEKPPSARYQC 122

Query: 130 ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGG 189
           + V    W D       G   G I++ P+G  GFGYDP+F    +  T  E++ EEKN  
Sbjct: 123 VIVYMRHWQDPTPYICQGTWEGQIIFTPQGSGGFGYDPLFYLPEHHCTAAELSPEEKN-- 180

Query: 190 IDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
                         LSHR +A +  +D   +
Sbjct: 181 -------------RLSHRGKALRVLLDALRQ 198


>gi|16079888|ref|NP_390714.1| nucleoside-triphosphatase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|22653751|sp|P94558|NTPA_BACSU RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|1770060|emb|CAA99555.1| hypothetical protein [Bacillus subtilis]
 gi|2635301|emb|CAB14796.1| inosine/xanthosine triphosphate pyrophosphatase (subunit A)
           [Bacillus subtilis subsp. subtilis str. 168]
          Length = 198

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 74/216 (34%), Positives = 105/216 (48%), Gaps = 22/216 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTA 62
           +I    +IA+HN  K+ E   ++ P G    S  E+      EETG++FEENA++K+   
Sbjct: 2   IIMKEAIIATHNPGKVKEFKEILEPRGYDVKSLAEIGFTEEIEETGHTFEENAIMKAEAV 61

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           AK      ++DDSGL ID L G+PG++SAR+A     ++        IE  L      + 
Sbjct: 62  AKAVNKMVIADDSGLSIDNLGGRPGVYSARYAGEQKDDQ------ANIEKVLSELKGIEK 115

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F   L+++ P    +   G V G I   PRG+ GFGYDPIF     D+T  E+T
Sbjct: 116 EQRTARFRCALAVSIPGEETKTVEGHVEGYIAEEPRGEYGFGYDPIFIVKDKDKTMAELT 175

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +EKN                +SHRA A K      
Sbjct: 176 SDEKNK---------------ISHRADALKKLSKLL 196


>gi|294139809|ref|YP_003555787.1| HAM1 protein [Shewanella violacea DSS12]
 gi|293326278|dbj|BAJ01009.1| HAM1 protein [Shewanella violacea DSS12]
          Length = 200

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 68/217 (31%), Positives = 100/217 (46%), Gaps = 24/217 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            +  V+AS N  K+ E   +    G+      + N+    ETG +F EN++IK+  AA+ 
Sbjct: 1   MDKFVLASGNKGKLKEFSEIFSAFGVEVLPQSQFNVEEVPETGTTFVENSIIKARHAAEI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ +++DDSGL +D+LDG PGI+SAR+   N GE+D  +        L      +   R
Sbjct: 61  TGLASIADDSGLEVDLLDGAPGIYSARYGGDNAGEKDNYIK-------LLDTLKTNMEGR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL       D           G I +   G  G GYDPIF PN ++ +  E+  
Sbjct: 114 TARFQCVLVYMRHAKDPTPIIAQASWEGKIAFAATGDNGHGYDPIFIPNEHNCSAAELDS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEKN                LSHR +A K  +    +
Sbjct: 174 EEKN---------------RLSHRGKAMKLLIHAMKQ 195


>gi|321312369|ref|YP_004204656.1| nucleoside-triphosphatase [Bacillus subtilis BSn5]
 gi|291485266|dbj|BAI86341.1| hypothetical protein BSNT_04138 [Bacillus subtilis subsp. natto
           BEST195]
 gi|320018643|gb|ADV93629.1| nucleoside-triphosphatase [Bacillus subtilis BSn5]
          Length = 195

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 103/214 (48%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAK 64
               +IA+HN  K+ E   ++ P G    S  E+      EETG++FEENA++K+   AK
Sbjct: 1   MKEAIIATHNPGKVKEFKEILEPRGYDVKSLAEIGFTEEIEETGHTFEENAILKAEAVAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL ID L G+PG++SAR+A     ++        IE  L      +   
Sbjct: 61  AVNKMVIADDSGLSIDNLGGRPGVYSARYAGEQKDDQ------ANIEKVLSELKGIEKEQ 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L+++ P    +   G V G I   PRG+ GFGYDPIF     D+T  E+T +
Sbjct: 115 RTARFRCALAVSIPGEETKTVEGHVEGYIAEEPRGEYGFGYDPIFIVKDKDKTMAELTSD 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                +SHRA A K      
Sbjct: 175 EKNK---------------ISHRADALKKLSKLL 193


>gi|304382098|ref|ZP_07364609.1| nucleoside-triphosphatase [Prevotella marshii DSM 16973]
 gi|304336696|gb|EFM02921.1| nucleoside-triphosphatase [Prevotella marshii DSM 16973]
          Length = 201

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 72/215 (33%), Positives = 111/215 (51%), Gaps = 20/215 (9%)

Query: 7   NNIVIASHNVDKIHEMDSLIMP-LGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             IV A++N +K+ E+  ++ P L I++ S +     IPE T ++ E NA++K+   A  
Sbjct: 1   MKIVFATNNKNKLTEIRKILEPQLEIVSLSDIGCEADIPE-TADTLEGNALLKARYIADQ 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +   +DD+GL ++ L+G PG+HSAR+   +T + D +  M+K+ + L  K      FR
Sbjct: 60  YHLACFADDTGLEVEALNGAPGVHSARFD--DTTDHDSEANMRKLLHELNGKDNRRARFR 117

Query: 126 SAH-FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           +   FI        D     F G ++G+I     G  GFGYDPIF PNGYD+TF E+  +
Sbjct: 118 TVIAFIPASHDTDSDSSPLLFEGMINGLIAREKHGIGGFGYDPIFIPNGYDKTFAELGTD 177

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            KN                +SHRA A +   D+ L
Sbjct: 178 IKN---------------RISHRALAVRKLADHLL 197


>gi|300947685|ref|ZP_07161854.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 116-1]
 gi|300954199|ref|ZP_07166664.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 175-1]
 gi|284922897|emb|CBG35986.1| conserved hypothetical protein [Escherichia coli 042]
 gi|300318783|gb|EFJ68567.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 175-1]
 gi|300452731|gb|EFK16351.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 116-1]
          Length = 197

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 69/215 (32%), Positives = 105/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNVGKVRELASLLSDFGLNIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +PA++DDSGL +DVL G PGI+SAR++  +  ++     +QK+   ++          
Sbjct: 61  TALPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQ---KNLQKLLETMKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|261364290|ref|ZP_05977173.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria mucosa ATCC 25996]
 gi|288567537|gb|EFC89097.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria mucosa ATCC 25996]
          Length = 197

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/217 (28%), Positives = 90/217 (41%), Gaps = 20/217 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           + + IV+AS N  K+ E   L   L I      + +     E   +F ENA+ K+  AAK
Sbjct: 1   MFDKIVLASGNAGKLKEFSRLFADLNIEVLPQSQFDTPECPEPYRTFVENALAKARHAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           ++G+PAL+DDSG+    L+G PGI SAR+A +N      D A  K  +   +  A    +
Sbjct: 61  HSGLPALADDSGICAAALNGAPGILSARYAGANP---KSDAANNKRLSDDLADKADKSCY 117

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
            +   + V              G   G       G  GFGYDP F    ++ T  E+  E
Sbjct: 118 YACVLVLVRHEND--PQPIIAEGIWHGQWQTEAAGTNGFGYDPHFYLPEHNCTAAELAPE 175

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            KN                 SHR +A +  +     +
Sbjct: 176 IKNAE---------------SHRGQALRELLRKIEAL 197


>gi|110835439|ref|YP_694298.1| Ham1 protein [Alcanivorax borkumensis SK2]
 gi|110648550|emb|CAL18026.1| Ham1 protein [Alcanivorax borkumensis SK2]
          Length = 196

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 63/215 (29%), Positives = 97/215 (45%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+AS N  K+ EM  L+ PL I   +  E  +   +ETG++F ENA+IK+  A K+
Sbjct: 1   MEKLVLASGNAKKLAEMQRLLAPLNIEVVAQSEFCVPEADETGSTFVENAIIKARNACKH 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +  L+G PGI SAR++     +   +  + ++   +           
Sbjct: 61  TGLPAIADDSGLEVSALNGSPGIFSARFSGVGATDAKNNALLVEMLAEIPEDA----RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + VL     D       G  +G IV  P+G  GFGYDP F       T  ++  +E
Sbjct: 117 RYVALLVLMRHEDDATPLICQGSWNGRIVLEPQGDQGFGYDPHFFVEEKGCTAAQLPADE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           KN                +SHR +A    +     
Sbjct: 177 KNA---------------ISHRGKAMATLIKALKE 196


>gi|206578648|ref|YP_002236594.1| non-canonical purine NTP pyrophosphatase RdgB [Klebsiella
           pneumoniae 342]
 gi|206567706|gb|ACI09482.1| non-canonical purine NTP pyrophosphatase RdgB [Klebsiella
           pneumoniae 342]
          Length = 197

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 104/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLEDFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGVDATDQ------QNLEKLLDALKDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E++ 
Sbjct: 115 QAQFHCVLVYLRHAEDPTPLVCHGSWPGVITRQAAGTGGFGYDPIFFVPSEGKTAAELSR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  ++    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLEALRN 196


>gi|255066007|ref|ZP_05317862.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria sicca ATCC 29256]
 gi|255049918|gb|EET45382.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria sicca ATCC 29256]
          Length = 197

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 58/217 (26%), Positives = 91/217 (41%), Gaps = 20/217 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           + + IV+AS N  K+ E   L   L I      + +     E  ++F ENA+ K+  AAK
Sbjct: 1   MFDKIVLASGNAGKLKEFSRLFADLNIEVLPQSQFDTPECPEPYHTFVENALAKARHAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           ++G+PAL+DDSG+    L+G PG+ SAR+A      +      +++ + L  +      +
Sbjct: 61  HSGLPALADDSGICTAALNGAPGVLSARYAG--ANPKSDAANNKRLSDDLADQADKSCHY 118

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                + VL     D       G   G       G  GFGYDP F    ++ T  E+  E
Sbjct: 119 ---VCVLVLVRHENDPQPIIAEGIWRGQWQAEAAGTHGFGYDPHFYLPEHNCTAAELDPE 175

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            KN                 SHR +A +  +     +
Sbjct: 176 IKNAE---------------SHRGQALRELLKKIEAL 197


>gi|28899395|ref|NP_799000.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|260366266|ref|ZP_05778725.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Vibrio
           parahaemolyticus K5030]
 gi|260878917|ref|ZP_05891272.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Vibrio
           parahaemolyticus AN-5034]
 gi|260898282|ref|ZP_05906778.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Vibrio
           parahaemolyticus Peru-466]
 gi|260902389|ref|ZP_05910784.1| non-canonical purine NTP pyrophosphatase RdgB [Vibrio
           parahaemolyticus AQ4037]
 gi|34098475|sp|Q87LJ1|NTPA_VIBPA RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|28807631|dbj|BAC60884.1| Ham1 protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308085855|gb|EFO35550.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Vibrio
           parahaemolyticus Peru-466]
 gi|308090446|gb|EFO40141.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Vibrio
           parahaemolyticus AN-5034]
 gi|308107149|gb|EFO44689.1| non-canonical purine NTP pyrophosphatase RdgB [Vibrio
           parahaemolyticus AQ4037]
 gi|308113529|gb|EFO51069.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Vibrio
           parahaemolyticus K5030]
          Length = 200

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 98/215 (45%), Gaps = 23/215 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A     ++      + +E  L +      A R
Sbjct: 61  TGLPAIADDSGLEVDFLKGAPGIYSARYAGEKASDQ------ENLEKLLAAMEGVPEAER 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G+ GFGYDPIF     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
             K                 LSHR +A K      
Sbjct: 175 ARK---------------KQLSHRGKALKSLFAQL 194


>gi|16761878|ref|NP_457495.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Typhi str. CT18]
 gi|29143365|ref|NP_806707.1| deoxyribonucleotide triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|213051777|ref|ZP_03344655.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E00-7866]
 gi|213422842|ref|ZP_03355880.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E01-6750]
 gi|213580618|ref|ZP_03362444.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-0664]
 gi|213609098|ref|ZP_03368924.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-2068]
 gi|213648209|ref|ZP_03378262.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           J185]
 gi|213850157|ref|ZP_03381055.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           M223]
 gi|289811235|ref|ZP_06541864.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           AG3]
 gi|289825937|ref|ZP_06545096.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-3139]
 gi|22653760|sp|Q8Z3U6|RDGB_SALTI RecName: Full=Nucleoside-triphosphatase rdgB; AltName:
           Full=Nucleoside triphosphate phosphohydrolase;
           Short=NTPase
 gi|25323166|pir||AG0878 conserved hypothetical protein STY3256 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504180|emb|CAD02927.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138999|gb|AAO70567.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 197

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 73/217 (33%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVVAQTKLGVDSAEETGLTFIENAILKARHAAKM 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  N  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQ------QNLEKLLHTLRDVPDDKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 QARFHCVLVYLRHAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLDALRN 196


>gi|311031423|ref|ZP_07709513.1| nucleoside-triphosphatase [Bacillus sp. m3-13]
          Length = 209

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 68/223 (30%), Positives = 108/223 (48%), Gaps = 22/223 (9%)

Query: 3   KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLT 61
           K+    I+IA++N  K+ +   ++ P G    S  +   +   EETG +FE+NA++K+  
Sbjct: 7   KIKMKEIIIATNNPGKVKDFKVILEPKGFQVKSLADFPEIHDVEETGTTFEKNALLKAEA 66

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            + + G   L+DDSGL +D L+G+PG++SAR+A     +R      + I+  L       
Sbjct: 67  VSAHLGKIVLADDSGLEVDALNGEPGVYSARYAGMEKDDR------KNIQKVLDGLKGVP 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F+ VL++  P+G      G   G I   P G+ GFGYDPIF  N   RT  ++
Sbjct: 121 DEKRTARFVCVLAVVDPEGEKFTVRGTCEGTISQEPIGENGFGYDPIFYVNEKQRTMAQL 180

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           ++EEK                 +SHR  A     +    +  K
Sbjct: 181 SKEEK---------------SEISHRGNAISQLTNQWEMLSRK 208


>gi|91228692|ref|ZP_01262606.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           alginolyticus 12G01]
 gi|269965740|ref|ZP_06179837.1| HAM1 protein [Vibrio alginolyticus 40B]
 gi|91187763|gb|EAS74081.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           alginolyticus 12G01]
 gi|269829608|gb|EEZ83845.1| HAM1 protein [Vibrio alginolyticus 40B]
          Length = 200

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 99/217 (45%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A  +  ++      + +E  L +      A R
Sbjct: 61  TGLPAIADDSGLEVDFLKGAPGIYSARYAGESASDQ------ENLEKLLAAMEGVPEAER 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G+ GFGYDPIF     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGKALKSLFAQLSE 196


>gi|116512124|ref|YP_809340.1| hypothetical protein LACR_1402 [Lactococcus lactis subsp. cremoris
           SK11]
 gi|116107778|gb|ABJ72918.1| Xanthosine triphosphate pyrophosphatase [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 201

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 71/221 (32%), Positives = 102/221 (46%), Gaps = 21/221 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAA 63
           +EN ++IA+ N  K  E   L    G       +   L   EETG++FEENA +K+   A
Sbjct: 1   MENTLIIATRNPGKTKEFKKLFADFGYEIKDLSDYPELPEIEETGSTFEENARLKAEQIA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G   + DDSGL +DVL G PGI S R++  +  +               +  A  P 
Sbjct: 61  ELTGQVVIGDDSGLCVDVLGGLPGIWSHRFSAPDPTDEKNIAK----LLHELAPTAITPE 116

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            RSAHF + L  A P+          +G I + P+G  GFGYDP+F  + + RT  E++E
Sbjct: 117 RRSAHFHTTLVAARPNHDSLVVEADWNGYIAFAPKGGNGFGYDPVFMVDAF-RTAAELSE 175

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +EKN                LSHR +A +  +       EK
Sbjct: 176 KEKNQ---------------LSHRGQALRKLMQELPEWLEK 201


>gi|317493546|ref|ZP_07951967.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918489|gb|EFV39827.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 197

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 107/215 (49%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKIVLATGNAGKVRELASLLADFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR+A     +R     ++K+ +AL+   A      
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYAGEEASDR---QNLEKLLDALKDVPADQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G  +G I + P G  GFGYDPIF       +  ++T+E+
Sbjct: 117 KFHCVLVYLRHAEDPTPLVCHGSWAGEISFAPSGDGGFGYDPIFHVPELGCSAAQLTKEQ 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K                 +SHR +A K  ++    
Sbjct: 177 K---------------IAVSHRGQALKLLLEAMRN 196


>gi|296331616|ref|ZP_06874085.1| nucleoside-triphosphatase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305675425|ref|YP_003867097.1| inosine/xanthosine triphosphate pyrophosphatase (subunit A)
           [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296151211|gb|EFG92091.1| nucleoside-triphosphatase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305413669|gb|ADM38788.1| inosine/xanthosine triphosphate pyrophosphatase (subunit A)
           [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 195

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 72/214 (33%), Positives = 102/214 (47%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAK 64
               +IA+HN  K+ E   ++ P G    S  E+      EETG++FEENA++K+   AK
Sbjct: 1   MKEAIIATHNPGKVKEFKEILEPKGYDVKSLAEIGFTEEIEETGHTFEENAILKAQAVAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL ID L G+PG++SAR+A     ++        I   L      +   
Sbjct: 61  AVNKMVIADDSGLSIDNLGGRPGVYSARYAGEQKDDQ------ANIAKVLSELKGIEKEQ 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L+++ P    +   G V G I   PRG+ GFGYDPIF     D+T  E+T +
Sbjct: 115 RTARFRCALAVSIPGEETKTVEGHVEGYIAEEPRGEYGFGYDPIFIVKDKDKTMAELTSD 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                +SHRA A K      
Sbjct: 175 EKNK---------------ISHRADALKKLSKLL 193


>gi|254162864|ref|YP_003045972.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli B str. REL606]
 gi|297520256|ref|ZP_06938642.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli OP50]
 gi|222034649|emb|CAP77391.1| HAM1 protein homolog [Escherichia coli LF82]
 gi|242378480|emb|CAQ33264.1| dITP/XTP pyrophosphatase [Escherichia coli BL21(DE3)]
 gi|253974765|gb|ACT40436.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli B str. REL606]
 gi|253978931|gb|ACT44601.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli BL21(DE3)]
 gi|312947485|gb|ADR28312.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Escherichia coli O83:H1 str. NRG 857C]
 gi|323971759|gb|EGB66986.1| rdgB/HAM1 family protein purine NTP pyrophosphatase [Escherichia
           coli TA007]
 gi|324005510|gb|EGB74729.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Escherichia coli MS 57-2]
          Length = 197

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 68/215 (31%), Positives = 104/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++     +QK+   ++          
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQ---KNLQKLLETMKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVLSEGKTAAELTREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|261377946|ref|ZP_05982519.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria cinerea ATCC 14685]
 gi|269145807|gb|EEZ72225.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria cinerea ATCC 14685]
          Length = 199

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 65/211 (30%), Positives = 86/211 (40%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P GI      E  +    E  ++F ENA+ K+  AAK +G
Sbjct: 7   KIVLASGNAGKLKEFSNLFEPYGITVLPQSEFGIPECPEPYSTFVENALAKARHAAKYSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A  N                            S 
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGDN-----PKSDSANNLKLAGELAGKADKSCSY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P+GQ GFGYDP F    + +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGVWHGQWHDAPQGQNGFGYDPYFYLPEHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALAELLHKL 197


>gi|297529172|ref|YP_003670447.1| ribonuclease PH [Geobacillus sp. C56-T3]
 gi|297252424|gb|ADI25870.1| ribonuclease PH [Geobacillus sp. C56-T3]
          Length = 460

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 70/216 (32%), Positives = 103/216 (47%), Gaps = 22/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             IVIA+ N  K+ E  +L    G+   S L+  +     ETG++F ENA++K+  A++ 
Sbjct: 258 KEIVIATKNAGKVREFAALFAKRGVEVKSLLDFPDAPDVAETGSTFAENAVLKAEAASRR 317

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
              P ++DDSGLV+D L G+PG+HSAR+A  +  +       + I   LR         R
Sbjct: 318 LKRPVIADDSGLVVDALGGRPGVHSARYAGEDKNDA------RNIAKLLRELDGVPMEQR 371

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F   L++A P            G I   PRG+ GFGYDP+F    + +T  E+  EE
Sbjct: 372 TARFHCALAVAIPGRPTAVVEATCDGYIAEAPRGEGGFGYDPVFYLPEWGKTMAELAPEE 431

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           KN                +SHRA+A     +    I
Sbjct: 432 KNQ---------------ISHRAKALTKLDEQWEEI 452


>gi|170292256|pdb|2PYU|A Chain A, Structure Of The E. Coli Inosine Triphosphate
           Pyrophosphatase Rgdb In Complex With Imp
          Length = 219

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 68/215 (31%), Positives = 104/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 21  MQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 80

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +PA++D SGL +DVL G PGI+SAR++  +  ++     +QK+   ++          
Sbjct: 81  TALPAIADASGLAVDVLGGAPGIYSARYSGEDATDQ---KNLQKLLETMKDVPDDQ-RQA 136

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 137 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 196

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 197 KSA---------------ISHRGQALKLLLDALRN 216


>gi|224824836|ref|ZP_03697943.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Lutiella nitroferrum 2002]
 gi|224603329|gb|EEG09505.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Lutiella nitroferrum 2002]
          Length = 197

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/218 (27%), Positives = 97/218 (44%), Gaps = 21/218 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           + + IV+AS+N  K+ E  +L   LG+      E ++    E  ++F ENA+ K+  A++
Sbjct: 1   MFDRIVLASNNAGKLKEFSALFAELGVAVHPQGEFDVPECPEPHHTFLENALEKARHASR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PAL+DDSG+ ++ L G PG+ SAR+A     +   +  +      L          
Sbjct: 61  ITGLPALADDSGICVEALAGAPGVQSARFAGEPKSDARNNALL------LEKLAGEPNRR 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
              + + VL     D       G   G ++   RG+ GFGYDP F   GY RT  E+   
Sbjct: 115 AWYYCVLVLVRHADDPQPIVADGVWYGEVIDSARGEGGFGYDPYFLLPGYGRTAAELDAA 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           EKN                +SHR +A +  +     + 
Sbjct: 175 EKN---------------RVSHRGQAVQALMAKLKALA 197


>gi|322834242|ref|YP_004214269.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rahnella sp. Y9602]
 gi|321169443|gb|ADW75142.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rahnella sp. Y9602]
          Length = 202

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 70/221 (31%), Positives = 106/221 (47%), Gaps = 23/221 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+  L+   G+   +  EL +   EETG +F ENA++K+  AA  
Sbjct: 1   MQKVVLATGNAGKVRELAHLLASFGLDVVAQTELGVESAEETGLTFIENAILKARHAAAV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A  +  ++      Q ++  L +        R
Sbjct: 61  TGLPAIADDSGLAVDFLGGAPGIYSARYAGVDASDQ------QNLDKLLVALKDVPQGQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G  +G I++   G+ GFGYDPIF      +T  E+T 
Sbjct: 115 DAQFHCVLVYMRHAEDPTPLVCHGSWAGEIIFAEAGEGGFGYDPIFYVPELGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EEK+                +SHR +A K  +       +K
Sbjct: 175 EEKSA---------------VSHRGQALKLLLAAMKEAVQK 200


>gi|15605763|ref|NP_213140.1| hypothetical protein aq_202 [Aquifex aeolicus VF5]
 gi|22653747|sp|O66580|NTPA_AQUAE RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|2982934|gb|AAC06551.1| hypothetical protein aq_202 [Aquifex aeolicus VF5]
          Length = 202

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 64/219 (29%), Positives = 104/219 (47%), Gaps = 20/219 (9%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +++A+ N  K  E+  ++   GI      E   +  EETG +F ENA +K+    +  
Sbjct: 1   MKLLVATTNEGKYREIKEILSEYGIEVLKPEE--KLEVEETGCTFLENAYLKARAYYERY 58

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESN-TGERDFDMAMQKIENALRSKFAHDPAFR 125
            +PAL+DDSGL+++ +   PG++S+R+ + +  G  +      +       +   +   R
Sbjct: 59  KIPALADDSGLIVEAISPYPGVYSSRFYDIDFGGREEVRTNKDEANIRKLLRLLENTENR 118

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F     + +         G+V G I   PRG  GFGYDP+F P GY++T  E++ EE
Sbjct: 119 KAKF-VAFIVVYGGSWGIFAEGEVRGEITKEPRGDRGFGYDPVFVPEGYNKTMAELSPEE 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           KN                +SHR RA +  V + L+  EK
Sbjct: 178 KNK---------------ISHRGRALRKLV-HVLKNCEK 200


>gi|294671110|ref|ZP_06735965.1| hypothetical protein NEIELOOT_02818 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307218|gb|EFE48461.1| hypothetical protein NEIELOOT_02818 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 197

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 59/217 (27%), Positives = 90/217 (41%), Gaps = 20/217 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           + + IV+AS N  K+ E   L   L I      + +     E   +F ENA+ K+  AAK
Sbjct: 1   MFDKIVLASGNAGKLKEFSRLFADLNIEVLPQSQFDTPECPEPYRTFVENALAKARHAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           ++G+PAL+DDSG+    L+G PG+ SAR+A      +      +++ + L  K      +
Sbjct: 61  HSGLPALADDSGICAAALNGAPGVLSARYAG--ANPKSDAANNKRLSDDLADKADKSCYY 118

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                + VL     D       G   G       G  GFGYDP F    ++ T  E+  E
Sbjct: 119 ---VCVLVLVRHENDPQPIIAEGIWHGQWQTEAAGTNGFGYDPHFYLPEHNCTAAELAPE 175

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            KN                 SHR +A +  +     +
Sbjct: 176 IKNAE---------------SHRGQALRELLRKIEAL 197


>gi|62181613|ref|YP_218030.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62129246|gb|AAX66949.1| putative Xanthosine triphosphate pyrophosphatase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
          Length = 197

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 74/217 (34%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK 
Sbjct: 1   MPKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKM 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  N  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQ------QNLEKLLHTLRDVPDDKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E+T 
Sbjct: 115 QARFHCVLVYLRHAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLDALRN 196


>gi|52425802|ref|YP_088939.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Mannheimia succiniciproducens MBEL55E]
 gi|62900191|sp|Q65RQ6|NTPA_MANSM RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|52307854|gb|AAU38354.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 199

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 101/214 (47%), Gaps = 17/214 (7%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L++  PEETG +F ENA++K+  AAK
Sbjct: 1   MKQKIVLATGNKGKVREMSDVLADFGFEVVAQTDLDIESPEETGLTFVENALLKARYAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV++ L+G PG++SAR+A  +      D   ++      +        
Sbjct: 61  VSGLPAIADDSGLVVEALNGAPGLYSARYAGIDG--ETADAENRRKLLRDLADVPVGKRQ 118

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V+     D       G+  G I++  +G+ GFGYD +F       TF E+   
Sbjct: 119 AKFVSCIVMLRHETDPSPIIAEGECIGEIIFAEKGENGFGYDSLFFTPEKGCTFAELETV 178

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRARA        
Sbjct: 179 EKKK---------------ISHRARALAVLKSKL 197


>gi|167552005|ref|ZP_02345758.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205323301|gb|EDZ11140.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
          Length = 197

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 73/217 (33%), Positives = 104/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKM 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  N  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQ------QNLEKLLHTLRDVPDDKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G+I     G  GFGYDPIF      +T  E+  
Sbjct: 115 QARFHCVLVYLRHAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAELAR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  +D    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLDALRN 196


>gi|114330336|ref|YP_746558.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Nitrosomonas eutropha C91]
 gi|114307350|gb|ABI58593.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Nitrosomonas eutropha C91]
          Length = 204

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 63/216 (29%), Positives = 100/216 (46%), Gaps = 21/216 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IVIAS+N  K+ E+  L+ PLGI   +   L +   +E   +F ENA+ K+  A+   G
Sbjct: 7   RIVIASNNAGKLAEIGKLLAPLGIEVVTQASLGVTEADEPHMTFVENALAKARHASLATG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+ ++ L G PG+ SAR+A     ++  +  + +  +      A+       
Sbjct: 67  LPALADDSGICVNALQGAPGVLSARYAGEPRSDKRNNRKLVEALHGQSDHRAYY------ 120

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
           + + +L     D           G I+  P+GQ GFGYDP F      +T  E++ EEKN
Sbjct: 121 YCVIILLRHGQDPQPVIIEDTWHGEIIAEPKGQGGFGYDPHFFLPKLGKTAAELSMEEKN 180

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
                           +SHR +A    V      ++
Sbjct: 181 K---------------ISHRGKALARLVQILAGNEK 201


>gi|197334710|ref|YP_002155181.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Vibrio
           fischeri MJ11]
 gi|197316200|gb|ACH65647.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Vibrio
           fischeri MJ11]
          Length = 198

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 65/217 (29%), Positives = 99/217 (45%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + IV+A+ N  K+ EM  ++   G    +  E N+    ETG +F ENA+IK+   AK 
Sbjct: 1   MSKIVLATGNQGKVREMADILADFGFDVVAQSEYNVSDVAETGTTFIENAIIKARHTAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PG++SAR++     ++      + I+  L +        R
Sbjct: 61  TGLPAIADDSGLEVDALNGAPGVYSARYSGEGATDQ------KNIDKMLAAMEGIPAEKR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         G   G I    +G+ GFGYDPIF  +  + +  E+  
Sbjct: 115 TARFHCVLVLMKHENDPTPLICHGTWEGHITTEQKGENGFGYDPIFWVSEDNCSSAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGQALKKLFAALKE 196


>gi|16272217|ref|NP_438428.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae Rd KW20]
 gi|260580858|ref|ZP_05848683.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Haemophilus influenzae RdAW]
 gi|1723867|sp|P44598|NTPA_HAEIN RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|1573226|gb|AAC21925.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260092481|gb|EEW76419.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Haemophilus influenzae RdAW]
          Length = 195

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 101/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A +   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHIAQEQRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETA 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A        
Sbjct: 177 EKKK---------------ISHRAKALSVLKSKL 195


>gi|109899592|ref|YP_662847.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Pseudoalteromonas atlantica T6c]
 gi|109701873|gb|ABG41793.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Pseudoalteromonas atlantica T6c]
          Length = 208

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 75/226 (33%), Positives = 107/226 (47%), Gaps = 23/226 (10%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M   +   IV+A+ N  K+ E+  L+ PL I      E ++    ETG +F ENA+IK+ 
Sbjct: 1   MSFPLSRKIVLATGNKGKVAELSQLLSPLHINIIPQSEFDVPEVAETGTTFVENAIIKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK  G+PA++DDSGL +D L G PG++SAR+A S+  +         I+  L S    
Sbjct: 61  HAAKITGLPAIADDSGLAVDALGGAPGVYSARYAGSHATD------SDNIDKLLHSLSDI 114

Query: 121 DPAFRSAHFISVLSLAW--PDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
            P  R A F+ VL       D       G+  G I     G+ GFGYDP+F       T 
Sbjct: 115 APVKRQARFLCVLVYMRSSEDPTPIICQGEWHGEITLERSGESGFGYDPVFWVEQKKCTS 174

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
            ++T+E+KN                LSHR +A +  +       EK
Sbjct: 175 AQLTKEQKNA---------------LSHRGQALQQLLVKLSADFEK 205


>gi|320155274|ref|YP_004187653.1| nucleoside 5-triphosphatase RdgB [Vibrio vulnificus MO6-24/O]
 gi|319930586|gb|ADV85450.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           vulnificus MO6-24/O]
          Length = 200

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MKKIVLATGNQGKVREMADLLADFGFDVVAQSEFNVSEVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D L G PGI+SAR+A     ++      + +E  L +      A R
Sbjct: 61  TGLAAIADDSGLEVDFLQGAPGIYSARYAGEKASDQ------ENLEKLLTAMEGVPEAQR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G  GFGYDPIF     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPIVCHGKWEGRILMQAHGDNGFGYDPIFFVPEDNCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGKALKQLFATLRE 196


>gi|282849099|ref|ZP_06258484.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Veillonella parvula ATCC 17745]
 gi|282580803|gb|EFB86201.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Veillonella parvula ATCC 17745]
          Length = 191

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 105/214 (49%), Gaps = 24/214 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALE-LNLIIPEETGNSFEENAMIKSLTAAK 64
              IV+A+ N  KI E       L I        +++  PEETG +F ENA++K+   AK
Sbjct: 1   MEQIVLATGNKGKIREFSEAFSHLSIDCVPVKAVISIEEPEETGTTFMENALLKARYYAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSG+ +DVL+G PG++SAR+A  +  +   +  + +             + 
Sbjct: 61  ATNRPCLADDSGITVDVLNGAPGVYSARYAGRHGDDNANNEKLIREL--------QGKSN 112

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+ H++  L+L +PDG      G   G++   P+G+ GFGYDP F    + +T  E++ E
Sbjct: 113 RTGHYVCALALVYPDGREVTAEGYCDGLVQDEPKGENGFGYDPYFYVPEFKKTMAELSIE 172

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK               + +SHR RA +  ++  
Sbjct: 173 EK---------------ETISHRGRALRELINKL 191


>gi|156932604|ref|YP_001436520.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Cronobacter sakazakii ATCC BAA-894]
 gi|156530858|gb|ABU75684.1| hypothetical protein ESA_00386 [Cronobacter sakazakii ATCC BAA-894]
          Length = 197

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 72/217 (33%), Positives = 106/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLQEFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAQV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  A++DDSGL +D L G PGI+SAR+A ++  ++      + +E  L +        R
Sbjct: 61  TGFAAIADDSGLAVDALGGAPGIYSARYAGNDATDQ------ENLEKLLEALKDVPDEQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G   G+I   P GQ GFGYDPIF      +T  E+T 
Sbjct: 115 QAQFHCVLVYMRHADDPTPLVFHGAWPGVITRAPAGQGGFGYDPIFFVPSIGKTAAELTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  ++    
Sbjct: 175 EEKSA---------------VSHRGQALKLLLEAMRN 196


>gi|254230230|ref|ZP_04923622.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Vibrio
           sp. Ex25]
 gi|262393224|ref|YP_003285078.1| nucleoside 5-triphosphatase RdgB [Vibrio sp. Ex25]
 gi|151937262|gb|EDN56128.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Vibrio
           sp. Ex25]
 gi|262336818|gb|ACY50613.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           sp. Ex25]
          Length = 200

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 99/217 (45%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A  +  ++      + +E  L +      A R
Sbjct: 61  TGLPAIADDSGLEVDFLKGAPGIYSARYAGESASDQ------ENLEKLLAAMEGVPEAER 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G+ GFGYDPIF     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A +        
Sbjct: 175 ARK---------------KQLSHRGKALQSLFAQLSE 196


>gi|290511357|ref|ZP_06550726.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Klebsiella sp. 1_1_55]
 gi|289776350|gb|EFD84349.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Klebsiella sp. 1_1_55]
          Length = 197

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 104/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLEDFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGVDATDQ------QNLEKLLDALKDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   GII     G  GFGYDPIF      +T  E++ 
Sbjct: 115 QAQFHCVLVYLRHAEDPTPLVCHGSWPGIITRQAAGTGGFGYDPIFFVPSEGKTAAELSR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  ++    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLEALRN 196


>gi|260591960|ref|ZP_05857418.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella veroralis F0319]
 gi|260536244|gb|EEX18861.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella veroralis F0319]
          Length = 193

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 73/213 (34%), Positives = 111/213 (52%), Gaps = 25/213 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             IV A++N  K+ E+  ++     I++ + +  +  IPE TG + EENA  KS    ++
Sbjct: 1   MKIVFATNNKHKLEEIKDILGKDFEIVSLAEIGCHEDIPE-TGLTLEENARQKSTYIVEH 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                 +DD+GL +D L+G+PG+HSAR+AE    + D +  M+K+ + + +        R
Sbjct: 60  YNHDCFADDTGLEVDALNGEPGVHSARYAE--GTDHDSEANMRKLLSKMSNVKD-----R 112

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F +V+SL         F G+V G I     G+ GFGYDPIF P GYD++F E+ EE 
Sbjct: 113 TARFRTVISLIINGVE-HQFEGRVEGRIATEKHGKEGFGYDPIFIPEGYDKSFAELGEEV 171

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN                +SHRARA K   +  
Sbjct: 172 KNQ---------------ISHRARAVKKLAEYL 189


>gi|83746455|ref|ZP_00943506.1| Xanthosine triphosphate pyrophosphatase [Ralstonia solanacearum
           UW551]
 gi|207743768|ref|YP_002260160.1| xanthosine triphosphate pyrophosphatase protein [Ralstonia
           solanacearum IPO1609]
 gi|83726786|gb|EAP73913.1| Xanthosine triphosphate pyrophosphatase [Ralstonia solanacearum
           UW551]
 gi|206595167|emb|CAQ62094.1| xanthosine triphosphate pyrophosphatase protein [Ralstonia
           solanacearum IPO1609]
          Length = 201

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 102/218 (46%), Gaps = 19/218 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS+N  K+ E  +L+ PLG+  T+  EL +   EE   +F ENA+ K+  A++ 
Sbjct: 1   MRRIVLASNNPGKLAEFGTLLAPLGLDVTAQGELGIPEAEEPHVTFVENALAKARHASRL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           AG+PAL+DDSG+    L G PG++SAR+A+     +       ++   L         + 
Sbjct: 61  AGLPALADDSGICAHALGGAPGVYSARYAQLAGEPKSDAANNARLVRELAGHADRGAHY- 119

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + V      D       G   G ++  PRG  GFGYDP F      +T  E+++ E
Sbjct: 120 --VCVLVYVRHADDPQPIIAEGNWYGEVIDAPRGDGGFGYDPHFLLPALGKTAAELSKTE 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           KN                +SHRA+A    V+   R+ E
Sbjct: 178 KNA---------------VSHRAQALAQLVERL-RLSE 199


>gi|187478426|ref|YP_786450.1| Ham1 protein-like protein [Bordetella avium 197N]
 gi|115423012|emb|CAJ49542.1| Ham1 protein homolog [Bordetella avium 197N]
          Length = 199

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 70/216 (32%), Positives = 97/216 (44%), Gaps = 17/216 (7%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+AS+N  K+ E  +L  PLGI      +L +   EE   +F ENA+ K+  A+  
Sbjct: 1   MRRVVLASNNPGKLREFAALFAPLGIELVPQGDLGVSEAEEPHVTFVENALAKARHASLA 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PAL+DDSGL +  L G PG++SAR+A+  TG    D A   +        A   A+ 
Sbjct: 61  TGLPALADDSGLCVHALGGAPGVYSARFAQRETGAAKSDAANNALLLERMQGQADRRAWY 120

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A  + V              G   G I   P G  GFGYDP F     DR+  ++  EE
Sbjct: 121 VALLVLVRHADD--PCPLIGEGHWHGEIALAPAGAHGFGYDPYFYLPDLDRSAAQLPPEE 178

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           KN                +SHRARA +  +     I
Sbjct: 179 KNA---------------VSHRARALRELLGKLSAI 199


>gi|323498667|ref|ZP_08103658.1| dITP/XTP pyrophosphatase [Vibrio sinaloensis DSM 21326]
 gi|323316267|gb|EGA69287.1| dITP/XTP pyrophosphatase [Vibrio sinaloensis DSM 21326]
          Length = 199

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 72/217 (33%), Positives = 101/217 (46%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MSKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D L G PGI+SAR+A  +  ++      Q +E  L +     PA R
Sbjct: 61  TGLAAIADDSGLEVDALQGAPGIYSARYAGEDATDQ------QNLEKLLHAMKDVPPAER 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+   +G+ GFGYDPIF     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAQGENGFGYDPIFFVPEDNCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGKALKALFATLSE 196


>gi|302391287|ref|YP_003827107.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Acetohalobium arabaticum DSM 5501]
 gi|302203364|gb|ADL12042.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Acetohalobium arabaticum DSM 5501]
          Length = 200

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 67/214 (31%), Positives = 103/214 (48%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              I +A+ N  K+ EM  L+  L +   +  +L  +    E G++ EENA+ K+   A 
Sbjct: 1   MRKIFLATGNEGKVKEMKDLLAELEVELVTTFDLSEVPEVVEDGSTLEENAIKKAKELAD 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+  ++DD+GL++D L G+PG++SAR+A  +    D +         L          
Sbjct: 61  YTGLLTIADDTGLLVDALAGRPGVYSARYAGEDATYDDNNR------KLLSELDGISLED 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F +V++L   +G V+   G   G I + P G  GFGYDP+F P GY+ TF EM  E
Sbjct: 115 RTARFKTVMALVKSEGEVKTVEGICKGKIGFKPEGNHGFGYDPLFIPQGYNVTFAEMKSE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            KN                +SHRA+A     +  
Sbjct: 175 VKNK---------------ISHRAKALDKLKEIL 193


>gi|157693250|ref|YP_001487712.1| HAM1 protein [Bacillus pumilus SAFR-032]
 gi|157682008|gb|ABV63152.1| HAM1 protein [Bacillus pumilus SAFR-032]
          Length = 197

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 70/218 (32%), Positives = 105/218 (48%), Gaps = 22/218 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
               +IA+HN  K  E  +++ P G    +  ++  +   EETG++FEENA+IK+     
Sbjct: 1   MKTAIIATHNAGKAKEFKAILEPKGFTVKTLADIGFIEEIEETGHTFEENAVIKAEAIQA 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            AG   ++DDSGL ID L GKPG++SAR+A  +  +       + +E  L      +   
Sbjct: 61  KAGEMVIADDSGLSIDYLGGKPGVYSARYAGEHKNDA------ENVEKVLSELQGIEKED 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L+++ P    +   G V G I   P G+ GFGYDPIF     D+T  E++ E
Sbjct: 115 RTARFRCALAVSIPGKETKTVEGSVEGFIAEEPIGENGFGYDPIFIVKDKDQTMAELSPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           EKN                +SHRA A +         +
Sbjct: 175 EKNK---------------ISHRAVALQKLSSLLDANE 197


>gi|59711032|ref|YP_203808.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           fischeri ES114]
 gi|59479133|gb|AAW84920.1| dITP/XTP pyrophosphatase [Vibrio fischeri ES114]
          Length = 198

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 66/217 (30%), Positives = 100/217 (46%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + IV+A+ N  K+ EM  ++   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MSKIVLATGNQGKVREMADILADFGFDVVAQSEYNVSDVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PG++SAR++     ++      + I+  L +        R
Sbjct: 61  TGLPAIADDSGLEVDALNGAPGVYSARYSGEGATDQ------KNIDKMLAAMEGIPAEKR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         G   G I    +G+ GFGYDPIF  +  + +  E+  
Sbjct: 115 TARFHCVLVLMKHENDPTPLICHGTWEGHITTEQKGENGFGYDPIFWVSEDNCSSAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGQALKKLFAALKE 196


>gi|328474075|gb|EGF44880.1| dITP/XTP pyrophosphatase [Vibrio parahaemolyticus 10329]
          Length = 200

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 98/215 (45%), Gaps = 23/215 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A     ++      + +E  L +      A R
Sbjct: 61  TGLPAIADDSGLEVDFLKGAPGIYSARYAGEKASDQ------ENLEKLLAAMEGVPEAER 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G+ GFGYDPIF     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
             K                 LSHR +A K      
Sbjct: 175 ARK---------------KQLSHRGKALKSLFTQL 194


>gi|268317915|ref|YP_003291634.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rhodothermus marinus DSM 4252]
 gi|262335449|gb|ACY49246.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Rhodothermus marinus DSM 4252]
          Length = 206

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 106/219 (48%), Gaps = 25/219 (11%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKNA 66
            +V+A+ N  K+ E+ +++  L +   +A +       +E   + E NA  K+    +  
Sbjct: 9   TLVLATRNPGKLAELQAMLADLPVQLRAATDFPGAPEVKEDAATLEGNAARKARALQEFT 68

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DD+GL ++ L G PG+HSAR+A     + D    + +    +          R 
Sbjct: 69  GLPALADDTGLEVEALGGAPGVHSARFAGPTATDADNRALLLERLKGVE--------NRR 120

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F +VL+ A     +  F G   G I+   RG  GFGYDP+F P G+ +TF EM+ EEK
Sbjct: 121 ARFRTVLAFAPDARTLHLFEGICPGWILEEERGSGGFGYDPLFVPEGHTQTFAEMSMEEK 180

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR-IDEK 224
           N                +SHR +A + FV      ++E+
Sbjct: 181 N---------------RISHRGQALRAFVSFLREWLNEQ 204


>gi|221310777|ref|ZP_03592624.1| hypothetical protein Bsubs1_15491 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315102|ref|ZP_03596907.1| hypothetical protein BsubsN3_15397 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320020|ref|ZP_03601314.1| hypothetical protein BsubsJ_15303 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324303|ref|ZP_03605597.1| hypothetical protein BsubsS_15457 [Bacillus subtilis subsp.
           subtilis str. SMY]
          Length = 195

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 103/214 (48%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAK 64
               +IA+HN  K+ E   ++ P G    S  E+      EETG++FEENA++K+   AK
Sbjct: 1   MKEAIIATHNPGKVKEFKEILEPRGYDVKSLAEIGFTEEIEETGHTFEENAIMKAEAVAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL ID L G+PG++SAR+A     ++        IE  L      +   
Sbjct: 61  AVNKMVIADDSGLSIDNLGGRPGVYSARYAGEQKDDQ------ANIEKVLSELKGIEKEQ 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L+++ P    +   G V G I   PRG+ GFGYDPIF     D+T  E+T +
Sbjct: 115 RTARFRCALAVSIPGEETKTVEGHVEGYIAEEPRGEYGFGYDPIFIVKDKDKTMAELTSD 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                +SHRA A K      
Sbjct: 175 EKNK---------------ISHRADALKKLSKLL 193


>gi|90023287|ref|YP_529114.1| 50S ribosomal protein L33 [Saccharophagus degradans 2-40]
 gi|89952887|gb|ABD82902.1| Ham1-like protein [Saccharophagus degradans 2-40]
          Length = 200

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 59/219 (26%), Positives = 92/219 (42%), Gaps = 19/219 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +++AS N  K+ E   ++    +        N+   EETG SF ENA++K+  A  +
Sbjct: 1   MQKVILASGNAGKLREFQRILAEFDLDVAPQSAYNVPDAEETGLSFVENAILKARNACAH 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  A+SDDSG+ +D L+G+PGI+SAR++     +   +  + +    L           
Sbjct: 61  TGFAAISDDSGIEVDALNGQPGIYSARFSGPGATDAKNNALLLEKLEGL----PEAERTA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + V      D       G   G I+  PRG+ GFGYDP+F    +     E+  E 
Sbjct: 117 RYQCVLVYMRHATDPTPIICQGAWEGTILTAPRGEGGFGYDPLFWVPSHQCASAELPAEV 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           KN                +SHRA A +  +        K
Sbjct: 177 KNS---------------ISHRAIAMQALLAQIRAQQAK 200


>gi|157372268|ref|YP_001480257.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Serratia
           proteamaculans 568]
 gi|157324032|gb|ABV43129.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Serratia proteamaculans 568]
          Length = 197

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 104/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+  L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNPGKVRELADLLADFGLNVVAQTELGVESAEETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A  +  +R      Q ++  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYAGVDASDR------QNLDKLLVALKDVPQGSR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G  +G I     G+ GFGYDPIF      RT  E++ 
Sbjct: 115 GAQFHCVLVYLRHAEDPTPLVFHGSWAGEITDTAAGEGGFGYDPIFYVPELGRTAAELSR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +EK                 +SHR +A K  ++    
Sbjct: 175 DEK---------------RAISHRGKALKLMLEAMRN 196


>gi|126175232|ref|YP_001051381.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella baltica OS155]
 gi|125998437|gb|ABN62512.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella baltica OS155]
          Length = 205

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 72/215 (33%), Positives = 99/215 (46%), Gaps = 24/215 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  K+ E D ++   G+      + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MQQIVLASGNKGKLAEFDQMLASYGVTVLPQSQFNVSEVAETGTTFVENAIIKARHAAEI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D+L G PGI+SAR+A  N  ++D  +        L       PA R
Sbjct: 61  TGLAAIADDSGLEVDLLQGAPGIYSARYAGENAKDQDNVLK-------LLETLKDQPAPR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL       D           G I +  RG  G GYDPIF P  Y  +  E++ 
Sbjct: 114 SARFQCVLVYMRHAKDPTPIICQAAWEGQIDFNQRGDNGHGYDPIFIPENYQCSAAELSS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            EKN                LSHR +A    +   
Sbjct: 174 NEKNA---------------LSHRGKALVQLIAAM 193


>gi|317403013|gb|EFV83551.1| HAM1-type NTP pyrophosphatase [Achromobacter xylosoxidans C54]
          Length = 207

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 104/214 (48%), Gaps = 22/214 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E  +L  PLGI      EL +   EE   +F ENA+ K+  A++  
Sbjct: 11  RRVVLASNNPGKLREFSALFAPLGIELVPQGELGVPEAEEPHVTFVENALAKARHASRLT 70

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +  L G PG++SAR+A+ + GE+          NAL  +     + RS
Sbjct: 71  GLPALADDSGLCVAALGGAPGVYSARYAKMHGGEKSDQAN-----NALLVEKLAAASDRS 125

Query: 127 AHFISVLSLAW--PDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           A +++VL+L     D       G   G I+  P G  GFGYDP F       T   +  E
Sbjct: 126 ACYVAVLALVRGENDPRPLIGEGLWQGEIIDQPEGVNGFGYDPHFYLPDQGLTAAALEPE 185

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                +SHRARA +  +   
Sbjct: 186 EKNA---------------ISHRARALRELLSKL 204


>gi|163803813|ref|ZP_02197665.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           sp. AND4]
 gi|159172393|gb|EDP57267.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           sp. AND4]
          Length = 200

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 98/217 (45%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D L G PGI+SAR+A     ++      + +E  L++      + R
Sbjct: 61  TGLAAIADDSGLEVDFLKGAPGIYSARYAGEKASDQ------ENLEKLLKAMEGVPESER 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L     D       GK  G I+   +G  GFGYDPIF     +    E+  
Sbjct: 115 TARFHCVLVLMRHANDPTPIVCHGKWEGRILIEAQGDNGFGYDPIFFVPEDNCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGKALKSLFVQLSE 196


>gi|332882734|ref|ZP_08450345.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332679236|gb|EGJ52222.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 194

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 100/217 (46%), Gaps = 26/217 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAKN 65
             +V A+HN+ K+ E+ +L+ P  I   S  ++       ET  + E NA++K+    K+
Sbjct: 1   MKLVFATHNIHKLKEIQALL-PQTIELLSLSDIGCNEEIAETAATIEGNALLKAQYVKKH 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                 +DD+GL +  L G PG+ SAR+A     + D           L  K       R
Sbjct: 60  YHYDVFADDTGLEVTALGGAPGVFSARYAGVQKSDIDNIA--------LLLKNMEAQQDR 111

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           SAHF +V++L      V  F G   G I   P G  GFGYDPIF P GY +TF E++  E
Sbjct: 112 SAHFKTVIALC-MGDEVHTFEGIAQGYITKEPVGTNGFGYDPIFVPEGYSQTFAELSAAE 170

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           KN                +SHRA+AF   ++    + 
Sbjct: 171 KN---------------RISHRAKAFGKLIEALGELS 192


>gi|114564029|ref|YP_751543.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Shewanella frigidimarina NCIMB 400]
 gi|114335322|gb|ABI72704.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Shewanella frigidimarina NCIMB 400]
          Length = 224

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 65/219 (29%), Positives = 95/219 (43%), Gaps = 21/219 (9%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M  L +  IV+AS N  K+ E D ++    I      + N+    ETG +F ENA+IK+ 
Sbjct: 12  MHTLAKQQIVLASGNKGKLAEFDQMLTAFNIEVLPQNQFNVTEVAETGTTFVENAIIKAR 71

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AA+  G  A++DDSG+ +D L G+PGI+SAR++     E             L +    
Sbjct: 72  HAAEITGKAAIADDSGIEVDALQGQPGIYSARYSGPGATE------TSNYLKLLDALQGE 125

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
                    + V      D           G I   P+G+ G GYDP+F P G+D +  E
Sbjct: 126 TLRSARFQCVLVYMRHAKDPTPIICQASWEGTINHVPQGEQGHGYDPVFIPQGFDCSAAE 185

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           +T E+KN                 SHR +A +  V    
Sbjct: 186 LTREQKNAH---------------SHRGKALELLVSAMK 209


>gi|88801069|ref|ZP_01116617.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Reinekea
           sp. MED297]
 gi|88776208|gb|EAR07435.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Reinekea
           sp. MED297]
          Length = 202

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 108/215 (50%), Gaps = 22/215 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
                 V+AS+N  K+ E   L+ P  I      E  +    E G SF ENA+IK+  A+
Sbjct: 2   QTNQEWVLASNNAGKLKEFSELLAPKSITIKPQKEYGVDDAIEDGLSFIENAIIKARHAS 61

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G+PAL+DDSGL +DVLDG PGI+SAR+A  + GE+     ++K+ + ++        
Sbjct: 62  KATGLPALADDSGLEVDVLDGAPGIYSARYASMDGGEKSDRANLEKVLSEMQDA-----Q 116

Query: 124 FRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            R+A F  VL+      D       G   G ++  PRG+ GFGYDPIF    +  +  E+
Sbjct: 117 NRTARFHCVLAFVRHALDPTPIIIQGTWEGSLLTEPRGEQGFGYDPIFWVEDHQCSAAEL 176

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           ++ +KN                LSHR +A + FV 
Sbjct: 177 SKAQKNA---------------LSHRGQAVRQFVA 196


>gi|290967729|ref|ZP_06559284.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Megasphaera genomosp. type_1 str. 28L]
 gi|290782245|gb|EFD94818.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Megasphaera genomosp. type_1 str. 28L]
          Length = 195

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 75/215 (34%), Positives = 107/215 (49%), Gaps = 23/215 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL--NLIIPEETGNSFEENAMIKSLTAA 63
              +V+A+HN  KI E+ +++ P G    +  E+   L  PEETG +F ENA +KS   A
Sbjct: 1   MRQLVLATHNAGKIRELRTMLSPAGYEVVAVREVLPTLKEPEETGQTFLENARLKSQYYA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G P L+DDSGL ++ L G+PG++SAR+A  +  +   +  +      L       PA
Sbjct: 61  KATGRPCLADDSGLCVEALQGRPGVYSARYAGIHGDDAANNAKLLTEIRHL------PPA 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A++  VL L++PDG      GK  G+I+  P G  GFGYDP F      +T  E+T 
Sbjct: 115 MRTAYYACVLVLSFPDGREIVAEGKCHGMIIETPVGTNGFGYDPYFYLPQKGKTMAELTA 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            EKN                 SHR  A K  +   
Sbjct: 175 IEKN---------------TCSHRGIALKKLLQVL 194


>gi|309378956|emb|CBX22409.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 199

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 84/211 (39%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P GI      E  +    E   +F ENA+ K+  AA ++G
Sbjct: 7   KIVLASGNAGKLKEFGNLFKPYGITVLPQSEFGIPECPEPYPTFVENALAKAWHAAGHSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A SN                              
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGSN-----PKSDTANNLKLAAELVGKADKSCCY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P GQ GFGYDP F    + +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGVWHGQWNDTPLGQNGFGYDPYFYLPEHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALADLIRKL 197


>gi|313668874|ref|YP_004049158.1| hypothetical protein NLA_15930 [Neisseria lactamica ST-640]
 gi|313006336|emb|CBN87799.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 199

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 66/211 (31%), Positives = 86/211 (40%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P GI      E  +    E  ++F ENA+ K+  AAK +G
Sbjct: 7   KIVLASGNAGKLKEFGNLFKPYGITVLPQSEFGIPECPEPYSTFVENALAKARHAAKYSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A SN                            S 
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGSN-----PKSDTANNLKLAAELAGKADKSCSY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P GQ GFGYDP F    + +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGVWHGQWHDTPLGQNGFGYDPYFYLPEHGKTAAELDAEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALADLIRKL 197


>gi|110802153|ref|YP_699515.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Clostridium perfringens SM101]
 gi|110682654|gb|ABG86024.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium perfringens SM101]
          Length = 204

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 69/225 (30%), Positives = 101/225 (44%), Gaps = 28/225 (12%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
               ++AS+N  K+ E+  ++    +   S  E  + I  EE G +FEEN+  K+    K
Sbjct: 1   MKKFILASNNAHKVKEIKEILKDFNLNILSLNEAGIDIDVEEDGKTFEENSFKKANEIRK 60

Query: 65  N------AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
                  +    ++DDSGL +D L+G PGI+SAR+A  +  +   +      E  L    
Sbjct: 61  YLLSRGESDFIVMADDSGLEVDYLNGAPGIYSARYAGEHGNDSKNN------EKLLEELK 114

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
                 R A+FI V+      G      GK  G+I+    G  GFGYDP+F    Y +TF
Sbjct: 115 NVKDDERKANFICVIVAVTDKGEKIVAEGKSYGVILEALSGNEGFGYDPLFFVPEYKKTF 174

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
            EMT +EKN                +SHR RA +   DN   I +
Sbjct: 175 AEMTSDEKNA---------------ISHRGRALEKLKDNLKGILK 204


>gi|300311450|ref|YP_003775542.1| xanthosine triphosphate pyrophosphatase [Herbaspirillum seropedicae
           SmR1]
 gi|300074235|gb|ADJ63634.1| xanthosine triphosphate pyrophosphatase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 196

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 64/215 (29%), Positives = 98/215 (45%), Gaps = 21/215 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
            +  IV+AS+N  K+ E  SL+  +G+      E ++   EE   +F ENA+ K+  AA+
Sbjct: 3   TKQKIVMASNNAGKLKEFASLLGGIGLDVRPQGEFDVPEAEEPFATFVENALAKARHAAR 62

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PAL+DDSG+ ++ L G PG++SAR+A     +   +         +R   AH    
Sbjct: 63  LTGLPALADDSGVCVNALGGAPGVYSARYAGEPKSDAANNA------KLIRELAAHADKS 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
              + + V      D       G   G IV   RG+ GFGYDP F      +T  E++  
Sbjct: 117 AYYYCVLVYVRHADDPQPVIADGVWKGEIVEQARGEGGFGYDPYFLLPALGKTAAELSAA 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EKN                +SHR +A +  V+   
Sbjct: 177 EKNA---------------VSHRGQALRALVEKLK 196


>gi|145628581|ref|ZP_01784381.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae 22.1-21]
 gi|144979051|gb|EDJ88737.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae 22.1-21]
          Length = 195

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 101/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A D   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHVAQDQRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPMDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETV 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A        
Sbjct: 177 EKKK---------------ISHRAKALSVLKSKL 195


>gi|332881593|ref|ZP_08449242.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332680591|gb|EGJ53539.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 196

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 69/220 (31%), Positives = 109/220 (49%), Gaps = 27/220 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTA 62
           ++  +V A++N  K+ E+ +++    I   S  +++    IPE T ++ E NA  KS   
Sbjct: 1   MKKRLVFATNNAHKLEEIRAILGN-SIEILSLADIHCHADIPE-TADTLEGNARQKSRYV 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            ++ G+   +DD+GL ++ L G PG++SAR+A+    +      M K+   +  K     
Sbjct: 59  YEHYGLDCFADDTGLEVESLGGAPGVYSARYADGQGHDSQ--ANMNKLLKEMEEKND--- 113

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F +++SL    G    F G V G I    RG+ GFGYDPIFQP+GY+ TF E+ 
Sbjct: 114 --RKAQFRTIISL-IEKGEERQFEGIVKGQITREKRGESGFGYDPIFQPDGYETTFAELG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
            + KN                +SHRARA     D   + +
Sbjct: 171 SDIKN---------------RISHRARAVAALCDYLRKNN 195


>gi|261401094|ref|ZP_05987219.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria lactamica ATCC 23970]
 gi|269208989|gb|EEZ75444.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria lactamica ATCC 23970]
          Length = 199

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 66/211 (31%), Positives = 86/211 (40%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P GI      E  +    E  ++F ENA+ K+  AAK +G
Sbjct: 7   KIVLASGNAGKLKEFGNLFKPYGITVLPQSEFGIPECPEPYSTFVENALAKARHAAKYSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A SN                            S 
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGSN-----PKSDTANNLKLAAELAGKADKSCSY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P GQ GFGYDP F    + +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGVWHGQWHDTPLGQNGFGYDPYFYLPEHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALADLIRKL 197


>gi|255282107|ref|ZP_05346662.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bryantella formatexigens DSM 14469]
 gi|255267426|gb|EET60631.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bryantella formatexigens DSM 14469]
          Length = 211

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 73/221 (33%), Positives = 104/221 (47%), Gaps = 22/221 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAA 63
           +E  I+ A+ N  K+ E+  ++  LG+   S  E  +    EE G SF ENAMIK+    
Sbjct: 1   MEGKIIFATGNEGKMKEVRMILADLGVPVLSQKEAGITADVEENGASFAENAMIKACAVK 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K      L+DDSGL ID LDG PGI+SAR+    T     +       + L       P 
Sbjct: 61  KLTDAVVLADDSGLEIDYLDGAPGIYSARYMGEQTPYEVKNR------HILELLADVPPK 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+ V++ A PDG V    G + G I +   G+ GFGYDP+F    Y  T  E++ 
Sbjct: 115 KRTARFVCVIAAALPDGTVLTSEGVMEGEIGYASAGENGFGYDPVFYLPQYGCTSAEISP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           E+KN                +SHR +A +   +      +K
Sbjct: 175 EQKNE---------------ISHRGKALRAMKEKLKAYYDK 200


>gi|257085617|ref|ZP_05579978.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis Fly1]
 gi|256993647|gb|EEU80949.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis Fly1]
          Length = 451

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 72/222 (32%), Positives = 99/222 (44%), Gaps = 22/222 (9%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTA 62
           L E  IVIA+ N  K  E  S+    G    + L+  NL   EETG +FEENA +K+ T 
Sbjct: 251 LEEKVIVIATRNPGKAKEFSSIFGEKGYTVKTLLDYPNLPDVEETGRTFEENARLKAETI 310

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A+    P L+DDSGL++D L G PGI+SAR+A   T +   +         L        
Sbjct: 311 AEILQKPVLADDSGLIVDALGGMPGIYSARFAGEPTNDASNNA------KLLHELTGVPK 364

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F   L  A P         +  G +   PRG+ GFGYD +F    + +T  E++
Sbjct: 365 EKRQARFHCTLVFAEPKKESLVVEAEWPGEVGTIPRGEGGFGYDSLFYVPEFGKTAAELS 424

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
            EEKN                +SHR +A     +      +K
Sbjct: 425 GEEKNK---------------VSHRGQAVAKLKEQWEEWLKK 451


>gi|153001558|ref|YP_001367239.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella baltica OS185]
 gi|151366176|gb|ABS09176.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella baltica OS185]
          Length = 205

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 72/215 (33%), Positives = 99/215 (46%), Gaps = 24/215 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  K+ E D ++   G+      + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MQQIVLASGNKGKLAEFDQMLASYGVTVLPQSQFNVSEVAETGTTFVENAIIKARHAAEI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D+L G PGI+SAR+A  N  ++D  +        L       PA R
Sbjct: 61  TGLAAIADDSGLEVDLLQGAPGIYSARYAGENAKDQDNVLK-------LLETIKDQPAPR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL       D           G I +  RG  G GYDPIF P  Y  +  E++ 
Sbjct: 114 SARFQCVLVYMRHAKDPTPIICQAAWEGQIDFNQRGDNGHGYDPIFIPENYQCSAAELSS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            EKN                LSHR +A    +   
Sbjct: 174 NEKNA---------------LSHRGKALVQLIAAM 193


>gi|293572585|ref|ZP_06683559.1| ribonuclease PH/Ham1 protein [Enterococcus faecium E980]
 gi|291607368|gb|EFF36716.1| ribonuclease PH/Ham1 protein [Enterococcus faecium E980]
          Length = 451

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 98/219 (44%), Gaps = 22/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              I+IA+ N  K  E  ++    G    + L+   L   EETG++FEENA +K+ T A+
Sbjct: 251 TKTIIIATRNPGKAEEFRNMFKEAGYHVKTLLDYPELPDVEETGSTFEENARLKAETIAQ 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL +D L G PGI+SAR+A     +   +         L          
Sbjct: 311 VLDQPVLADDSGLKVDALGGMPGIYSARFAGEQKSDAGNNA------KLLYELTDVPDEK 364

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L  A P         +  G +   P G+ GFGYDP+F P G  +T  E++ E
Sbjct: 365 RTAQFHCTLVFAAPKKDSLVVEAEWPGRVARIPSGENGFGYDPLFIPEGKKQTAAELSSE 424

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EKN                +SHRA+A K       +  E
Sbjct: 425 EKNK---------------ISHRAQAMKKLSAEWKQWLE 448


>gi|309750325|gb|ADO80309.1| dITP/XTP pyrophosphatase [Haemophilus influenzae R2866]
          Length = 195

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 100/214 (46%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+   ++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYTSE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A D   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHVAQDKRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETV 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A        
Sbjct: 177 EKKK---------------ISHRAKALSVLKSKL 195


>gi|120553466|ref|YP_957817.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Marinobacter aquaeolei VT8]
 gi|120323315|gb|ABM17630.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Marinobacter aquaeolei VT8]
          Length = 199

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 77/217 (35%), Positives = 107/217 (49%), Gaps = 23/217 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +VIAS+N  KI E+  L+ PLG+   +  EL +   EE   +F ENA+IK+  AA+
Sbjct: 1   MARKLVIASNNKGKIAELTDLLAPLGLQPVAQGELGVSEAEEPAVTFVENAIIKARHAAR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PAL+DDSGL +D LDG+PG+ SAR+A     +         +E  L +      A 
Sbjct: 61  VTGLPALADDSGLAVDALDGRPGVRSARFAGEEATD------NDNVEALLAALKDTPEAE 114

Query: 125 RSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           RSA F  VL       D       G+  G I+  PRGQ GFGYDP+F    +  +  E+T
Sbjct: 115 RSAQFHCVLVYLRHADDPTPIICHGRWPGRILAEPRGQGGFGYDPVFLVPEHGCSAAELT 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            E+K                 +SHR RA    +D   
Sbjct: 175 REQK---------------GRISHRGRALASLLDQLR 196


>gi|194017103|ref|ZP_03055715.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacillus pumilus ATCC 7061]
 gi|194010971|gb|EDW20541.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacillus pumilus ATCC 7061]
          Length = 197

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 70/218 (32%), Positives = 103/218 (47%), Gaps = 22/218 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAK 64
               +IA+HN  K  E  +++ P G    +  ++      EETG +FEENA+IK+     
Sbjct: 1   MKTAIIATHNAGKAKEFKAILEPKGFTVKTLADIGFTEEIEETGQTFEENAIIKAEAIQA 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            AG   ++DDSGL ID L GKPG++SAR+A  +  +       + +E  L      +   
Sbjct: 61  KAGEMVIADDSGLSIDFLGGKPGVYSARYAGEHKNDA------ENVEKVLSELQGIEKED 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L+++ P    +   G V G I   P G+ GFGYDPIF     D+T  E++ E
Sbjct: 115 RTARFRCALAVSIPGKETKTVEGSVEGFIAEEPIGENGFGYDPIFIVKDKDQTMAELSPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           EKN                +SHRA A +         +
Sbjct: 175 EKNK---------------ISHRAVALQKLSSLLDANE 197


>gi|260582857|ref|ZP_05850642.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Haemophilus influenzae NT127]
 gi|260094070|gb|EEW77973.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Haemophilus influenzae NT127]
          Length = 195

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 101/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A +   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHVAQEQRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECHGVIGFEEKGENGFGYDSLFFSPELGCTFAELETV 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A        
Sbjct: 177 EKKK---------------ISHRAKALSVLKSKL 195


>gi|238754615|ref|ZP_04615969.1| Nucleoside-triphosphatase [Yersinia ruckeri ATCC 29473]
 gi|238707246|gb|EEP99609.1| Nucleoside-triphosphatase [Yersinia ruckeri ATCC 29473]
          Length = 197

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 103/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+  L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNPGKVRELAGLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A  +  ++        +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYAGESASDQ------ANLEKLLVTMKDVPDEQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  G+I     G  GFGYDPIF      ++  E++ 
Sbjct: 115 GAQFHCVLVYMRHAEDPTPLVFHGRWPGMIAHESAGVGGFGYDPIFYVPELGKSAAELSR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK                 +SHR +A K  +D    
Sbjct: 175 EEK---------------QAVSHRGKALKLMLDALRN 196


>gi|332702709|ref|ZP_08422797.1| Nucleoside-triphosphatase rdgB [Desulfovibrio africanus str. Walvis
           Bay]
 gi|332552858|gb|EGJ49902.1| Nucleoside-triphosphatase rdgB [Desulfovibrio africanus str. Walvis
           Bay]
          Length = 212

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 74/212 (34%), Positives = 105/212 (49%), Gaps = 22/212 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              IV+A+ N  KI E+ +++ PL +          +    ETG +FEENA+IK+    +
Sbjct: 1   MQKIVLATRNRGKIAELSAMLGPLDVEVVGLDAFPEIGEIPETGKTFEENALIKARAVCQ 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            AG+PAL+DDSGLV+D L G PG++SAR+A     + D +         LR      P  
Sbjct: 61  AAGLPALADDSGLVVDALAGAPGVYSARFAGERATDADNNA------KLLREMATVPPER 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           RSAHF+ V++   P+G      G   G I   P+GQ GFGYDP+F       +  E+  E
Sbjct: 115 RSAHFVCVVAAVAPNGATVTARGTWDGEIARKPKGQGGFGYDPLFLDPELGMSAAELDPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +KN                 SHR RA +  +D
Sbjct: 175 QKNAR---------------SHRGRALRKLMD 191


>gi|313894022|ref|ZP_07827588.1| non-canonical purine NTP pyrophosphatase RdgB [Veillonella sp. oral
           taxon 158 str. F0412]
 gi|313441586|gb|EFR60012.1| non-canonical purine NTP pyrophosphatase RdgB [Veillonella sp. oral
           taxon 158 str. F0412]
          Length = 191

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 104/214 (48%), Gaps = 24/214 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              IV+A+ N  KI E       L I      E+  +  PEETG +F ENA++K+   AK
Sbjct: 1   MEQIVLATGNKGKIREFSEAFSHLSIDCVPVKEVVTIEEPEETGTTFMENALLKAHYYAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSG+ +D L+G PG++SAR+A  +  ++  +  + +             + 
Sbjct: 61  ATNRPCLADDSGITVDALNGAPGVYSARYAGHHGDDQANNEKLIREL--------QGKSD 112

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+ H++  L+L +PDG      G   G++   P+G  GFGYDP F    +++T  E+T E
Sbjct: 113 RTGHYVCALALVYPDGREVTAEGYCDGLVQDEPKGDNGFGYDPYFYVPQFEKTMAELTIE 172

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK               + +SHR RA +  +   
Sbjct: 173 EK---------------ETISHRGRALRELISKL 191


>gi|167623101|ref|YP_001673395.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella halifaxensis HAW-EB4]
 gi|167353123|gb|ABZ75736.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella halifaxensis HAW-EB4]
          Length = 199

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 64/215 (29%), Positives = 93/215 (43%), Gaps = 21/215 (9%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            N IV+AS N  K+ E   L+   G+   +  + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MNQIVLASGNKGKLKEFSELMANYGVEILAQSQFNVSEVAETGTTFVENAIIKARHAAEI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  A++DDSGL +D L G PGI+SAR+A     +       Q     L +         
Sbjct: 61  TGHAAIADDSGLEVDFLQGAPGIYSARYAGEGAKDE------QNYTKLLSALEGQTERNA 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + V      D           G I +   G+ G GYDPIF P  +D    E++ +E
Sbjct: 115 RFQCVLVYMRHAKDPTPIICQASWEGTIAFEALGENGHGYDPIFIPAEHDCAAAELSSDE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           KN                LSHR +A    ++   +
Sbjct: 175 KNK---------------LSHRGKALVLLIEAMKQ 194


>gi|300727546|ref|ZP_07060937.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella bryantii B14]
 gi|299775249|gb|EFI71850.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella bryantii B14]
          Length = 199

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 71/216 (32%), Positives = 104/216 (48%), Gaps = 22/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL--NLIIPEETGNSFEENAMIKSLTAAK 64
             IV A++N  K+ E+  ++        S  ++  ++ IPE TG + E NA  K+    +
Sbjct: 1   MKIVFATNNQHKLQEIREILGS-DFEVVSLKDIGCDVDIPE-TGTTLEANAHQKASYIYE 58

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           N G+   +DD+GL ++ LDG PG+HSAR+AE    + D +  M K+   L  K      F
Sbjct: 59  NYGLDCFADDTGLEVEALDGAPGVHSARYAE--GTDHDSEANMAKLLKELEGKNNRKARF 116

Query: 125 RSAHFISVLSLAWPDGHVEN-FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           R+   +            E  F G+V G I     G+ GFGYDPIF P GYD++F E+ E
Sbjct: 117 RTVIALIQKEGDSTICSREYSFEGEVKGEIATEKSGKGGFGYDPIFVPEGYDKSFAELGE 176

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           E KN                +SHRARA     ++  
Sbjct: 177 EIKNK---------------ISHRARAVAKLAEHLK 197


>gi|293554040|ref|ZP_06674640.1| ribonuclease PH/Ham1 protein [Enterococcus faecium E1039]
 gi|291601822|gb|EFF32074.1| ribonuclease PH/Ham1 protein [Enterococcus faecium E1039]
          Length = 451

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 98/219 (44%), Gaps = 22/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              I+IA+ N  K  E  ++    G    + L+   L   EETG++FEENA +K+ T A+
Sbjct: 251 TKTIIIATRNPGKAEEFRNMFKEAGYHVKTLLDYPELPDVEETGSTFEENARLKAETIAQ 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL +D L G PGI+SAR+A     +   +         L          
Sbjct: 311 LLDQPVLADDSGLKVDALGGMPGIYSARFAGEQKSDAGNNA------KLLYELTDVPDEK 364

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L  A P         +  G +   P G+ GFGYDP+F P G  +T  E++ E
Sbjct: 365 RTAQFHCTLVFAAPKKDSLVVEAEWPGRVARIPSGENGFGYDPLFIPEGKKQTAAELSSE 424

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EKN                +SHRA+A K       +  E
Sbjct: 425 EKNK---------------ISHRAQAMKKLSAEWKQWLE 448


>gi|293569789|ref|ZP_06680876.1| ribonuclease PH/Ham1 protein [Enterococcus faecium E1071]
 gi|291587537|gb|EFF19414.1| ribonuclease PH/Ham1 protein [Enterococcus faecium E1071]
          Length = 451

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 98/219 (44%), Gaps = 22/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              I+IA+ N  K  E  ++    G    + L+   L   EETG++FEENA +K+ T A+
Sbjct: 251 TKTIIIATRNPGKAEEFRNMFKEAGYHVKTLLDYPELPDVEETGSTFEENARLKAETIAQ 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL +D L G PGI+SAR+A     +   +         L          
Sbjct: 311 LLDQPVLADDSGLKVDALGGMPGIYSARFAGEQKSDAGNNA------KLLYELTDVPDEK 364

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L  A P         +  G +   P G+ GFGYDP+F P G  +T  E++ E
Sbjct: 365 RTAQFHCTLVFAAPKKDSLVVEAEWPGRVARIPSGENGFGYDPLFIPEGKKQTAAELSSE 424

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EKN                +SHRA+A K       +  E
Sbjct: 425 EKNK---------------ISHRAQAMKKLSAEWKQWLE 448


>gi|257884710|ref|ZP_05664363.1| ribonuclease PH/Ham1 [Enterococcus faecium 1,231,501]
 gi|257820548|gb|EEV47696.1| ribonuclease PH/Ham1 [Enterococcus faecium 1,231,501]
          Length = 451

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 98/219 (44%), Gaps = 22/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              I+IA+ N  K  E  ++    G    + L+   L   EETG++FEENA +K+ T A+
Sbjct: 251 TKTIIIATRNPGKAEEFRNMFKEAGYHVKTLLDYPELPDVEETGSTFEENARLKAETIAQ 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL +D L G PGI+SAR+A     +   +         L          
Sbjct: 311 LLDQPVLADDSGLKVDALGGMPGIYSARFAGEQKSDAGNNA------KLLYELTDVPDEK 364

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L  A P         +  G +   P G+ GFGYDP+F P G  +T  E++ E
Sbjct: 365 RTAQFHCTLVFAAPKKDSLVVEAEWPGRVARIPSGENGFGYDPLFIPEGKKQTAAELSSE 424

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EKN                +SHRA+A K       +  E
Sbjct: 425 EKNK---------------ISHRAQAMKKLSAEWKQWLE 448


>gi|257878167|ref|ZP_05657820.1| ribonuclease PH/Ham1 [Enterococcus faecium 1,230,933]
 gi|257881049|ref|ZP_05660702.1| ribonuclease PH/Ham1 [Enterococcus faecium 1,231,502]
 gi|257889634|ref|ZP_05669287.1| ribonuclease PH/Ham1 [Enterococcus faecium 1,231,410]
 gi|257892426|ref|ZP_05672079.1| ribonuclease PH/Ham1 [Enterococcus faecium 1,231,408]
 gi|260559214|ref|ZP_05831400.1| ribonuclease PH/Ham1 protein [Enterococcus faecium C68]
 gi|261207747|ref|ZP_05922432.1| ribonuclease PH/Ham1 protein [Enterococcus faecium TC 6]
 gi|289565822|ref|ZP_06446264.1| ribonuclease PH [Enterococcus faecium D344SRF]
 gi|293563126|ref|ZP_06677591.1| ribonuclease PH/Ham1 protein [Enterococcus faecium E1162]
 gi|294614004|ref|ZP_06693934.1| ribonuclease PH/Ham1 protein [Enterococcus faecium E1636]
 gi|294617101|ref|ZP_06696767.1| ribonuclease PH/Ham1 protein [Enterococcus faecium E1679]
 gi|294623312|ref|ZP_06702174.1| ribonuclease PH/Ham1 protein [Enterococcus faecium U0317]
 gi|314939893|ref|ZP_07847099.1| ribonuclease PH [Enterococcus faecium TX0133a04]
 gi|314943740|ref|ZP_07850479.1| ribonuclease PH [Enterococcus faecium TX0133C]
 gi|314949696|ref|ZP_07853014.1| ribonuclease PH [Enterococcus faecium TX0082]
 gi|314953242|ref|ZP_07856181.1| ribonuclease PH [Enterococcus faecium TX0133A]
 gi|314993678|ref|ZP_07859026.1| ribonuclease PH [Enterococcus faecium TX0133B]
 gi|314997405|ref|ZP_07862356.1| ribonuclease PH [Enterococcus faecium TX0133a01]
 gi|257812395|gb|EEV41153.1| ribonuclease PH/Ham1 [Enterococcus faecium 1,230,933]
 gi|257816707|gb|EEV44035.1| ribonuclease PH/Ham1 [Enterococcus faecium 1,231,502]
 gi|257825994|gb|EEV52620.1| ribonuclease PH/Ham1 [Enterococcus faecium 1,231,410]
 gi|257828805|gb|EEV55412.1| ribonuclease PH/Ham1 [Enterococcus faecium 1,231,408]
 gi|260074971|gb|EEW63287.1| ribonuclease PH/Ham1 protein [Enterococcus faecium C68]
 gi|260078130|gb|EEW65836.1| ribonuclease PH/Ham1 protein [Enterococcus faecium TC 6]
 gi|289162365|gb|EFD10223.1| ribonuclease PH [Enterococcus faecium D344SRF]
 gi|291593111|gb|EFF24690.1| ribonuclease PH/Ham1 protein [Enterococcus faecium E1636]
 gi|291596638|gb|EFF27865.1| ribonuclease PH/Ham1 protein [Enterococcus faecium E1679]
 gi|291597280|gb|EFF28469.1| ribonuclease PH/Ham1 protein [Enterococcus faecium U0317]
 gi|291604904|gb|EFF34373.1| ribonuclease PH/Ham1 protein [Enterococcus faecium E1162]
 gi|313588540|gb|EFR67385.1| ribonuclease PH [Enterococcus faecium TX0133a01]
 gi|313591852|gb|EFR70697.1| ribonuclease PH [Enterococcus faecium TX0133B]
 gi|313594708|gb|EFR73553.1| ribonuclease PH [Enterococcus faecium TX0133A]
 gi|313597603|gb|EFR76448.1| ribonuclease PH [Enterococcus faecium TX0133C]
 gi|313640856|gb|EFS05436.1| ribonuclease PH [Enterococcus faecium TX0133a04]
 gi|313643954|gb|EFS08534.1| ribonuclease PH [Enterococcus faecium TX0082]
          Length = 451

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 98/219 (44%), Gaps = 22/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              I+IA+ N  K  E  ++    G    + L+   L   EETG++FEENA +K+ T A+
Sbjct: 251 TKTIIIATRNPGKAEEFRNMFKEAGYHVKTLLDYPELPDVEETGSTFEENARLKAETIAQ 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL +D L G PGI+SAR+A     +   +         L          
Sbjct: 311 LLDQPVLADDSGLKVDALGGMPGIYSARFAGEQKSDAGNNA------KLLYELTDVPDEK 364

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L  A P         +  G +   P G+ GFGYDP+F P G  +T  E++ E
Sbjct: 365 RTAQFHCTLVFAAPKKDSLVVEAEWPGRVARIPSGENGFGYDPLFIPEGKKQTAAELSSE 424

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EKN                +SHRA+A K       +  E
Sbjct: 425 EKNK---------------ISHRAQAMKKLSAEWKQWLE 448


>gi|227551340|ref|ZP_03981389.1| tRNA nucleotidyltransferase [Enterococcus faecium TX1330]
 gi|257887545|ref|ZP_05667198.1| ribonuclease PH/Ham1 [Enterococcus faecium 1,141,733]
 gi|257896040|ref|ZP_05675693.1| ribonuclease PH/Ham1 [Enterococcus faecium Com12]
 gi|257898668|ref|ZP_05678321.1| ribonuclease PH/Ham1 [Enterococcus faecium Com15]
 gi|293378788|ref|ZP_06624945.1| tRNA nucleotidyltransferase [Enterococcus faecium PC4.1]
 gi|227179551|gb|EEI60523.1| tRNA nucleotidyltransferase [Enterococcus faecium TX1330]
 gi|257823599|gb|EEV50531.1| ribonuclease PH/Ham1 [Enterococcus faecium 1,141,733]
 gi|257832605|gb|EEV59026.1| ribonuclease PH/Ham1 [Enterococcus faecium Com12]
 gi|257836580|gb|EEV61654.1| ribonuclease PH/Ham1 [Enterococcus faecium Com15]
 gi|292642581|gb|EFF60734.1| tRNA nucleotidyltransferase [Enterococcus faecium PC4.1]
          Length = 451

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 98/219 (44%), Gaps = 22/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              I+IA+ N  K  E  ++    G    + L+   L   EETG++FEENA +K+ T A+
Sbjct: 251 TKTIIIATRNPGKAEEFRNMFKEAGYHVKTLLDYPELPDVEETGSTFEENARLKAETIAQ 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL +D L G PGI+SAR+A     +   +         L          
Sbjct: 311 LLDQPVLADDSGLKVDALGGMPGIYSARFAGEQKSDAGNNA------KLLYELTDVPDEK 364

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L  A P         +  G +   P G+ GFGYDP+F P G  +T  E++ E
Sbjct: 365 RTAQFHCTLVFAAPKKDSLVVEAEWPGRVARIPSGENGFGYDPLFIPEGKKQTAAELSSE 424

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EKN                +SHRA+A K       +  E
Sbjct: 425 EKNK---------------ISHRAQAMKKLSAEWKQWLE 448


>gi|55981623|ref|YP_144920.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Thermus
           thermophilus HB8]
 gi|62900175|sp|Q5SHS6|NTPA_THET8 RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|55773036|dbj|BAD71477.1| nucleoside-triphosphatase (HAM1 protein) [Thermus thermophilus HB8]
          Length = 207

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 75/219 (34%), Positives = 119/219 (54%), Gaps = 24/219 (10%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + +   +V+A+ N  K+ E+   + PLG    +  +  L +P+E G +F ENA++K+ 
Sbjct: 1   MLRGM--KVVLATGNPGKVRELKEGLAPLGWTLLTLADFALRMPKEEGATFLENALLKAA 58

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             AK  G+PAL+DDSGL +  L G+PG++SAR+      +R+ ++ + +    L+ +   
Sbjct: 59  YVAKATGLPALADDSGLEVYALGGEPGVYSARYGG-RATDRERNVYLLERMRHLKGEE-- 115

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R A F++VL LA+PDGH E + G V G+I+  PRG+ GFGYDP+F      +TF E
Sbjct: 116 ----RKARFVAVLVLAYPDGHAEAYEGSVEGVILEAPRGEGGFGYDPLFYVPEAGKTFAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M  EEK                  SHR +A +  ++   
Sbjct: 172 MGLEEK---------------ARYSHRGKALRALLEAYK 195


>gi|37199813|dbj|BAC95643.1| xanthosine triphosphate pyrophosphatase [Vibrio vulnificus YJ016]
          Length = 226

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 70/218 (32%), Positives = 96/218 (44%), Gaps = 23/218 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
               IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK
Sbjct: 26  TMKKIVLATGNQGKVREMADLLADFGFDVVAQSEFNVSEVAETGTTFIENAIIKARHAAK 85

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+ A++DDSGL +D L G PGI+SAR+A     ++      + +E  L +      A 
Sbjct: 86  ETGLAAIADDSGLEVDFLQGAPGIYSARYAGEKASDQ------ENLEKLLTAMEGVPEAQ 139

Query: 125 RSAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R+A F  VL L   +         GK  G I+    G  GFGYDPIF     +    E+ 
Sbjct: 140 RTARFHCVLVLMRHENDPTPIVCHGKWEGRILTQAHGDNGFGYDPIFFVPEDNCASAELE 199

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
              K                 LSHR +A K        
Sbjct: 200 PVRK---------------KQLSHRGKALKQLFATLRE 222


>gi|304385229|ref|ZP_07367574.1| nucleoside-triphosphatase [Pediococcus acidilactici DSM 20284]
 gi|304328436|gb|EFL95657.1| nucleoside-triphosphatase [Pediococcus acidilactici DSM 20284]
          Length = 197

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAA 63
           + N I+IA+ N  K+ E   +    GI   S  +++     +E G +FEENA +K+ + A
Sbjct: 1   MSNQILIATKNEGKLKEFKQIFTAKGIEVLSLKDVDEDVDVQENGLTFEENARLKADSYA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G+P L+DDSGL ID L+G+PGI SAR+A  +    +           L         
Sbjct: 61  KTIGIPVLADDSGLEIDALNGRPGIFSARYAGDHNDAANNA-------KVLTELGGVSDE 113

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F + + +  PDG     +G + G I+  PRG  GFGYDP+F      +T  +MT 
Sbjct: 114 KRTATFHTTVVVRKPDGTELVANGNLRGRILSVPRGDNGFGYDPLFYVEEKQKTLAQMTR 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEKN                +SHRA A +  +    +
Sbjct: 174 EEKNQ---------------ISHRALAIQDLLTKFDK 195


>gi|255324312|ref|ZP_05365433.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Corynebacterium tuberculostearicum SK141]
 gi|255298642|gb|EET77938.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Corynebacterium tuberculostearicum SK141]
          Length = 202

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 104/217 (47%), Gaps = 25/217 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALEL----NLIIPEETGNSFEENAMIKSLTAAK 64
           I++AS+N  K+ E++ ++   GI       L        P E G +F +NA+IK+   A 
Sbjct: 3   ILVASNNPKKLAELERILADAGIEGVELRPLSAVEPYPEPVEDGRTFADNALIKARAGAA 62

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G   ++DDSGL I+ L+G PG+ SARW+  +  ++  +  +      L          
Sbjct: 63  ATGFATVADDSGLAIEELNGMPGVLSARWSGQHGNDQANNDLV------LAQMADVPDER 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+SV +L  PDG      G+  G  +  PRG  GFGYDP+FQP G  R+  EM+ E
Sbjct: 117 RAAAFVSVCALVTPDGTEHVAEGRWEGRFLREPRGDNGFGYDPLFQPEGESRSAAEMSPE 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EKN                +SHR RA    V     +
Sbjct: 177 EKNA---------------VSHRGRALSQLVPAIAEL 198


>gi|168211259|ref|ZP_02636884.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium perfringens B str. ATCC 3626]
 gi|168216783|ref|ZP_02642408.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium perfringens NCTC 8239]
 gi|182625558|ref|ZP_02953329.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium perfringens D str. JGS1721]
 gi|170710691|gb|EDT22873.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium perfringens B str. ATCC 3626]
 gi|177909246|gb|EDT71711.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium perfringens D str. JGS1721]
 gi|182381225|gb|EDT78704.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium perfringens NCTC 8239]
          Length = 204

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 69/225 (30%), Positives = 101/225 (44%), Gaps = 28/225 (12%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
               ++AS+N  K+ E+  ++    +   S  E  + I  EE G +FEEN+  K+    K
Sbjct: 1   MKKFILASNNAHKVKEIKEILKDFNLNILSLNEAGIDIDVEEDGKTFEENSFKKANEIRK 60

Query: 65  N------AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
                  +    ++DDSGL +D L+G PGI+SAR+A  +  +   +      E  L    
Sbjct: 61  YLLSKGESDFIVMADDSGLEVDYLNGAPGIYSARYAGEHGNDSKNN------EKLLEELK 114

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
                 R A+FI V+      G      GK  G+I+    G  GFGYDP+F    Y +TF
Sbjct: 115 NVKDDERKANFICVIVAVTDKGEKIVAEGKSYGVILEALSGNEGFGYDPLFFVPEYKKTF 174

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
            EMT +EKN                +SHR RA +   DN   I +
Sbjct: 175 AEMTSDEKNA---------------ISHRGRALEKLKDNLKGILK 204


>gi|260881494|ref|ZP_05404545.2| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Mitsuokella multacida DSM 20544]
 gi|260848583|gb|EEX68590.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Mitsuokella multacida DSM 20544]
          Length = 210

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 72/228 (31%), Positives = 97/228 (42%), Gaps = 29/228 (12%)

Query: 1   MRKL------IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEE 53
           M++L          IVIA+ N  K+ EM   +  L +   S  E   L    E G +F E
Sbjct: 1   MKRLENWRGEKMKKIVIATKNKGKVREMREALSHLPVEVVSLAEFGALPDAVEDGKTFAE 60

Query: 54  NAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENA 113
           NA IK+       G   L+DDSGL ++VL GKPGI SAR+A  +  +   +      E  
Sbjct: 61  NARIKASFYRGKTGCACLADDSGLEVEVLGGKPGIFSARFAGFHADDATNN------EKL 114

Query: 114 LRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNG 173
           +            A +   L+    DG      G+  G +   PRG+ GFGYDP F    
Sbjct: 115 MEELRKAGVESSPADYRCALAFVDEDGTNLLTEGRCDGTVRMVPRGENGFGYDPYFYTEA 174

Query: 174 Y-DRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           Y DRT  E++ EEK               D +SHR RA +  V     
Sbjct: 175 YPDRTMAELSLEEK---------------DAISHRGRALRAMVKELEE 207


>gi|125624018|ref|YP_001032501.1| hypothetical protein llmg_1188 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|124492826|emb|CAL97781.1| conserved hypothetical protein [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300070788|gb|ADJ60188.1| hypothetical protein LLNZ_06115 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 201

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 71/221 (32%), Positives = 102/221 (46%), Gaps = 21/221 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAA 63
           +EN ++IA+ N  K  E   L    G       +   L   EETG++FEENA +K+   A
Sbjct: 1   MENTLIIATRNPGKTKEFKKLFADFGYEIKDLSDYPELPEIEETGSTFEENARLKAEQIA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G   + DDSGL +DVL G PGI S R++  +  +               +  A  P 
Sbjct: 61  ELTGQVVIGDDSGLCVDVLGGLPGIWSHRFSAPDPTDEKNIAK----LLHELAPTAITPE 116

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            RSAHF + L  A P+          +G I   P+G+ GFGYDP+F  + + RT  E++E
Sbjct: 117 RRSAHFHTTLVAARPNHDSLVVEADWNGYIALAPKGENGFGYDPVFMVDAF-RTAAELSE 175

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +EKN                LSHR +A +  +       EK
Sbjct: 176 KEKNQ---------------LSHRGQALRKLMQELPEWLEK 201


>gi|289209633|ref|YP_003461699.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thioalkalivibrio sp. K90mix]
 gi|288945264|gb|ADC72963.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thioalkalivibrio sp. K90mix]
          Length = 203

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 103/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ +L+ PLG+      E  +   +ETG +F ENA++K+  AA++
Sbjct: 4   SRRVVLATGNPGKLREIRALLEPLGLAIEPQSEHAVPEADETGLTFVENAILKARNAAQH 63

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G+PGI+SAR+A     +   +         L++      A R
Sbjct: 64  TGLPAIADDSGLEVDALRGQPGIYSARYAGPEADDAANNA------RLLKALAGVPEAQR 117

Query: 126 SAHFISVLSL--AWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F +V+       D       G   G IV  P G  GFGYDP+F       T  E++ 
Sbjct: 118 AARFRAVVVFLEHAEDPSPLIAEGVWPGRIVEQPSGANGFGYDPLFFVPEEGCTSAELSP 177

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           E KN                LSHR +A    V     
Sbjct: 178 EAKN---------------RLSHRGQALAKLVAQLRE 199


>gi|189460216|ref|ZP_03009001.1| hypothetical protein BACCOP_00853 [Bacteroides coprocola DSM 17136]
 gi|189433077|gb|EDV02062.1| hypothetical protein BACCOP_00853 [Bacteroides coprocola DSM 17136]
          Length = 194

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 68/216 (31%), Positives = 104/216 (48%), Gaps = 25/216 (11%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAA 63
           ++  +V A++N  K+ E+ +++    +   S  +++      ET ++ E NA +K+    
Sbjct: 1   MKKKLVFATNNAHKLDEIRAILGDR-VEVLSLKDIHCEADIPETADTLEGNAALKAEYIY 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           KN G+   +DD+GL ++VL G PG++SAR+A     +   +  M+K+   L  K      
Sbjct: 60  KNYGLDCFADDTGLEVEVLGGAPGVYSARYAGGEGHDS--EANMKKLLVELEGKTNRKAQ 117

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           FR+A  +         G    F G V G I+   RG  GFGYDP+F P GY  TF EM  
Sbjct: 118 FRTAICL------IEGGTEHLFEGVVKGEIIEKKRGCSGFGYDPVFVPEGYTETFAEMGN 171

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           EEKN                +SHRARA +   D   
Sbjct: 172 EEKNK---------------ISHRARATQKLCDYLK 192


>gi|302344804|ref|YP_003813157.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella melaninogenica ATCC 25845]
 gi|302150228|gb|ADK96490.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella melaninogenica ATCC 25845]
          Length = 194

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 75/216 (34%), Positives = 110/216 (50%), Gaps = 25/216 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             IV A++N  K+ E+  ++     I++ + +  +  IPE TG + EENA  KS    ++
Sbjct: 1   MKIVFATNNKHKLEEIKDILGKDFEIVSLAEIGCHEDIPE-TGATLEENARQKSSYVVEH 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G    +DD+GL ++ L G+PG+HSAR+AE    + D +  M+K+   L          R
Sbjct: 60  YGQNCFADDTGLEVEALGGEPGVHSARYAE--GTDHDSEANMRKLLANLEG-----KDNR 112

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F +++SL         F GKV G I     G+ GFGYDPIF P GYD++F E+ EE 
Sbjct: 113 KACFRTIISLIIDGVE-HQFEGKVKGRIATEKHGKEGFGYDPIFIPEGYDKSFAELGEEI 171

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           KN                +SHRARA K   +   R+
Sbjct: 172 KNQ---------------ISHRARAVKKLAEYLGRL 192


>gi|163749431|ref|ZP_02156679.1| HAM1 protein [Shewanella benthica KT99]
 gi|161330840|gb|EDQ01767.1| HAM1 protein [Shewanella benthica KT99]
          Length = 200

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 103/217 (47%), Gaps = 24/217 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            +  V+AS N  K+ E   +    G+      + ++    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MDKFVLASGNKGKLKEFTEIFSAYGVEVLPQSQFDVEEVPETGTTFVENAIIKARHAAEI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D+LDG PGI+SAR+   N  E+D      K+ +AL++        R
Sbjct: 61  TGLAAIADDSGLEVDLLDGAPGIYSARYGGENADEKD---NYIKLLDALKANL----TGR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  +L       D           G I +   G  G GYDPIF PN ++ +  E+  
Sbjct: 114 TARFQCILVYMRHAKDPTPIITQASWEGKIAFEASGDKGHGYDPIFIPNEHNCSAAELDS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEKN                LSHR +A K  +D    
Sbjct: 174 EEKN---------------RLSHRGKAMKLLIDAMKN 195


>gi|304410076|ref|ZP_07391695.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella baltica OS183]
 gi|307302212|ref|ZP_07581970.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella baltica BA175]
 gi|304351485|gb|EFM15884.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella baltica OS183]
 gi|306914250|gb|EFN44671.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella baltica BA175]
          Length = 205

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 72/215 (33%), Positives = 99/215 (46%), Gaps = 24/215 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  K+ E D ++   G+      + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MQQIVLASGNKGKLAEFDQMLASYGVTVLPQSQFNVSEVAETGTTFVENAIIKARHAAEI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D+L G PGI+SAR+A  N  ++D  +        L       PA R
Sbjct: 61  TGLAAIADDSGLEVDLLQGAPGIYSARYAGENAKDQDNVLK-------LLETLKDQPAPR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL       D           G I +  RG  G GYDPIF P  Y  +  E++ 
Sbjct: 114 SARFQCVLVYMRHAKDPTPIICQAAWEGQIDFNQRGDNGHGYDPIFIPENYQCSAAELSS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            EKN                LSHR +A    +   
Sbjct: 174 NEKN---------------TLSHRGKALVQLIAAM 193


>gi|229846346|ref|ZP_04466454.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae 7P49H1]
 gi|229810439|gb|EEP46157.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae 7P49H1]
          Length = 202

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 65/219 (29%), Positives = 106/219 (48%), Gaps = 19/219 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A D   
Sbjct: 61  KSGLPAIADDSGLVVSALNGTPGLYSARY----AGEEGNDAKNREKLLAELAHVAQDKRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETA 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EK                 +SHRA+A   F     ++++
Sbjct: 177 EKKK---------------ISHRAKALNIFKKINYKVNK 200


>gi|87121163|ref|ZP_01077054.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Marinomonas sp. MED121]
 gi|86163655|gb|EAQ64929.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Marinomonas sp. MED121]
          Length = 200

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 68/220 (30%), Positives = 107/220 (48%), Gaps = 23/220 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +V+AS+N  KI+E + ++  LG       E N+   EE G SF ENA++K+  A  
Sbjct: 1   MSKTLVLASNNTGKINEFNEMLADLGFEVKPQGEFNVEEAEENGLSFIENAVLKARNACA 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PA++DDSG+ +D L+G PGI+SAR+A  +   +  +  +      L          
Sbjct: 61  QTGLPAIADDSGIEVDYLNGAPGIYSARFAGEHGNSQANNALL------LEKLEGVPEEE 114

Query: 125 RSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R+A F  VL+      D     F G   G I+   +G+ GFGYDP+F     D +   +T
Sbjct: 115 RTARFHCVLAYMKHKDDPTPLVFHGVWEGSILTEIQGKHGFGYDPVFYVPNRDCSAAMLT 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           ++EKN                +SHRA A +  +    ++D
Sbjct: 175 KDEKN---------------RISHRAIALQQLLAAFEQVD 199


>gi|169347156|ref|ZP_02866098.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium perfringens C str. JGS1495]
 gi|169296839|gb|EDS78968.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium perfringens C str. JGS1495]
          Length = 204

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 69/225 (30%), Positives = 101/225 (44%), Gaps = 28/225 (12%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
               ++AS+N  K+ E+  ++    +   S  E  + I  EE G +FEEN+  K+    K
Sbjct: 1   MKKFILASNNAHKVKEIKEILKDFNLNILSLNEAGIDIDVEEDGKTFEENSFKKANEIRK 60

Query: 65  N------AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
                  +    ++DDSGL +D L+G PGI+SAR+A  +  +   +      E  L    
Sbjct: 61  YLLSKGESNFIVMADDSGLEVDYLNGAPGIYSARYAGEHGNDSKNN------EKLLEELK 114

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
                 R A+FI V+      G      GK  G+I+    G  GFGYDP+F    Y +TF
Sbjct: 115 NVKDDERKANFICVIVAVTDKGEKIVAEGKSYGVILEALSGNEGFGYDPLFFVPEYKKTF 174

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
            EMT +EKN                +SHR RA +   DN   I +
Sbjct: 175 AEMTSDEKNA---------------ISHRGRALEKLKDNLKGILK 204


>gi|269797500|ref|YP_003311400.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Veillonella parvula DSM 2008]
 gi|269094129|gb|ACZ24120.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Veillonella parvula DSM 2008]
          Length = 191

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 104/214 (48%), Gaps = 24/214 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALE-LNLIIPEETGNSFEENAMIKSLTAAK 64
              IV+A+ N  KI E       L I      + +++  PEETG +F ENA++K+   AK
Sbjct: 1   MEQIVLATGNKGKIREFSEAFSHLSIDCVPVKDVISVEEPEETGTTFMENALLKARYYAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL +D+LDG PG++SAR+A  +  +   +  + +               
Sbjct: 61  ATNRPCLADDSGLTVDILDGAPGVYSARYAGHHGDDNANNEKLIREL--------QGKRD 112

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+ H++  L+L +PDG      G   G++   P+G+ GFGYDP F    +++T  E++ +
Sbjct: 113 RTGHYVCALALVYPDGREVTAEGYCDGLVQDEPKGENGFGYDPYFYVPEFEKTMAELSID 172

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            K               + +SHR RA +  +   
Sbjct: 173 VK---------------ETISHRGRALRELISKL 191


>gi|161486599|ref|NP_935672.2| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           vulnificus YJ016]
 gi|161501824|ref|NP_760419.2| dITP/XTP pyrophosphatase [Vibrio vulnificus CMCP6]
 gi|34098534|sp|Q8DCB9|NTPA_VIBVU RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|62900251|sp|Q7MHJ0|NTPA_VIBVY RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|319999219|gb|AAO09946.2| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Vibrio
           vulnificus CMCP6]
          Length = 200

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MKKIVLATGNQGKVREMADLLADFGFDVVAQSEFNVSEVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D L G PGI+SAR+A     ++      + +E  L +      A R
Sbjct: 61  TGLAAIADDSGLEVDFLQGAPGIYSARYAGEKASDQ------ENLEKLLTAMEGVPEAQR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G  GFGYDPIF     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPIVCHGKWEGRILTQAHGDNGFGYDPIFFVPEDNCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 VRK---------------KQLSHRGKALKQLFATLRE 196


>gi|113969532|ref|YP_733325.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella sp. MR-4]
 gi|113884216|gb|ABI38268.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella sp. MR-4]
          Length = 205

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 101/217 (46%), Gaps = 24/217 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  K+ E D ++   G+      + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MQQIVLASGNKGKLAEFDQMLAAYGVKVLPQSQFNVSEVAETGTTFVENAIIKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D+L G PGI+SAR+A  N  ++D  +        L      +PA R
Sbjct: 61  TGLAAIADDSGLEVDLLQGAPGIYSARYAGENAKDQDNVLK-------LLDTLKDNPAPR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL       D           G I +  RG  G GYDPIF P  +  +  +++ 
Sbjct: 114 TARFQCVLVYMRHAKDPTPIICQASWEGQIDFVQRGDNGHGYDPIFIPEHHYCSAAQLSS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +EKN                LSHR +A    +     
Sbjct: 174 DEKNA---------------LSHRGKALVQLIAAMQE 195


>gi|145640184|ref|ZP_01795768.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae R3021]
 gi|319775870|ref|YP_004138358.1| xanthosine triphosphate pyrophosphatase [Haemophilus influenzae
           F3047]
 gi|329123715|ref|ZP_08252275.1| non-canonical purine NTP pyrophosphatase RdgB [Haemophilus
           aegyptius ATCC 11116]
 gi|145274770|gb|EDK14632.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae 22.4-21]
 gi|317450461|emb|CBY86677.1| predicted xanthosine triphosphate pyrophosphatase [Haemophilus
           influenzae F3047]
 gi|327469914|gb|EGF15379.1| non-canonical purine NTP pyrophosphatase RdgB [Haemophilus
           aegyptius ATCC 11116]
          Length = 195

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 101/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A D   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHVAQDQRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETV 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A        
Sbjct: 177 EKKK---------------ISHRAKALSVLKSKL 195


>gi|110800365|ref|YP_696925.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Clostridium perfringens ATCC 13124]
 gi|110675012|gb|ABG83999.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium perfringens ATCC 13124]
          Length = 204

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 69/225 (30%), Positives = 101/225 (44%), Gaps = 28/225 (12%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
               ++AS+N  K+ E+  ++    +   S  E  + I  EE G +FEEN+  K+    K
Sbjct: 1   MKKFILASNNAHKVKEIKEILKDFNLNILSLNEAGIDIDVEEDGKTFEENSFKKANEIRK 60

Query: 65  N------AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
                  +    ++DDSGL +D L+G PGI+SAR+A  +  +   +      E  L    
Sbjct: 61  YLLSKGESDFIVMADDSGLEVDYLNGAPGIYSARYAGEHGNDSKNN------EKLLEELK 114

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
                 R A+FI V+      G      GK  G+I+    G  GFGYDP+F    Y +TF
Sbjct: 115 NVKEDERKANFICVIVAVTDKGEKIVAEGKSYGVILEALSGNEGFGYDPLFFVPEYKKTF 174

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
            EMT +EKN                +SHR RA +   DN   I +
Sbjct: 175 AEMTSDEKNA---------------ISHRGRALEKLKDNLKGILK 204


>gi|319896594|ref|YP_004134787.1| xanthosine triphosphate pyrophosphatase [Haemophilus influenzae
           F3031]
 gi|309972581|gb|ADO95782.1| dITP/XTP pyrophosphatase [Haemophilus influenzae R2846]
 gi|317432096|emb|CBY80447.1| predicted xanthosine triphosphate pyrophosphatase [Haemophilus
           influenzae F3031]
          Length = 195

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 101/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A D   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHIAQDQRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETV 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A        
Sbjct: 177 EKKK---------------ISHRAKALSVLKSKL 195


>gi|295094142|emb|CBK83233.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Coprococcus sp. ART55/1]
          Length = 200

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 105/219 (47%), Gaps = 22/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
            + ++ A+ N  K+ E+  ++  LG    S  E  + I   E G +FEENA+IK+   +K
Sbjct: 1   MDKLIFATGNEGKMKEVRMILADLGFEIQSMKEAGIDIDIVEDGQTFEENALIKARAISK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G   L+DDSGL +D +D  PGI+SAR+   +T  R  +  +      +          
Sbjct: 61  ESGCLVLADDSGLEVDYMDKAPGIYSARFLGEDTSYRIKNQYI------IDKLAGVPDPE 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+  ++  +PDG      G + GII +  RG+ GFGYDPIF   G  +T  E+  E
Sbjct: 115 RTARFVCAIAAVFPDGSEYTTRGTIEGIIGYEERGENGFGYDPIFFLPGKGKTTAELDPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EKN                +SHR  A +   D   +  E
Sbjct: 175 EKNE---------------ISHRGNALRLMKDVIRKHRE 198


>gi|288925915|ref|ZP_06419845.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella buccae D17]
 gi|288337339|gb|EFC75695.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella buccae D17]
          Length = 204

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 95/218 (43%), Gaps = 24/218 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAKN 65
             IV A++N  K+ E+  ++        S  E+       ETG + EENA+ K+     +
Sbjct: 1   MKIVFATNNAHKLKEIREILGN-SFEVVSLAEIGCHEDIPETGKTLEENALQKAQYVYDH 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +   +DD+GL ++ LDG PG+HSAR+AE    + + +  M K+   L  K      FR
Sbjct: 60  YHISCFADDTGLEVEALDGAPGVHSARYAE--GTDHNSEANMAKLLRQLDGKDNRKARFR 117

Query: 126 SAHF-----ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           +                    +  F G V G I     G  GFGYDP+F P GYD++F E
Sbjct: 118 TVIALIEKKDVCPCGCTSIPQIHRFEGIVEGRIATERHGSEGFGYDPLFVPEGYDKSFAE 177

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           + E  KN                +SHRARA     +  
Sbjct: 178 LGEHVKN---------------TISHRARAVAKLAEYL 200


>gi|157960950|ref|YP_001500984.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella pealeana ATCC 700345]
 gi|157845950|gb|ABV86449.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella pealeana ATCC 700345]
          Length = 199

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 100/217 (46%), Gaps = 25/217 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            N IV+AS N  K+ E   L+   G+   +  + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MNQIVLASGNKGKLKEFSELMADYGVEILAQSQFNVSEVAETGTTFVENAIIKARHAAEI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  A++DDSGL +D L G PGI+SAR+A     +        K+ NAL  +       R
Sbjct: 61  TGHAAIADDSGLEVDFLQGAPGIYSARYAGEGAKDE---QNYTKLLNALEDQAE-----R 112

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL       D           G I +  +G  G GYDPIF P  ++    E++ 
Sbjct: 113 SARFQCVLVYMRHAKDPTPIICQASWEGTIGFAAQGVNGHGYDPIFIPAEHECAAAELSS 172

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +EKN                LSHR +A    ++   +
Sbjct: 173 DEKNK---------------LSHRGKALVLLIEAMKQ 194


>gi|282858944|ref|ZP_06268084.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella bivia JCVIHMP010]
 gi|282588326|gb|EFB93491.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella bivia JCVIHMP010]
          Length = 192

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 72/216 (33%), Positives = 104/216 (48%), Gaps = 25/216 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAKN 65
             IV A++N  K+ E+  ++   G    S  ++N      ETG + EENA IKS     N
Sbjct: 1   MKIVFATNNTHKLSEIKEILGE-GFEVVSLADINCHEDIPETGTTLEENARIKSNYVVTN 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +   +DD+GL ++ L G+PG++SAR+ E  T + D +  M K+   L      D   R
Sbjct: 60  YHLDCFADDTGLEVEALGGEPGVYSARYDE--TTDHDSEANMCKLLRKL-----GDNTNR 112

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F +V+SL         F G V G I +   G  GFGYDPIF P GYD++F E+ E  
Sbjct: 113 KACFRTVISLMINGKE-HQFEGIVEGNIAFEKSGSNGFGYDPIFIPKGYDKSFAELGEGI 171

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           KN                +SHRA+A +       ++
Sbjct: 172 KNQ---------------ISHRAKAVQKLAAYLKKL 192


>gi|92115422|ref|YP_575350.1| Ham1-like protein [Chromohalobacter salexigens DSM 3043]
 gi|91798512|gb|ABE60651.1| Ham1-like protein [Chromohalobacter salexigens DSM 3043]
          Length = 201

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 68/214 (31%), Positives = 100/214 (46%), Gaps = 23/214 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
           + +V+AS N  K+ E  SL+ PLG+      +  +   EETG +F ENA++K+  A++ +
Sbjct: 5   DTLVLASGNTGKLREFQSLLAPLGLEVRPQRDFAVTEVEETGLTFVENALLKAREASRVS 64

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +D L G PGI SAR+A   + +   +         L +        R 
Sbjct: 65  GLPALADDSGLEVDALQGAPGIRSARFAGEPSDDAANNR------KLLEALKDVPEGQRG 118

Query: 127 AHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           A F  VL       D           G ++  PRG+ GFGYD +F       T  E++ E
Sbjct: 119 ARFWCVLVYLRHAEDPVPRIVQCAWEGEVLAYPRGEGGFGYDSLFWVPERAMTAAELSAE 178

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           +KN                LSHR RA +  +   
Sbjct: 179 DKN---------------RLSHRGRAMQALLAQL 197


>gi|217972513|ref|YP_002357264.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella baltica OS223]
 gi|217497648|gb|ACK45841.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella baltica OS223]
          Length = 205

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/215 (33%), Positives = 99/215 (46%), Gaps = 24/215 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  K+ E D ++   G+      + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MQQIVLASGNKGKLAEFDQMLASYGVTVLPQSQFNVSEVAETGTTFVENAIIKARHAAEI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D+L G PGI+SAR+A  N  ++D  +        L       PA R
Sbjct: 61  TGLAAIADDSGLEVDLLQGAPGIYSARYAGENAKDQDNVLK-------LLETLKDQPAPR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL       D           G I +  RG  G GYDPIF P  Y  +  +++ 
Sbjct: 114 SARFQCVLVYMRHAKDPTPIICQAAWEGQIDFNQRGDNGHGYDPIFIPENYQCSAAQLSS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            EKN                LSHR +A    +   
Sbjct: 174 NEKNA---------------LSHRGKALVQLIAAM 193


>gi|160876294|ref|YP_001555610.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Shewanella baltica OS195]
 gi|160861816|gb|ABX50350.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella baltica OS195]
 gi|315268483|gb|ADT95336.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shewanella baltica OS678]
          Length = 205

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 72/215 (33%), Positives = 98/215 (45%), Gaps = 24/215 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  K+ E D ++   G+      + N+    ETG +F ENA+IK+  AA+ 
Sbjct: 1   MQQIVLASGNKGKLAEFDQMLASYGVTVLPQSQFNVSEVAETGTTFVENAIIKARHAAEI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D+L G PGI+SAR+A  N  ++D  +        L       PA R
Sbjct: 61  TGLAAIADDSGLEVDLLQGAPGIYSARYAGENAKDQDNVLK-------LLETLKDQPAPR 113

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL       D           G I +  RG  G GYDPIF P  Y  +  E++ 
Sbjct: 114 SARFQCVLVYMRHAKDPTPIICQAAWEGQIDFNQRGDNGHGYDPIFIPENYQCSAAELSS 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            EKN                LSHR +A        
Sbjct: 174 NEKNA---------------LSHRGKALVQLFAAM 193


>gi|167854599|ref|ZP_02477380.1| HAM1-like protein [Haemophilus parasuis 29755]
 gi|167854354|gb|EDS25587.1| HAM1-like protein [Haemophilus parasuis 29755]
          Length = 202

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 65/216 (30%), Positives = 100/216 (46%), Gaps = 23/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
           +  IV+A+ N  K+ EM  ++   G    +  E ++  PEETG +F ENA+IK+  A++ 
Sbjct: 8   KTKIVLATGNQGKVKEMADVLAEFGFDVIAQSEFDIQSPEETGLTFVENALIKARYASQM 67

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL ++ L G+PG++SAR+A     ++            L          R
Sbjct: 68  TGLPAIADDSGLAVEALGGEPGLYSARYAGEEGNDQANRQ------KLLAEMANVADEDR 121

Query: 126 SAHF--ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F    V+     D   +   G+  G I+   RG  GFGYDP+F     + TF E+  
Sbjct: 122 TAKFVSCIVMLQHPTDPTPKIAIGECYGQILREERGSNGFGYDPLFFYPPKNCTFAELET 181

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            EK                 +SHRA A +       
Sbjct: 182 VEKKK---------------ISHRAIALQSLKQQLK 202


>gi|168205081|ref|ZP_02631086.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium perfringens E str. JGS1987]
 gi|170663246|gb|EDT15929.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium perfringens E str. JGS1987]
          Length = 204

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 69/225 (30%), Positives = 101/225 (44%), Gaps = 28/225 (12%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
               ++AS+N  K+ E+  ++    +   S  E  + I  EE G +FEEN+  K+    K
Sbjct: 1   MKKFILASNNAHKVKEIKEILKDFNLNILSLNEAGIDIDVEEDGKTFEENSFKKANEIRK 60

Query: 65  N------AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
                  +    ++DDSGL +D L+G PGI+SAR+A  +  +   +      E  L    
Sbjct: 61  FLLSKGESDFIVMADDSGLEVDYLNGAPGIYSARYAGEHGNDSKNN------EKLLEELK 114

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
                 R A+FI V+      G      GK  G+I+    G  GFGYDP+F    Y +TF
Sbjct: 115 NVKDDERKANFICVIVAVTDKGEKIVAEGKSYGVILEALSGNEGFGYDPLFFVPEYKKTF 174

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
            EMT +EKN                +SHR RA +   DN   I +
Sbjct: 175 AEMTSDEKNA---------------ISHRGRALEKLKDNLKGILK 204


>gi|332977271|gb|EGK14062.1| non-canonical purine NTP pyrophosphatase RdgB [Psychrobacter sp.
           1501(2011)]
          Length = 228

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 97/220 (44%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           E   V+AS+N  K+ E   L     LGI      +LN+    E G SF ENA+IK+  A+
Sbjct: 21  EKRWVLASNNKGKLAEFQRLFDQAHLGIEIIPQGQLNIEDAIEDGLSFVENAIIKARHAS 80

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           + +G+PA++DDSGL +  L   PGI+SAR+A  +  +   +  +       R        
Sbjct: 81  RISGLPAVADDSGLCVPTLGNAPGIYSARYAGEHGNDAKNNAKLIADLQPYRGTDIDSAN 140

Query: 124 FRSAH-----FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
             SA       +  L     D       G   G I+  P+G+ GFGYDP+F    Y +T 
Sbjct: 141 TESAIKGYFICVLALVRHADDPLPIIAQGLWQGEILAEPQGENGFGYDPLFWVPEYQQTA 200

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
             MT E+KN                +SHR  A +  +   
Sbjct: 201 AAMTPEQKNK---------------ISHRGLALQSLLKQL 225


>gi|69246345|ref|ZP_00603901.1| Ribonuclease PH:Ham1-like protein [Enterococcus faecium DO]
 gi|68195298|gb|EAN09749.1| Ribonuclease PH:Ham1-like protein [Enterococcus faecium DO]
          Length = 451

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 98/219 (44%), Gaps = 22/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              I+IA+ N  K  E  ++    G    + L+   L   EETG++FEENA +K+ T A+
Sbjct: 251 TKTIIIATRNPGKAEEFRNMFKEAGYHVKTLLDYPELPDVEETGSTFEENARLKAETIAQ 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL +D L G PGI+SAR+A     +   +         L          
Sbjct: 311 LLDQPVLADDSGLKVDALGGMPGIYSARFAGEQKSDAGNNA------KLLYELTDVPDER 364

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L  A P         +  G +   P G+ GFGYDP+F P G  +T  E++ E
Sbjct: 365 RTAQFHCTLVFAAPKKDSLVVEAEWPGRVARIPSGENGFGYDPLFIPEGKKQTAAELSSE 424

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EKN                +SHRA+A K       +  E
Sbjct: 425 EKNK---------------ISHRAQAMKKLSAEWKQWLE 448


>gi|256821439|ref|YP_003145402.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Kangiella koreensis DSM 16069]
 gi|256794978|gb|ACV25634.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Kangiella koreensis DSM 16069]
          Length = 210

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 65/220 (29%), Positives = 96/220 (43%), Gaps = 18/220 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  K+ E+  L+           ELN+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MQKIVLASGNAKKVKELSELLASFDYQIIPQTELNVSEVPETGTTFVENAIIKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSG+ +D L G PGI+SAR+A  +  E   +   Q   + L  K    P   
Sbjct: 61  TGLPAIADDSGIEVDYLKGMPGIYSARFAALDDSEHKGNADDQANNDLLLDKLNGVPTAE 120

Query: 126 ---SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
                  + V      D       G   G I+    G  GFGYDP+F    +     E++
Sbjct: 121 RSARYQCLLVFMEHAEDPTPIICQGSWEGRILESETGNGGFGYDPLFWAPEHQCAAAELS 180

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
            E+K                 +SHR +A +  ++    + 
Sbjct: 181 PEQKAA---------------ISHRGKALRSLMEQLSALQ 205


>gi|225019241|ref|ZP_03708433.1| hypothetical protein CLOSTMETH_03194 [Clostridium methylpentosum
           DSM 5476]
 gi|224947872|gb|EEG29081.1| hypothetical protein CLOSTMETH_03194 [Clostridium methylpentosum
           DSM 5476]
          Length = 205

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 102/218 (46%), Gaps = 24/218 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAKN 65
             +++A++N  K+ E   ++ PLG    S  E    +  EETG +F ENA +K+    + 
Sbjct: 1   MKLILATNNPSKLEEFRRILSPLGFEVLSQSEAGFDMQVEETGKTFAENAFLKADAIYRA 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+P ++DDSGLV+  L G PG++SAR+A  +  +   +         L          R
Sbjct: 61  TGLPTVADDSGLVVKALKGAPGVYSARYAGEHATDEQNNQ------KLLNELIYVGVEKR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F+  +    P+G      G   G I +  RG+ GFGYDP+F  NG  ++F EMT+ E
Sbjct: 115 QAKFVCSICYIDPNGEAHYTDGVCEGRIGFAERGENGFGYDPLFYANG--KSFAEMTDAE 172

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           K               D  SHR RA +        ++E
Sbjct: 173 K---------------DKYSHRGRALRQLAAIVKELNE 195


>gi|197284234|ref|YP_002150106.1| deoxyribonucleotide triphosphate pyrophosphatase [Proteus mirabilis
           HI4320]
 gi|227357863|ref|ZP_03842211.1| nucleoside-triphosphatase [Proteus mirabilis ATCC 29906]
 gi|194681721|emb|CAR40869.1| putative hydrolase [Proteus mirabilis HI4320]
 gi|227161973|gb|EEI46991.1| nucleoside-triphosphatase [Proteus mirabilis ATCC 29906]
          Length = 197

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 104/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA+IK+  AAK 
Sbjct: 1   MQKVVLATGNPGKVTELASLLADFGLDIVAQTELGVGSVEETGLTFVENALIKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSG+ +D L G PGI+SAR+A     ++      Q ++  L +        R
Sbjct: 61  TGLPAIADDSGISVDALGGAPGIYSARYAGIEATDQ------QNVDKLLEAMKDVPAEKR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL     +       F G   G++    +G  GFGYDPIF     + T  ++T 
Sbjct: 115 QAQFNCVLVYLRHENDPTPLIFHGIWQGVLTQEMQGDGGFGYDPIFFIPELNCTAAQLTR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           E+KN                 SHR +A K  +D    
Sbjct: 175 EQKNQ---------------YSHRGKALKLMLDALKN 196


>gi|260767470|ref|ZP_05876407.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           furnissii CIP 102972]
 gi|260617582|gb|EEX42764.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           furnissii CIP 102972]
          Length = 199

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 68/217 (31%), Positives = 95/217 (43%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MKKIVLATGNQGKVREMADLLADFGFDVVAQSEFNVSEVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D LDG PG++SAR+A  +  ++            L +      A R
Sbjct: 61  TGLPAIADDSGLEVDALDGAPGVYSARYAGEHATDQQNLT------KLLDAMKDVPEAQR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         G   G I+    G  GFGYDPIF     +    ++  
Sbjct: 115 TARFHCVLVLMRHENDPTPLVCHGTWEGRILTEAHGSNGFGYDPIFFVPEDNCASAQLEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGQALKKLFQAIEE 196


>gi|255994312|ref|ZP_05427447.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Eubacterium saphenum ATCC 49989]
 gi|255993025|gb|EEU03114.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Eubacterium saphenum ATCC 49989]
          Length = 198

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 107/217 (49%), Gaps = 23/217 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII--PEETGNSFEENAMIKSLTAAK 64
             +V+AS N  KI E+  ++ PLGI+ T+  E        EETG++F EN+ IK+     
Sbjct: 1   MEVVLASGNAHKIKEIKEILSPLGIVITTLSENGYPDLDIEETGSTFSENSKIKAEAVHD 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G  AL+DDSGL +D LDG PG+ SAR+A  +  +   +         L      + A 
Sbjct: 61  LLGKAALADDSGLCVDALDGAPGVFSARYAGVDKDDDRNNK------KLLAELSKKEGAS 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R AH+  VL+L   +G     SGK  G I +   G  GFGYDP+F P+G+D+TF E+   
Sbjct: 115 RKAHYECVLTLITDEGSEVVVSGKCHGTIGYSEVGDNGFGYDPLFIPDGFDKTFAELEPS 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           +KN                +SHR RA +        +
Sbjct: 175 QKNA---------------ISHRRRALEALKHELENL 196


>gi|327395108|dbj|BAK12530.1| HAM1 protein YggV [Pantoea ananatis AJ13355]
          Length = 204

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 103/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+  L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 8   MQKVVLATGNPGKVRELADLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQV 67

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL ++ L G PGI+SAR+A  +  ++      Q +E  L++        R
Sbjct: 68  TGLPAIADDSGLAVNALGGAPGIYSARYAGEDASDQ------QNLEKLLQALENTPDGQR 121

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G   G I     G+ GFGYDP+F      +T  E+T+
Sbjct: 122 QAQFHCVLVYLRHAADPTPLVFHGAWEGEITQTASGEGGFGYDPVFWVPALGKTAAELTK 181

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            EK                 +SHR +A    ++    
Sbjct: 182 AEKGK---------------VSHRGKALTLLLEAMRN 203


>gi|308174533|ref|YP_003921238.1| inosine/xanthosine triphosphate pyrophosphatase subunit A [Bacillus
           amyloliquefaciens DSM 7]
 gi|307607397|emb|CBI43768.1| inosine/xanthosine triphosphate pyrophosphatase (subunit A)
           [Bacillus amyloliquefaciens DSM 7]
 gi|328554455|gb|AEB24947.1| nucleoside-triphosphatase [Bacillus amyloliquefaciens TA208]
 gi|328912858|gb|AEB64454.1| inosine/xanthosine triphosphate pyrophosphatase (subunit A)
           [Bacillus amyloliquefaciens LL3]
          Length = 195

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 68/214 (31%), Positives = 101/214 (47%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAK 64
               +IA+HN  K+ E   ++ P G   +S  E+      EETG++FEENA++K+   AK
Sbjct: 1   MKEAIIATHNPGKVKEFKEILEPKGYSVSSLAEIGFTEEIEETGHTFEENAILKAEAVAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL +D L G+PG++SAR+A     ++        ++  L      +   
Sbjct: 61  AVNKMVIADDSGLSVDNLGGRPGVYSARYAGEAKDDK------ANMDKVLSELKGIEKEQ 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L+++ P    +   G V G I   P G  GFGYDPIF     D+T  ++T  
Sbjct: 115 RTARFRCALAVSMPGQETKTVEGHVEGYIAEEPEGDNGFGYDPIFIVKDKDKTMAQLTSA 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                +SHRA A K      
Sbjct: 175 EKNK---------------ISHRAEALKKLSKLL 193


>gi|255693147|ref|ZP_05416822.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides finegoldii DSM 17565]
 gi|260621102|gb|EEX43973.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides finegoldii DSM 17565]
          Length = 194

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/219 (30%), Positives = 108/219 (49%), Gaps = 27/219 (12%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLT 61
           +++  +V A++N  K+ E+ +++    I   S  +++    IPE T ++ E NA++KS  
Sbjct: 1   MMKRKLVFATNNAHKLEEVAAILGDQ-IELLSLNDIDCHTDIPE-TADTLEGNALLKSSF 58

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
              N G+   +DD+GL ++ LDG PG++SAR+A     +   +M     E          
Sbjct: 59  IYNNYGLNCFADDTGLEVEALDGAPGVYSARYAGGEGHDAQANMLKLLHE-------LEG 111

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F + +SL     +   F G + G I+   RG+ GFGYDP+FQP GYD+TF E+
Sbjct: 112 KENRKAQFRTAISLILDGKNYL-FEGIIKGEIIKEKRGESGFGYDPVFQPEGYDKTFAEL 170

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             + KN                +SHRA A +   +   R
Sbjct: 171 GNDIKNK---------------ISHRALAIQKLCEFLQR 194


>gi|240122899|ref|ZP_04735855.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae PID332]
 gi|268681520|ref|ZP_06148382.1| nucleoside-triphosphatase [Neisseria gonorrhoeae PID332]
 gi|268621804|gb|EEZ54204.1| nucleoside-triphosphatase [Neisseria gonorrhoeae PID332]
          Length = 199

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 84/211 (39%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P GI         +    E   +F ENA+ K+  AA ++G
Sbjct: 7   KIVLASGNAGKLKEFGNLFKPYGITVLPQSAFGIPECPEPYPTFVENALAKARHAAGHSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A SN                            S 
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGSN-----PKSDTANNLKLAAELAGKADKSCSY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P GQ GFGYDP F    + +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGIWHGQWHHTPLGQNGFGYDPYFYLPEHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALADLIRKL 197


>gi|163856585|ref|YP_001630883.1| HAM1-type NTP pyrophosphatase [Bordetella petrii DSM 12804]
 gi|163260313|emb|CAP42615.1| HAM1-type NTP pyrophosphatase [Bordetella petrii]
          Length = 209

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 75/213 (35%), Positives = 100/213 (46%), Gaps = 20/213 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V+AS+N  K+ E  +L  PLGI      EL +   EE   +F ENA+ K+  A++  G
Sbjct: 12  RVVLASNNPGKLREFSALFAPLGIELVPQGELGVPEAEEPHVTFVENALAKARHASRLTG 71

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSGL +  L G PG++SAR+A+         +      NAL        A R A
Sbjct: 72  LPALADDSGLCVAALAGAPGVYSARYAQL---ADPAAVRSDAANNALLVSKLAGVADRRA 128

Query: 128 HFIS--VLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            +++  VL  A  D       G   G IV  PRG  GFGYDP F      RT  E+   E
Sbjct: 129 WYVALLVLVRAHDDPRPLIGEGLWHGEIVETPRGGNGFGYDPHFLLPELGRTAAELDPAE 188

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN                +SHRARA    +D  
Sbjct: 189 KN---------------RVSHRARALAQLLDKL 206


>gi|288933576|ref|YP_003437635.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Klebsiella variicola At-22]
 gi|288888305|gb|ADC56623.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Klebsiella variicola At-22]
          Length = 197

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNAGKVRELASLLEDFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++  +  ++      Q +E  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYSGVDATDQ------QNLEKLLDALKDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   GII     G  GFGYDPIF  +   +T  E++ 
Sbjct: 115 QAQFHCVLVYLRHAEDPTPLVCHGSWPGIITRQAAGTGGFGYDPIFFVSSEGKTAAELSR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EEK+                +SHR +A K  ++    
Sbjct: 175 EEKSA---------------ISHRGQALKLLLEALRN 196


>gi|15603531|ref|NP_246605.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Pasteurella multocida subsp. multocida str. Pm70]
 gi|22653773|sp|Q9CKF5|NTPA_PASMU RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|12722072|gb|AAK03750.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 202

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 101/214 (47%), Gaps = 17/214 (7%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N+ K+ EM  ++   G    +  ELN+  PEETG +F ENA++K+  A+K
Sbjct: 1   MKQKIVLATGNLGKVKEMSDVLADFGFEVIAQTELNIESPEETGLTFVENALLKARYASK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L G PG++SAR+A  +  +   D   +     +    A     
Sbjct: 61  MSGLPAIADDSGLVVPALGGAPGLYSARYAGVDGPDA--DAKNRAKLLHVLHHIAPTHRQ 118

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V+     D       G+  G I +  +G+ GFGYD +F     + TF E+   
Sbjct: 119 AKFVSCIVMLQHEHDPSPIIAEGECYGEIGFAEKGENGFGYDSLFFSPEVNCTFAELATS 178

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A        
Sbjct: 179 EKKK---------------ISHRAKALSVLQTKL 197


>gi|288801798|ref|ZP_06407240.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella melaninogenica D18]
 gi|288335840|gb|EFC74273.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella melaninogenica D18]
          Length = 194

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 74/216 (34%), Positives = 110/216 (50%), Gaps = 25/216 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLI-MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             IV A++N  K+ E+  ++     I++ + +  +  IPE TG + EENA  KS    ++
Sbjct: 1   MKIVFATNNKHKLEEIKDILGKDFEIVSLAEIGCHEDIPE-TGATLEENARQKSSYVVEH 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G    +DD+GL ++ L G+PG+HSAR+A     + D +  M+K+   L        A R
Sbjct: 60  YGQNCFADDTGLEVEALGGEPGVHSARYA--KGTDHDSEANMRKLLANLEG-----KANR 112

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A+F +++SL         F GKV G I     G  GFGYDPIF P GYD++F E+ EE 
Sbjct: 113 KAYFRTIISLIIDGVE-HQFEGKVEGRIATENHGTEGFGYDPIFIPEGYDKSFAELGEEI 171

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           KN                +SHRARA K   +   ++
Sbjct: 172 KNQ---------------ISHRARAVKKLAEYLGKL 192


>gi|254508598|ref|ZP_05120714.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Vibrio
           parahaemolyticus 16]
 gi|219548449|gb|EED25458.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Vibrio
           parahaemolyticus 16]
          Length = 199

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFNVVAQSEFNVSEVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  A++DDSGL +D L G PGI+SAR+A     ++      Q +E  L +      A R
Sbjct: 61  TGFAAIADDSGLEVDALKGAPGIYSARYAGVGATDQ------QNLEKLLEAMKDVPEAER 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G+ GFGYDPIF     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGKALKTLFATLSE 196


>gi|300723970|ref|YP_003713284.1| hypothetical protein XNC1_3112 [Xenorhabdus nematophila ATCC 19061]
 gi|297630501|emb|CBJ91166.1| putative protein controls HAP (6-N-hydroxylaminopurine) mutagenesis
           (Ham1) [Xenorhabdus nematophila ATCC 19061]
          Length = 199

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 105/219 (47%), Gaps = 23/219 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           + +  +V+A+ N  K+ E+  L+   G+   +  EL +   +E G +F ENA+IK+  AA
Sbjct: 1   MAKQKVVLATGNAGKVRELADLLADFGLNIVAQTELGVDSADEAGLTFIENAIIKARHAA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
              G+PA++DDSGL +D L G PGI+SAR+A S   ++        +E  L +       
Sbjct: 61  AVTGLPAIADDSGLSVDALGGAPGIYSARYAGSEASDQ------DNLEKLLEAMRDVPDE 114

Query: 124 FRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            R A F  VL       D     F G+ SG+I   P G+ GFGYDPIF       T  ++
Sbjct: 115 QRQAQFNCVLVFLRHAEDPTPLVFHGRWSGMITHEPAGEGGFGYDPIFYAPELGCTAAQL 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           + E+KN                +SHR +A    ++    
Sbjct: 175 SREQKN---------------TVSHRGKALDMLLEAMRN 198


>gi|225175206|ref|ZP_03729202.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dethiobacter alkaliphilus AHT 1]
 gi|225169382|gb|EEG78180.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dethiobacter alkaliphilus AHT 1]
          Length = 200

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 75/219 (34%), Positives = 109/219 (49%), Gaps = 22/219 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             ++IAS N  K+ E   L+    +   S     NL   EETG++F ENA +K+ T A+ 
Sbjct: 1   MKLIIASRNEGKLREFAQLLADSPLEPVSLSAYPNLPEIEETGSTFRENAALKAETVARL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  AL+DDSGL +D L G+PG++SAR+A    G+   +         L          R
Sbjct: 61  TGEWALADDSGLEVDALGGEPGVYSARYAGEGQGDEANNK------KLLDKLADVPEEKR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F +V+++A P    +   G V GII + P+G  GFGYDP+F      +TF +MT EE
Sbjct: 115 TARFRAVIAIARPGKDTQFAEGAVEGIIAFSPQGSGGFGYDPLFLVPHTGKTFAQMTGEE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           KN                +SHRARA +  +    +I  +
Sbjct: 175 KN---------------RISHRARAMEQAMKILKQIASE 198


>gi|149192344|ref|ZP_01870549.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           shilonii AK1]
 gi|148833822|gb|EDL50854.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           shilonii AK1]
          Length = 200

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 68/217 (31%), Positives = 97/217 (44%), Gaps = 23/217 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA+
Sbjct: 1   MSKKIVLATGNQGKVKEMADLLSDFGFEVHAQSEFNVSEVAETGTTFIENAIIKARHAAQ 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+ A++DDSGL +D L G PGI+SAR++     ++      + ++  L        A 
Sbjct: 61  ETGLAAIADDSGLEVDYLKGAPGIYSARYSGEGATDK------RNLDKVLEELKGVPEAQ 114

Query: 125 RSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R+A F  VL L     D       GK  G I+  P G  GFGYDPIF     +    ++ 
Sbjct: 115 RTARFHCVLVLMRHAADPTPIVCHGKWEGRILTEPSGDNGFGYDPIFFVPEDNCASADLE 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              K                 LSHR +A K       
Sbjct: 175 PARK---------------KQLSHRGKALKELFATIK 196


>gi|194468342|ref|ZP_03074328.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Lactobacillus reuteri 100-23]
 gi|194453195|gb|EDX42093.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Lactobacillus reuteri 100-23]
          Length = 195

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 68/213 (31%), Positives = 104/213 (48%), Gaps = 22/213 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IVIA+ N  K  E   ++ PLGI   +  +   I  +E G +FEENA IK+ TA   
Sbjct: 1   MKTIVIATKNAGKAREYQEMLAPLGIEVKTLADFAPIAIDENGETFEENATIKATTATNQ 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +P ++DDSGL++D L G PGI+SAR+A  +    +           L +        R
Sbjct: 61  LHLPVMADDSGLMVDALGGAPGIYSARYAGDHDDAANNAKL-------LSALNGVPDEKR 113

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +AHF + +    PDG     +G+V G I+    G+ GFGYDP+F  +   ++  ++T ++
Sbjct: 114 TAHFRTTIVGIKPDGTKLVANGRVDGHILHQLTGENGFGYDPLFYVDELGKSMAQLTADQ 173

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN                +SHR RA + F+   
Sbjct: 174 KNQ---------------ISHRGRALRSFMKQF 191


>gi|325129832|gb|EGC52640.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis OX99.30304]
 gi|325141916|gb|EGC64358.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis 961-5945]
 gi|325197851|gb|ADY93307.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis G2136]
          Length = 199

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 62/211 (29%), Positives = 85/211 (40%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS NV K+ E  +L  P GI         +    E  ++F ENA+ K+  AA ++G
Sbjct: 7   KIVLASGNVGKLEEFANLFKPYGITVLPQSAFGIPECSEPYSTFVENALAKARHAAGHSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A  +                              
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGDH-----PKSDTANNLKLAAELVGKADKSCCY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P+GQ GFGYDP F    + +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGVWHGQWHDTPQGQNGFGYDPYFYLPEHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALADLIRKL 197


>gi|315181250|gb|ADT88164.1| hypothetical deoxyribonucleotide triphosphate pyrophosphatase
           [Vibrio furnissii NCTC 11218]
          Length = 199

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 68/217 (31%), Positives = 95/217 (43%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MKKIVLATGNQGKVREMADLLADFGFNVVAQSEFNVSEVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D LDG PG++SAR+A  +  ++            L +      A R
Sbjct: 61  TGLPAIADDSGLEVDALDGAPGVYSARYAGEHATDQQNLT------KLLDAMKDVPEAQR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         G   G I+    G  GFGYDPIF     +    ++  
Sbjct: 115 TARFHCVLVLMRHENDPTPLVCHGTWEGRILTEAHGSNGFGYDPIFFVPEDNCASAQLEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGQALKKLFQAIEE 196


>gi|209694131|ref|YP_002262059.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Aliivibrio salmonicida LFI1238]
 gi|208008082|emb|CAQ78223.1| putative hydrolase [Aliivibrio salmonicida LFI1238]
          Length = 198

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 66/217 (30%), Positives = 100/217 (46%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + IV+A+ N  K+ EM  ++   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MSKIVLATGNQGKVREMADVLSDFGFDVVAQSEFNVSDVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G+PA++DDSGL +D L G PG++SAR++     ++      + I+  L +        R
Sbjct: 61  SGLPAIADDSGLEVDALHGAPGVYSARYSGEGATDQ------KNIDKMLAAMKDIPEEKR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         G   G I    +G+ GFGYDPIF  +  + +  E+  
Sbjct: 115 TARFHCVLVLMKHENDPTPLICHGSWEGHITTEQQGENGFGYDPIFWVSEDNCSSAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGQALKKLFAALKE 196


>gi|261392994|emb|CAX50580.1| putative HAM1-like protein [Neisseria meningitidis 8013]
          Length = 199

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 87/211 (41%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS NV K+ E  +L  P GI      E  +    E  ++F ENA+ K+  AA+ +G
Sbjct: 7   KIVLASGNVGKLEEFANLFKPYGITVLPQSEFGIPECPEPYSTFVENALAKARHAAEYSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A  +                              
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGDH-----PKSDTANNLKLAAELAGKADKSCCY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V  L   D       G   G     P G+ GFGYDP F   G+ +T  E+  E KN
Sbjct: 122 VCVLVFVLHKDDPRPIIAEGVWHGQWNGVPAGENGFGYDPYFYLPGHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALAELLRKL 197


>gi|297537276|ref|YP_003673045.1| non-canonical purine NTP pyrophosphatase [Methylotenera sp. 301]
 gi|297256623|gb|ADI28468.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylotenera sp. 301]
          Length = 198

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 98/218 (44%), Gaps = 21/218 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           + + +VIAS N  K+ E++ ++ PL I       LN+   EE   +F ENA+ K+  A+K
Sbjct: 1   MFSKLVIASGNKGKLREIEHILAPLHIEIIPQNALNVPECEEPFCTFIENALAKARHASK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           + G+PAL+DDSGL +D L G PG+ SAR+A     +   +         L+         
Sbjct: 61  HTGLPALADDSGLCVDALQGAPGVLSARYAGEPKSDEANNQ------KLLKVMVNEKNRH 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
              + + VL     D       G+  G I+   RG  GFGYDPIF  +   +T  E++ E
Sbjct: 115 AHFYCVMVLVRHEHDPEPIIAEGQWVGEILSEYRGNDGFGYDPIFLDDKTGKTVAELSIE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
            K                 +SHR  A    +    R+ 
Sbjct: 175 IK---------------SRISHRGHAMAKLLQKIERLS 197


>gi|207723806|ref|YP_002254204.1| xanthosine triphosphate pyrophosphatase protein [Ralstonia
           solanacearum MolK2]
 gi|206589011|emb|CAQ35973.1| xanthosine triphosphate pyrophosphatase protein [Ralstonia
           solanacearum MolK2]
          Length = 206

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 102/217 (47%), Gaps = 19/217 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+AS+N  K+ E  +L+ PLG+  T+  EL +   EE   +F ENA+ K+  A++ A
Sbjct: 7   RRIVLASNNPGKLAEFGTLLAPLGLDVTAQGELGIPEAEEPHVTFVENALAKARHASRLA 66

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSG+    L G PG++SAR+A+     +       ++   L         +  
Sbjct: 67  GLPALADDSGICAHALGGAPGVYSARYAQLAGEPKSDAANNARLVRELAGHADRGAHY-- 124

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
              + V      D       G   G ++  PRG  GFGYDP F      +T  E+++ EK
Sbjct: 125 -VCVLVYVRHADDPQPIIAEGNWFGEVIDAPRGDGGFGYDPHFLLPALGKTAAELSKAEK 183

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           N                +SHRA+A    V+   R+ E
Sbjct: 184 NA---------------VSHRAQALAQLVERL-RLSE 204


>gi|259047138|ref|ZP_05737539.1| glutamate racemase [Granulicatella adiacens ATCC 49175]
 gi|259036188|gb|EEW37443.1| glutamate racemase [Granulicatella adiacens ATCC 49175]
          Length = 482

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 72/215 (33%), Positives = 101/215 (46%), Gaps = 22/215 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTA 62
            +E  IVIA++NV K  E   +  P G    +  +   L   EETG +FEENA +K+ T 
Sbjct: 274 QLEKEIVIATNNVGKAREFAKIFEPKGYKVKTLKDFPELDEVEETGTTFEENARLKAETI 333

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A       L+DDSGL +D L+G PG++SAR+A     +   +  +      L+ K     
Sbjct: 334 ANALQTMVLADDSGLCVDALEGLPGVYSARFAGEEKNDAANNAKLLSELGGLKGKE---- 389

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+AHF   L LA P         +  G I   P G  GFGYDP+F    Y +TF E+ 
Sbjct: 390 --RAAHFTCCLVLAAPFQESLVVQAECHGEIATLPSGDSGFGYDPLFLVPEYQKTFAELG 447

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
            + KN                +SHRA+A +  V+ 
Sbjct: 448 MDIKNK---------------ISHRAKAIELLVEK 467


>gi|197106935|ref|YP_002132312.1| xanthosine triphosphate pyrophosphatase [Phenylobacterium zucineum
           HLK1]
 gi|196480355|gb|ACG79883.1| xanthosine triphosphate pyrophosphatase [Phenylobacterium zucineum
           HLK1]
          Length = 199

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 90/212 (42%), Positives = 120/212 (56%), Gaps = 22/212 (10%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            +V+A+HN  K  E+  ++        SA EL L  P+ET  +F  NA++K+  AA+ +G
Sbjct: 10  RLVVATHNPGKARELAEILDGR-FELVSAGELGLSEPDETEATFSGNALLKARAAAEASG 68

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           + AL+DDSGL +  LDG PG++SARWA     E+DF  AM+K+E  L    A      SA
Sbjct: 69  LIALADDSGLSVAALDGAPGVYSARWAGP---EKDFAAAMRKVEERLEEAGAE---DVSA 122

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F S L++AWP G      G+V G++V+PPRG  GFGYDPIF P G+D+TFGEM    K 
Sbjct: 123 WFTSALAVAWPGGPAVVVEGRVDGMLVFPPRGTRGFGYDPIFVPEGFDQTFGEMEPAAK- 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
                         D +SHRARAF       L
Sbjct: 182 --------------DAMSHRARAFAKLKAALL 199


>gi|194097935|ref|YP_002000981.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae NCCP11945]
 gi|239998406|ref|ZP_04718330.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae 35/02]
 gi|240125155|ref|ZP_04738041.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae SK-92-679]
 gi|268594266|ref|ZP_06128433.1| nucleoside-triphosphatase [Neisseria gonorrhoeae 35/02]
 gi|268683750|ref|ZP_06150612.1| nucleoside-triphosphatase [Neisseria gonorrhoeae SK-92-679]
 gi|193933225|gb|ACF29049.1| Nucleoside-triphosphatase [Neisseria gonorrhoeae NCCP11945]
 gi|268547655|gb|EEZ43073.1| nucleoside-triphosphatase [Neisseria gonorrhoeae 35/02]
 gi|268624034|gb|EEZ56434.1| nucleoside-triphosphatase [Neisseria gonorrhoeae SK-92-679]
 gi|317163692|gb|ADV07233.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 199

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 84/211 (39%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P GI         +    E   +F ENA+ K+  AA ++G
Sbjct: 7   KIVLASGNAGKLKEFGNLFKPYGITVLPQSPFGIPECPEPYPTFVENALAKARHAAGHSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A SN                            S 
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGSN-----PKSDTANNLKLAAELAGKADKSCSY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P GQ GFGYDP F    + +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGIWHGQWHDTPLGQNGFGYDPYFYLPEHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALADLIRKL 197


>gi|57642046|ref|YP_184524.1| nucleoside triphosphate phosphohydrolase, Ham1p-like protein
           [Thermococcus kodakarensis KOD1]
 gi|62900154|sp|Q5JEX8|NTPA_PYRKO RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|57160370|dbj|BAD86300.1| nucleoside triphosphate phosphohydrolase, Ham1p homolog
           [Thermococcus kodakarensis KOD1]
          Length = 184

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 68/217 (31%), Positives = 97/217 (44%), Gaps = 33/217 (15%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +   + N  K+ E      PLG+      +L +  PE   ++ EE A   +   A+  
Sbjct: 1   MRLAFVTSNPGKVEEARKYFEPLGVEVY---QLKVSYPEIQADTLEEVAEYGAKWLAQRV 57

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
             P   DDSGL ++ L G PG++SA   ++           Q I   L+ +       R 
Sbjct: 58  DGPFFLDDSGLFVEALKGFPGVYSAYVYKTIG--------YQGILKLLQGEK-----NRK 104

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           AHF SV++    +     F+G+V G I   PRG  GFG+DPIF P G+DRTF EMT EEK
Sbjct: 105 AHFKSVIAYWDGEL--HIFTGRVDGKIATEPRGSGGFGFDPIFIPEGFDRTFAEMTTEEK 162

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           N                +SHR RA + F +      +
Sbjct: 163 N---------------RISHRGRALREFANWLKENLK 184


>gi|225387619|ref|ZP_03757383.1| hypothetical protein CLOSTASPAR_01384 [Clostridium asparagiforme
           DSM 15981]
 gi|225046292|gb|EEG56538.1| hypothetical protein CLOSTASPAR_01384 [Clostridium asparagiforme
           DSM 15981]
          Length = 203

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 102/221 (46%), Gaps = 22/221 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAA 63
           +E+ IV A+ N  K+ E+ S++  LG+   S  E  +    EE G +F ENA IK+    
Sbjct: 1   MEDKIVFATGNEGKMREIRSILSDLGLPVLSMKEAGVSPEIEENGTTFGENAEIKARAVW 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G   L+DDSGLV+D L G+PGI+SAR+   +T     +  +       R +      
Sbjct: 61  EQTGGIVLADDSGLVVDYLGGEPGIYSARYLGEDTSYEVKNRTIIDRLREAREEERSA-- 118

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
                F+  ++   PDG V +    + G I   P G  GFGYDPI     + +T  E+T 
Sbjct: 119 ----RFVCNIAAVLPDGSVLHTEETMEGRIAGEPAGSGGFGYDPILWLPEFGKTSAEITM 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +EKN                +SHR +A +   +  +    K
Sbjct: 175 DEKN---------------RISHRGKALRAMREALVNWLGK 200


>gi|312903655|ref|ZP_07762831.1| ribonuclease PH [Enterococcus faecalis TX0635]
 gi|310633008|gb|EFQ16291.1| ribonuclease PH [Enterococcus faecalis TX0635]
          Length = 451

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 97/220 (44%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
           E  IVIA+ N  K  E  S+    G    + L+  NL   EETG +FEENA +K+ T A+
Sbjct: 253 EKVIVIATRNPGKAKEFSSIFGEKGYTVKTLLDYPNLPDVEETGRTFEENARLKAETIAE 312

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL++D L G PGI+SAR+A   T +   +         L          
Sbjct: 313 ILQKPVLADDSGLIVDALRGMPGIYSARFAGEPTNDASNNA------KLLHELTGVPKEK 366

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F   L  A P         +  G +   PRG+ GFGYD +F      +T  E++ E
Sbjct: 367 RQARFHCTLVFAEPKKESLVVEAEWPGEVGTIPRGEGGFGYDSLFYVPELGKTAAELSGE 426

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EKN                +SHR +A     +      +K
Sbjct: 427 EKNK---------------VSHRGQAVAKLKEQWEEWLKK 451


>gi|256618706|ref|ZP_05475552.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis ATCC 4200]
 gi|257089534|ref|ZP_05583895.1| ribonuclease PH [Enterococcus faecalis CH188]
 gi|256598233|gb|EEU17409.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis ATCC 4200]
 gi|256998346|gb|EEU84866.1| ribonuclease PH [Enterococcus faecalis CH188]
 gi|315577483|gb|EFU89674.1| ribonuclease PH [Enterococcus faecalis TX0630]
          Length = 451

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 97/220 (44%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
           E  IVIA+ N  K  E  S+    G    + L+  NL   EETG +FEENA +K+ T A+
Sbjct: 253 EKVIVIATRNPGKAKEFSSIFGEKGYTVKTLLDYPNLPDVEETGRTFEENARLKAETIAE 312

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL++D L G PGI+SAR+A   T +   +         L          
Sbjct: 313 ILQKPVLADDSGLIVDALRGMPGIYSARFAGEPTNDASNNA------KLLHELTGVPKEK 366

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F   L  A P         +  G +   PRG+ GFGYD +F      +T  E++ E
Sbjct: 367 RQARFHCTLVFAEPKKESLVVEAEWPGEVGTIPRGEGGFGYDSLFYVPELGKTAAELSGE 426

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EKN                +SHR +A     +      +K
Sbjct: 427 EKNK---------------VSHRGQAVAKLKEQWEEWLKK 451


>gi|23200232|pdb|1K7K|A Chain A, Crystal Structure Of Rdgb- Inosine Triphosphate
           Pyrophosphatase From E. Coli
          Length = 221

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 71/216 (32%), Positives = 106/216 (49%), Gaps = 23/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 24  QKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 83

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +PA++DDSGL +DVL G PGI+SAR++  +  ++      + ++  L +        R 
Sbjct: 84  ALPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQ------KNLQKLLETXKDVPDDQRQ 137

Query: 127 AHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           A F  VL       D       G   G+I   P G  GFGYDPIF      +T  E+T E
Sbjct: 138 ARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTRE 197

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EK+                +SHR +A K  +D    
Sbjct: 198 EKSA---------------ISHRGQALKLLLDALRN 218


>gi|18311235|ref|NP_563169.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Clostridium perfringens str. 13]
 gi|22653755|sp|Q8XI68|NTPA_CLOPE RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|18145918|dbj|BAB81959.1| conserved hypothetical protein [Clostridium perfringens str. 13]
          Length = 204

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 69/225 (30%), Positives = 101/225 (44%), Gaps = 28/225 (12%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
               ++AS+N  K+ E+  ++    +   S  E  + I  EE G +FEEN+  K+    K
Sbjct: 1   MKKFILASNNAHKVKEIKEILKDFNLNILSLNEAGIDIDVEEDGKTFEENSFKKANEIRK 60

Query: 65  N------AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
                  +    ++DDSGL +D L+G PGI+SAR+A  +  +   +      E  L    
Sbjct: 61  YLLSKGESDFIVMADDSGLEVDYLNGAPGIYSARYAGEHGNDSKNN------EKLLEELK 114

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
                 R A+FI V+      G      GK  G+I+    G  GFGYDP+F    Y +TF
Sbjct: 115 NVKDDERKANFICVIVAVTDKGEKIVAEGKSYGLILEALSGNEGFGYDPLFFVPEYKKTF 174

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
            EMT +EKN                +SHR RA +   DN   I +
Sbjct: 175 AEMTSDEKNA---------------ISHRGRALEKLKDNLKGILK 204


>gi|307244059|ref|ZP_07526178.1| tRNA nucleotidyltransferase [Peptostreptococcus stomatis DSM 17678]
 gi|306492583|gb|EFM64617.1| tRNA nucleotidyltransferase [Peptostreptococcus stomatis DSM 17678]
          Length = 486

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 70/214 (32%), Positives = 105/214 (49%), Gaps = 23/214 (10%)

Query: 10  VIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAKNAG 67
           +IA+ N+ K+ E+  ++  +     S  +++L   E  E G +FE NA+IK+ T +K  G
Sbjct: 288 IIATGNMHKLEEIQKMLADMDFDIKSLKDVDLDGVEIIENGKTFEHNALIKARTISKLTG 347

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
             A+ DDSG+ +D L  +PGI+SAR+A  N  +       +                R+A
Sbjct: 348 KIAIGDDSGIEVDALGKRPGIYSARYAGENATDE------ENRIKMFEELKDVPMEKRTA 401

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+ V++  +PDG      GKV G I    RGQ GFGYD +F P GY+ TFG+++ E KN
Sbjct: 402 RFVCVIATVFPDGKEMLARGKVEGRIALEERGQNGFGYDCMFIPEGYEETFGQLSPEVKN 461

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
                            SHR+RA +        I
Sbjct: 462 S---------------FSHRSRALEQMKLRLKEI 480


>gi|291618775|ref|YP_003521517.1| YggV [Pantoea ananatis LMG 20103]
 gi|291153805|gb|ADD78389.1| YggV [Pantoea ananatis LMG 20103]
          Length = 204

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 103/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+  L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 8   MQKVVLATGNPGKVRELADLLADFGLDVVAQTELGVESAEETGLTFIENAILKARHAAQV 67

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL ++ L G PGI+SAR+A  +  ++      Q +E  L++        R
Sbjct: 68  TGLPAIADDSGLAVNALGGAPGIYSARYAGEDASDQ------QNLEKLLQALENTPDGQR 121

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G   G I     G+ GFGYDP+F      +T  E+T+
Sbjct: 122 QAQFHCVLVYLRHAADPTPLVFHGAWEGEITRTASGEGGFGYDPVFWIPALGKTAAELTK 181

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            EK                 +SHR +A    ++    
Sbjct: 182 AEKGK---------------VSHRGKALTLLLEAMRN 203


>gi|237654671|ref|YP_002890985.1| deoxyribonucleotide triphosphate pyrophosphatase [Thauera sp. MZ1T]
 gi|237625918|gb|ACR02608.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Thauera
           sp. MZ1T]
          Length = 201

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 66/216 (30%), Positives = 96/216 (44%), Gaps = 18/216 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +V+AS+N  K  EM +L+ PLGI         +   EE   SF ENA+ K+  A+ 
Sbjct: 1   MSKRLVLASNNAKKAAEMQALLAPLGIEVIPQSVFGVGEAEEPHPSFVENALAKARHASA 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PA++DDSGL ++ L G PG+ SAR+A     +   +  + +    L         F
Sbjct: 61  ATGLPAVADDSGLCVEALGGAPGVISARFAGEPRSDARNNALLLERLAHLPEPAQRRAYF 120

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
            SA    VL     D       G+  G I+   RG+ GFGYDP+F     ++T  E+   
Sbjct: 121 YSA---VVLVRHADDPRPLIADGEWHGEILPAARGEGGFGYDPLFWVPELEQTAAELDSA 177

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            KN                LSHR  A +  +D    
Sbjct: 178 LKN---------------TLSHRGAAMRHLLDRLAE 198


>gi|59800674|ref|YP_207386.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae FA 1090]
 gi|240013531|ref|ZP_04720444.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae DGI18]
 gi|240015969|ref|ZP_04722509.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae FA6140]
 gi|240080110|ref|ZP_04724653.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae FA19]
 gi|240112322|ref|ZP_04726812.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae MS11]
 gi|240115063|ref|ZP_04729125.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae PID18]
 gi|240117348|ref|ZP_04731410.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae PID1]
 gi|240120603|ref|ZP_04733565.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae PID24-1]
 gi|240127610|ref|ZP_04740271.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae SK-93-1035]
 gi|254493125|ref|ZP_05106296.1| nucleoside-triphosphatase [Neisseria gonorrhoeae 1291]
 gi|260441121|ref|ZP_05794937.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria gonorrhoeae DGI2]
 gi|268596263|ref|ZP_06130430.1| nucleoside-triphosphatase [Neisseria gonorrhoeae FA19]
 gi|268598384|ref|ZP_06132551.1| nucleoside-triphosphatase [Neisseria gonorrhoeae MS11]
 gi|268600739|ref|ZP_06134906.1| nucleoside-triphosphatase [Neisseria gonorrhoeae PID18]
 gi|268603045|ref|ZP_06137212.1| nucleoside-triphosphatase [Neisseria gonorrhoeae PID1]
 gi|268685991|ref|ZP_06152853.1| nucleoside-triphosphatase [Neisseria gonorrhoeae SK-93-1035]
 gi|291044451|ref|ZP_06570160.1| nucleoside-triphosphatase [Neisseria gonorrhoeae DGI2]
 gi|293397585|ref|ZP_06641791.1| Ham1 family protein [Neisseria gonorrhoeae F62]
 gi|59717569|gb|AAW88974.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|226512165|gb|EEH61510.1| nucleoside-triphosphatase [Neisseria gonorrhoeae 1291]
 gi|268550051|gb|EEZ45070.1| nucleoside-triphosphatase [Neisseria gonorrhoeae FA19]
 gi|268582515|gb|EEZ47191.1| nucleoside-triphosphatase [Neisseria gonorrhoeae MS11]
 gi|268584870|gb|EEZ49546.1| nucleoside-triphosphatase [Neisseria gonorrhoeae PID18]
 gi|268587176|gb|EEZ51852.1| nucleoside-triphosphatase [Neisseria gonorrhoeae PID1]
 gi|268626275|gb|EEZ58675.1| nucleoside-triphosphatase [Neisseria gonorrhoeae SK-93-1035]
 gi|291011345|gb|EFE03341.1| nucleoside-triphosphatase [Neisseria gonorrhoeae DGI2]
 gi|291611531|gb|EFF40600.1| Ham1 family protein [Neisseria gonorrhoeae F62]
          Length = 199

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 84/211 (39%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P GI         +    E   +F ENA+ K+  AA ++G
Sbjct: 7   KIVLASGNAGKLKEFGNLFKPYGITVLPQSAFGIPECPEPYPTFVENALAKARHAAGHSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A SN                            S 
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGSN-----PKSDTANNLKLAAELAGKADKSCSY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P GQ GFGYDP F    + +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGIWHGQWHDTPLGQNGFGYDPYFYLPEHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALADLIRKL 197


>gi|225075214|ref|ZP_03718413.1| hypothetical protein NEIFLAOT_00214 [Neisseria flavescens
           NRL30031/H210]
 gi|224953389|gb|EEG34598.1| hypothetical protein NEIFLAOT_00214 [Neisseria flavescens
           NRL30031/H210]
          Length = 197

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/217 (29%), Positives = 89/217 (41%), Gaps = 20/217 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   IV+AS N  K+ E   L   L I      + N     E  ++F ENA+ K+  AAK
Sbjct: 1   MFEKIVLASGNAGKLKEFSRLFADLNIEVLPQSQFNTPECPEPYHTFVENALAKARHAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PAL+DDSG+  + L+G PGI SAR+A  N   +       K+ N L  K      +
Sbjct: 61  YSGLPALADDSGICTNALNGAPGIFSARYAGEN--PKSDAANNAKLSNDLADKDDKSCYY 118

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                + VL     D       G   G       G  GFGYDP F    +  T  E+  E
Sbjct: 119 ---VCVLVLVRHENDPQPIIAEGIWRGQWQAEAAGTNGFGYDPHFYLAEHGCTAAELDPE 175

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            KN                 SHR +A +  +     +
Sbjct: 176 IKNAE---------------SHRGQALRELLRKIEAL 197


>gi|83945045|ref|ZP_00957411.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanicaulis alexandrii HTCC2633]
 gi|83851827|gb|EAP89682.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanicaulis alexandrii HTCC2633]
          Length = 201

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 112/209 (53%), Gaps = 21/209 (10%)

Query: 11  IASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPA 70
           IASHN  KI E+  LI P G+    A  L L  PEET  +F  NA++K+   A+  G+ +
Sbjct: 12  IASHNKGKIKEIAELIAPYGLAAEGAESLGLPEPEETEKTFTGNALLKARAGAEACGLVS 71

Query: 71  LSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFI 130
           L+DDSGL +  LDG PGI+SARWA               +E   R   A +    SA F+
Sbjct: 72  LADDSGLEVTALDGAPGIYSARWAGEPRDFH------AAMEKVRRELEARNATDYSARFV 125

Query: 131 SVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGGI 190
             L+LA P+G    + G+V G + +PPRG+ GFGYDPIF P+G++ TF EM    K+   
Sbjct: 126 CALALAHPNGETRVYEGEVRGQLSFPPRGEKGFGYDPIFIPDGHELTFAEMDPAIKHA-- 183

Query: 191 DSATLFSILSTDLLSHRARAFKCFVDNCL 219
                        +SHRA AF+  V++  
Sbjct: 184 -------------MSHRAHAFRLLVEDIF 199


>gi|146329252|ref|YP_001209572.1| Ham1-like protein [Dichelobacter nodosus VCS1703A]
 gi|146232722|gb|ABQ13700.1| Ham1-like protein [Dichelobacter nodosus VCS1703A]
          Length = 196

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 102/217 (47%), Gaps = 21/217 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +EN IV+AS+N  KI E  SL  PL           +    ETG SF ENA++K+  AAK
Sbjct: 1   MENTIVLASNNSGKIAEFQSLFAPLSYRIVPQSNWRIDDVCETGLSFVENALLKARHAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGL++  L+G P I+SAR+A  +  +   +  + K    +  + A     
Sbjct: 61  ISGLPAIADDSGLMVTALNGAPSIYSARYAGGHGDDVANNANLLKEMELIDDRRAMF--- 117

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                + V      D      +G  +G I+  PRG  GFGYDP+F      ++  E+T  
Sbjct: 118 ---VSVIVYCRHDEDPLPLIATGTWTGEILRAPRGDRGFGYDPLFWLPELGKSAAELTLA 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EKN                +SHR +A + F       
Sbjct: 175 EKNQ---------------ISHRGKALRAFCALFQEN 196


>gi|220936121|ref|YP_002515020.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|254768053|sp|B8GPB3|NTPA_THISH RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|219997431|gb|ACL74033.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 196

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 96/214 (44%), Gaps = 23/214 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+A+ N  K+ E+  L+   GI      +  +   EE G SF ENA++K+  AA + 
Sbjct: 1   MKIVLATGNAGKVRELSELLAGTGITILPQSDFGVPEAEENGLSFVENAILKARNAAAHT 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSG+ +D L+G PGI+SAR+A         +  + K    + S        R+
Sbjct: 61  GLPAIADDSGIEVDALNGSPGIYSARYAGPGGDAEANNRKLLKALEHVESS------QRT 114

Query: 127 AHFISVLSLAWPDGHVENFSGK--VSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           A F  V+              +    G I    RG  G GYDPIF+    + T  E++  
Sbjct: 115 ARFRCVMVYLRHADDPSPVIAEGSWEGRIASEARGPGGHGYDPIFEIPELELTAAEISPA 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                 SHR +A +  ++  
Sbjct: 175 EKNRR---------------SHRGQALRILLERL 193


>gi|293605630|ref|ZP_06688010.1| non-canonical purine NTP pyrophosphatase RdgB [Achromobacter
           piechaudii ATCC 43553]
 gi|292816010|gb|EFF75111.1| non-canonical purine NTP pyrophosphatase RdgB [Achromobacter
           piechaudii ATCC 43553]
          Length = 207

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 104/214 (48%), Gaps = 22/214 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+AS+N  K+ E  +L  PLGI      ELN+   +E   +F ENA+ K+  A++  
Sbjct: 11  RRIVLASNNAGKLREFSALFAPLGIELVPQGELNVPEADEPHVTFIENALTKARHASRLT 70

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +  LD  PG++SAR+A+ + GE+          NAL  +     + R 
Sbjct: 71  GLPALADDSGLCVAALDAAPGVYSARYAKMHGGEKSDQAN-----NALLVQNLAGVSDRR 125

Query: 127 AHFISVLSLAW--PDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           A +++VL+L     D       G   G I+  P G  GFGYDP F       T   +  E
Sbjct: 126 AWYVAVLALVRSENDPCPLIGEGLWHGEIIDVPEGANGFGYDPHFYLPDMALTAASLEPE 185

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                +SHRARA +  +   
Sbjct: 186 EKN---------------RVSHRARALRELLSKL 204


>gi|329891145|ref|ZP_08269488.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brevundimonas diminuta ATCC 11568]
 gi|328846446|gb|EGF96010.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brevundimonas diminuta ATCC 11568]
          Length = 200

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 91/216 (42%), Positives = 122/216 (56%), Gaps = 22/216 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           +    +V A+HN  K  E+++L+        +A ELNL  P+ET  +F  NAM+K+  AA
Sbjct: 6   IKGMRLVAATHNPGKAREIEALLDGH-YTIVTAGELNLPEPDETETTFVGNAMLKARHAA 64

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           + +G  AL+DDSGL +  LDG PGI+SARWA      +DF +AM+K+E  L    +    
Sbjct: 65  QASGEVALADDSGLSVAALDGAPGIYSARWAGPT---KDFALAMKKVEQRLEEIAST--- 118

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F S L++AWPDG      G++ G +V+PPRG  GFGYDPIF+P G + TFGEM  
Sbjct: 119 DRRAWFTSALAVAWPDGPCVVVEGQIDGELVFPPRGDRGFGYDPIFRPEGSELTFGEMDP 178

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            EK               D LSHRARAF       +
Sbjct: 179 VEK---------------DALSHRARAFARLKAALI 199


>gi|323493575|ref|ZP_08098696.1| dITP/XTP pyrophosphatase [Vibrio brasiliensis LMG 20546]
 gi|323312098|gb|EGA65241.1| dITP/XTP pyrophosphatase [Vibrio brasiliensis LMG 20546]
          Length = 199

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 97/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MSKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D L G PGI+SAR+A     ++      Q +E  L +        R
Sbjct: 61  TGLAAIADDSGLEVDALKGAPGIYSARYAGEGASDQ------QNLEKLLEAMKDVPEEQR 114

Query: 126 SAHFIS--VLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F    VL     D       GK  G I+   +G+ GFGYDP+F     +    ++  
Sbjct: 115 SARFHCVLVLMRHDNDPTPIVCHGKWEGRILTEAQGENGFGYDPVFFVPEDNCASAQLEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 ARK---------------KQLSHRGKALKQLFATLSE 196


>gi|325570405|ref|ZP_08146182.1| ribonuclease PH/Ham1 protein [Enterococcus casseliflavus ATCC
           12755]
 gi|325156615|gb|EGC68792.1| ribonuclease PH/Ham1 protein [Enterococcus casseliflavus ATCC
           12755]
          Length = 450

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 72/221 (32%), Positives = 103/221 (46%), Gaps = 22/221 (9%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTA 62
           + E  IVIA+ N  K  E  ++    G    +  +   L   EETG +FEENA +K+ T 
Sbjct: 247 IPEKTIVIATGNPGKAKEFKAVFGAAGYDVRTLKDYPSLPDVEETGTTFEENARLKAETI 306

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A+  G P L+DDSGL +D L G+PG++SAR+A     +   +         L      + 
Sbjct: 307 ARILGRPVLADDSGLKVDALGGRPGVYSARFAGEQKSDAANNA------KLLYELTDVED 360

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             RSA F   L  A P         +  G I   PRG+ GFGYDP+F P+G +++  +M+
Sbjct: 361 DKRSAQFHCTLVFAAPGKDSLVVEAQWPGRIGRIPRGENGFGYDPLFIPDGSEQSAAQMS 420

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           +EEKN                +SHR  A K   +      E
Sbjct: 421 QEEKN---------------RVSHRGLAIKKLQEQWQEWLE 446


>gi|315170973|gb|EFU14990.1| ribonuclease PH [Enterococcus faecalis TX1342]
          Length = 451

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 97/220 (44%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
           E  IVIA+ N  K  E  S+    G    + L+  NL   EETG +FEENA +K+ T A+
Sbjct: 253 EKVIVIATRNPGKAKEFSSIFGEKGYTVKTLLDYPNLPDVEETGRTFEENARLKAETIAE 312

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL++D L G PGI+SAR+A   T +   +         L          
Sbjct: 313 ILQKPVLADDSGLIVDALGGMPGIYSARFAGEPTNDASNNA------KLLHELTGVPKEK 366

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F   L  A P         +  G +   PRG+ GFGYD +F      +T  E++ E
Sbjct: 367 RQARFHCTLVFAEPKKESLVVEAEWPGEVGTIPRGEGGFGYDSLFYVPELGKTAAELSGE 426

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EKN                +SHR +A     +      +K
Sbjct: 427 EKNK---------------VSHRGQAVAKLKEQWEEWLKK 451


>gi|315153645|gb|EFT97661.1| ribonuclease PH [Enterococcus faecalis TX0031]
          Length = 451

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 97/220 (44%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
           E  IVIA+ N  K  E  S+    G    + L+  NL   EETG +FEENA +K+ T A+
Sbjct: 253 EKVIVIATRNPGKAKEFSSIFGEKGYTVKTLLDYPNLPDVEETGRTFEENARLKAETIAE 312

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL++D L G PGI+SAR+A   T +   +         L          
Sbjct: 313 ILQKPVLADDSGLIVDALGGMPGIYSARFAGEPTNDASNNA------KLLHELTGVPKEK 366

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F   L  A P         +  G +   PRG+ GFGYD +F      +T  E++ E
Sbjct: 367 RQARFHCTLVFAEPKKESLVVEAEWPGEVGTIPRGEGGFGYDSLFYVPELGKTAAELSGE 426

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EKN                +SHR +A     +      +K
Sbjct: 427 EKNK---------------VSHRGQAVAKLKEQWEEWLKK 451


>gi|315150398|gb|EFT94414.1| ribonuclease PH [Enterococcus faecalis TX0012]
          Length = 451

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 97/220 (44%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
           E  IVIA+ N  K  E  S+    G    + L+  NL   EETG +FEENA +K+ T A+
Sbjct: 253 EKVIVIATRNPGKAKEFSSIFGEKGYTVKTLLDYPNLPDVEETGRTFEENARLKAETIAE 312

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL++D L G PGI+SAR+A   T +   +         L          
Sbjct: 313 ILQKPVLADDSGLIVDALGGMPGIYSARFAGEPTNDASNNA------KLLHELTGVPKEK 366

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F   L  A P         +  G +   PRG+ GFGYD +F      +T  E++ E
Sbjct: 367 RQARFHCTLVFAEPKKESLVVEAEWPGEVGTIPRGEGGFGYDSLFYVPELGKTAAELSGE 426

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EKN                +SHR +A     +      +K
Sbjct: 427 EKNK---------------VSHRGQAVAKLKEQWEEWLKK 451


>gi|315144635|gb|EFT88651.1| ribonuclease PH [Enterococcus faecalis TX2141]
 gi|315160934|gb|EFU04951.1| ribonuclease PH [Enterococcus faecalis TX0645]
          Length = 451

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 97/220 (44%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
           E  IVIA+ N  K  E  S+    G    + L+  NL   EETG +FEENA +K+ T A+
Sbjct: 253 EKVIVIATRNPGKAKEFSSIFGEKGYTVKTLLDYPNLPDVEETGRTFEENARLKAETIAE 312

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL++D L G PGI+SAR+A   T +   +         L          
Sbjct: 313 ILQKPVLADDSGLIVDALGGMPGIYSARFAGEPTNDASNNA------KLLHELTGVPKEK 366

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F   L  A P         +  G +   PRG+ GFGYD +F      +T  E++ E
Sbjct: 367 RQARFHCTLVFAEPKKESLVVEAEWPGEVGTIPRGEGGFGYDSLFYVPELGKTAAELSGE 426

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EKN                +SHR +A     +      +K
Sbjct: 427 EKNK---------------VSHRGQAVAKLKEQWEEWLKK 451


>gi|312899597|ref|ZP_07758923.1| ribonuclease PH [Enterococcus faecalis TX0470]
 gi|311293276|gb|EFQ71832.1| ribonuclease PH [Enterococcus faecalis TX0470]
          Length = 451

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 97/220 (44%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
           E  IVIA+ N  K  E  S+    G    + L+  NL   EETG +FEENA +K+ T A+
Sbjct: 253 EKVIVIATRNPGKAKEFSSIFGEKGYTVKTLLDYPNLPDVEETGRTFEENARLKAETIAE 312

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL++D L G PGI+SAR+A   T +   +         L          
Sbjct: 313 ILQKPVLADDSGLIVDALGGMPGIYSARFAGEPTNDASNNA------KLLHELTGVPKEK 366

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F   L  A P         +  G +   PRG+ GFGYD +F      +T  E++ E
Sbjct: 367 RQARFHCTLVFAEPKKESLVVEAEWPGEVGTIPRGEGGFGYDSLFYVPELGKTAAELSGE 426

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EKN                +SHR +A     +      +K
Sbjct: 427 EKNK---------------VSHRGQAVAKLKEQWEEWLKK 451


>gi|229546199|ref|ZP_04434924.1| tRNA nucleotidyltransferase [Enterococcus faecalis TX1322]
 gi|229550384|ref|ZP_04439109.1| tRNA nucleotidyltransferase [Enterococcus faecalis ATCC 29200]
 gi|255973155|ref|ZP_05423741.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis T1]
 gi|255976198|ref|ZP_05426784.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis T2]
 gi|256762130|ref|ZP_05502710.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis T3]
 gi|256852772|ref|ZP_05558142.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis T8]
 gi|256958619|ref|ZP_05562790.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis DS5]
 gi|256965477|ref|ZP_05569648.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis HIP11704]
 gi|257078027|ref|ZP_05572388.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis JH1]
 gi|257082915|ref|ZP_05577276.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis E1Sol]
 gi|257086477|ref|ZP_05580838.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis D6]
 gi|257415736|ref|ZP_05592730.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis AR01/DG]
 gi|257422961|ref|ZP_05599951.1| ribonuclease PH [Enterococcus faecalis X98]
 gi|294780993|ref|ZP_06746345.1| tRNA nucleotidyltransferase [Enterococcus faecalis PC1.1]
 gi|300860046|ref|ZP_07106134.1| tRNA nucleotidyltransferase [Enterococcus faecalis TUSoD Ef11]
 gi|307273813|ref|ZP_07555035.1| ribonuclease PH [Enterococcus faecalis TX0855]
 gi|307274576|ref|ZP_07555756.1| ribonuclease PH [Enterococcus faecalis TX2134]
 gi|307278842|ref|ZP_07559905.1| ribonuclease PH [Enterococcus faecalis TX0860]
 gi|307288573|ref|ZP_07568557.1| ribonuclease PH [Enterococcus faecalis TX0109]
 gi|307291105|ref|ZP_07570990.1| ribonuclease PH [Enterococcus faecalis TX0411]
 gi|312951374|ref|ZP_07770272.1| ribonuclease PH [Enterococcus faecalis TX0102]
 gi|229304506|gb|EEN70502.1| tRNA nucleotidyltransferase [Enterococcus faecalis ATCC 29200]
 gi|229308723|gb|EEN74710.1| tRNA nucleotidyltransferase [Enterococcus faecalis TX1322]
 gi|255964173|gb|EET96649.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis T1]
 gi|255969070|gb|EET99692.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis T2]
 gi|256683381|gb|EEU23076.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis T3]
 gi|256711231|gb|EEU26269.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis T8]
 gi|256949115|gb|EEU65747.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis DS5]
 gi|256955973|gb|EEU72605.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis HIP11704]
 gi|256986057|gb|EEU73359.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis JH1]
 gi|256990945|gb|EEU78247.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis E1Sol]
 gi|256994507|gb|EEU81809.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis D6]
 gi|257157564|gb|EEU87524.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis ARO1/DG]
 gi|257164785|gb|EEU94745.1| ribonuclease PH [Enterococcus faecalis X98]
 gi|294451939|gb|EFG20389.1| tRNA nucleotidyltransferase [Enterococcus faecalis PC1.1]
 gi|300850864|gb|EFK78613.1| tRNA nucleotidyltransferase [Enterococcus faecalis TUSoD Ef11]
 gi|306497759|gb|EFM67291.1| ribonuclease PH [Enterococcus faecalis TX0411]
 gi|306500480|gb|EFM69813.1| ribonuclease PH [Enterococcus faecalis TX0109]
 gi|306504513|gb|EFM73720.1| ribonuclease PH [Enterococcus faecalis TX0860]
 gi|306508728|gb|EFM77818.1| ribonuclease PH [Enterococcus faecalis TX2134]
 gi|306509498|gb|EFM78546.1| ribonuclease PH [Enterococcus faecalis TX0855]
 gi|310630634|gb|EFQ13917.1| ribonuclease PH [Enterococcus faecalis TX0102]
 gi|315028079|gb|EFT40011.1| ribonuclease PH [Enterococcus faecalis TX2137]
 gi|315030712|gb|EFT42644.1| ribonuclease PH [Enterococcus faecalis TX4000]
 gi|315031600|gb|EFT43532.1| ribonuclease PH [Enterococcus faecalis TX0017]
 gi|315034958|gb|EFT46890.1| ribonuclease PH [Enterococcus faecalis TX0027]
 gi|315148459|gb|EFT92475.1| ribonuclease PH [Enterococcus faecalis TX4244]
 gi|315156537|gb|EFU00554.1| ribonuclease PH [Enterococcus faecalis TX0043]
 gi|315158363|gb|EFU02380.1| ribonuclease PH [Enterococcus faecalis TX0312]
 gi|315165533|gb|EFU09550.1| ribonuclease PH [Enterococcus faecalis TX1302]
 gi|315168390|gb|EFU12407.1| ribonuclease PH [Enterococcus faecalis TX1341]
 gi|323480361|gb|ADX79800.1| ribonuclease PH [Enterococcus faecalis 62]
 gi|329576387|gb|EGG57900.1| tRNA nucleotidyltransferase [Enterococcus faecalis TX1467]
          Length = 451

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 97/220 (44%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
           E  IVIA+ N  K  E  S+    G    + L+  NL   EETG +FEENA +K+ T A+
Sbjct: 253 EKVIVIATRNPGKAKEFSSIFGEKGYTVKTLLDYPNLPDVEETGRTFEENARLKAETIAE 312

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL++D L G PGI+SAR+A   T +   +         L          
Sbjct: 313 ILQKPVLADDSGLIVDALGGMPGIYSARFAGEPTNDASNNA------KLLHELTGVPKEK 366

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F   L  A P         +  G +   PRG+ GFGYD +F      +T  E++ E
Sbjct: 367 RQARFHCTLVFAEPKKESLVVEAEWPGEVGTIPRGEGGFGYDSLFYVPELGKTAAELSGE 426

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EKN                +SHR +A     +      +K
Sbjct: 427 EKNK---------------VSHRGQAVAKLKEQWEEWLKK 451


>gi|145637141|ref|ZP_01792803.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae PittHH]
 gi|145269586|gb|EDK09527.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus influenzae PittHH]
          Length = 195

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 102/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  A++
Sbjct: 1   MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+  L+G PG++SAR+     GE   D   ++   A  +  A D   
Sbjct: 61  KSGLPAIADDSGLVVSALNGAPGLYSARY----AGEEGNDAKNREKLLAELAHVAQDQRQ 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  V      D       G+  G+I +  +G+ GFGYD +F       TFGE+   
Sbjct: 117 AKFVSCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFSPEQGCTFGELETV 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRA+A        
Sbjct: 177 EKKK---------------ISHRAKALSVLKSKL 195


>gi|29375698|ref|NP_814852.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis V583]
 gi|256962282|ref|ZP_05566453.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis Merz96]
 gi|257418951|ref|ZP_05595945.1| ribonuclease PH/Ham1 [Enterococcus faecalis T11]
 gi|293383311|ref|ZP_06629226.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis R712]
 gi|293387532|ref|ZP_06632081.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis S613]
 gi|312905818|ref|ZP_07764838.1| ribonuclease PH [Enterococcus faecalis DAPTO 512]
 gi|312909127|ref|ZP_07767986.1| ribonuclease PH [Enterococcus faecalis DAPTO 516]
 gi|29343159|gb|AAO80922.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis V583]
 gi|256952778|gb|EEU69410.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis Merz96]
 gi|257160779|gb|EEU90739.1| ribonuclease PH/Ham1 [Enterococcus faecalis T11]
 gi|291079334|gb|EFE16698.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis R712]
 gi|291083042|gb|EFE20005.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis S613]
 gi|310628157|gb|EFQ11440.1| ribonuclease PH [Enterococcus faecalis DAPTO 512]
 gi|311290551|gb|EFQ69107.1| ribonuclease PH [Enterococcus faecalis DAPTO 516]
 gi|315174641|gb|EFU18658.1| ribonuclease PH [Enterococcus faecalis TX1346]
 gi|315573714|gb|EFU85905.1| ribonuclease PH [Enterococcus faecalis TX0309B]
 gi|315582671|gb|EFU94862.1| ribonuclease PH [Enterococcus faecalis TX0309A]
 gi|327534753|gb|AEA93587.1| ribonuclease PH/Ham1 protein [Enterococcus faecalis OG1RF]
          Length = 451

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 97/220 (44%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
           E  IVIA+ N  K  E  S+    G    + L+  NL   EETG +FEENA +K+ T A+
Sbjct: 253 EKVIVIATRNPGKAKEFSSIFGEKGYTVKTLLDYPNLPDVEETGRTFEENARLKAETIAE 312

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL++D L G PGI+SAR+A   T +   +         L          
Sbjct: 313 ILQKPVLADDSGLIVDALGGMPGIYSARFAGEPTNDASNNA------KLLHELTGVPKEK 366

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F   L  A P         +  G +   PRG+ GFGYD +F      +T  E++ E
Sbjct: 367 RQARFHCTLVFAEPKKESLVVEAEWPGEVGTIPRGEGGFGYDSLFYVPELGKTAAELSGE 426

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EKN                +SHR +A     +      +K
Sbjct: 427 EKNK---------------VSHRGQAVAKLKEQWEEWLKK 451


>gi|72162763|ref|YP_290420.1| Ham1-like protein [Thermobifida fusca YX]
 gi|71916495|gb|AAZ56397.1| Ham1-like protein [Thermobifida fusca YX]
          Length = 207

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 76/224 (33%), Positives = 111/224 (49%), Gaps = 21/224 (9%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMP--LGIMTTSALEL-NLIIPEETGNSFEENAMI 57
           M ++  + +V+A+ N  KI E+ S++    L I   S     +     ET  +F  NA++
Sbjct: 1   MSRI--STLVLATRNRKKIPELRSILGEVGLDIEVRSLDGYPDAPEVAETEATFTGNALL 58

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSK 117
           K+   A++ G+PA++DDSGL +D L+G PG+ SARW+    G +  D     +E  L   
Sbjct: 59  KARAIAEHTGLPAVADDSGLRVDALNGMPGVLSARWSGRF-GAQHGDRDAANLELVLDQL 117

Query: 118 FAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
               P  R A F+   +LA PDG      G + G +   PRG+ GFGYDPIF P GY +T
Sbjct: 118 ADVPPERRGAEFVCAAALALPDGEEHVVEGVLRGSLTTEPRGKNGFGYDPIFVPEGYTQT 177

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
             EM+ EEKN                +SHR  AF+        +
Sbjct: 178 TAEMSPEEKNA---------------ISHRGVAFRALAKKIREL 206


>gi|295691350|ref|YP_003595043.1| non-canonical purine NTP pyrophosphatase, rdgb/HAM1 family
           [Caulobacter segnis ATCC 21756]
 gi|295433253|gb|ADG12425.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Caulobacter segnis ATCC 21756]
          Length = 200

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 84/216 (38%), Positives = 120/216 (55%), Gaps = 22/216 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +V A+HN  K+ E+ +L+        +A +L L  PEET ++F  NA++K+  AA 
Sbjct: 7   MGMKLVAATHNPGKVPEIMALLDGR-FEIVTAGQLGLPEPEETESTFVGNALLKARHAAD 65

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+ AL+DDSGL +  L+G PG++SARWA  +   +DF  AM+K+E  L    +     
Sbjct: 66  RSGLVALADDSGLSVAALEGSPGVYSARWAGPS---KDFMAAMRKVEERLEETSSD---D 119

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           RSA F S L++AWP G      G++ G++ +PPRG  GFGYDPIF P G++ TFGEM   
Sbjct: 120 RSAWFTSALAVAWPHGPAVVVEGRIDGMLTFPPRGDRGFGYDPIFIPAGHETTFGEMEPA 179

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            K               D +SHRARAF         
Sbjct: 180 AK---------------DAMSHRARAFAKLKAALFE 200


>gi|33592682|ref|NP_880326.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bordetella pertussis Tohama I]
 gi|62900266|sp|Q7VXX8|NTPA_BORPE RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|62900268|sp|Q7WI95|NTPA_BORBR RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|33572328|emb|CAE41882.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|332382097|gb|AEE66944.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bordetella pertussis CS]
          Length = 213

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 67/213 (31%), Positives = 95/213 (44%), Gaps = 18/213 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E  +L  PLGI      EL +   EE   +F ENA+ K+  A+++ 
Sbjct: 11  RRVVLASNNAGKLREFSALFAPLGIELVPQSELGVSEAEEPHATFVENALAKARHASRHT 70

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +  L G PG+HSAR+A+   G R        +   L +       +  
Sbjct: 71  GLPALADDSGLCVVALGGAPGVHSARYAQQPGGARSDAANNALLVRELAAAGDRRAWY-- 128

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
              +  L     D       G   G IV  P G+ GFGYDP F       T  ++  E K
Sbjct: 129 -VALLALVRTENDPCPLIGEGLWHGEIVDAPAGEHGFGYDPHFYLPQQGCTAAQLAPEHK 187

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           N                +SHRA+A    +D   
Sbjct: 188 N---------------RISHRAQALAQLLDKLR 205


>gi|33601932|ref|NP_889492.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bordetella bronchiseptica RB50]
 gi|33576370|emb|CAE33448.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 216

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 67/213 (31%), Positives = 95/213 (44%), Gaps = 18/213 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E  +L  PLGI      EL +   EE   +F ENA+ K+  A+++ 
Sbjct: 14  RRVVLASNNAGKLREFSALFAPLGIELVPQSELGVSEAEEPHATFVENALAKARHASRHT 73

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +  L G PG+HSAR+A+   G R        +   L +       +  
Sbjct: 74  GLPALADDSGLCVVALGGAPGVHSARYAQQPGGARSDAANNALLVRELAAAGDRRAWY-- 131

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
              +  L     D       G   G IV  P G+ GFGYDP F       T  ++  E K
Sbjct: 132 -VALLALVRTENDPCPLIGEGLWHGEIVDAPAGEHGFGYDPHFYLPQQGCTAAQLAPEHK 190

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           N                +SHRA+A    +D   
Sbjct: 191 N---------------RISHRAQALAQLLDKLR 208


>gi|82778274|ref|YP_404623.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Shigella
           dysenteriae Sd197]
 gi|309785218|ref|ZP_07679849.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella dysenteriae 1617]
 gi|81242422|gb|ABB63132.1| putative ribosomal protein [Shigella dysenteriae Sd197]
 gi|308926338|gb|EFP71814.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Shigella dysenteriae 1617]
          Length = 197

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 69/215 (32%), Positives = 103/215 (47%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 1   MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +DVL G PGI+SAR++  +  +      +QK+   L+          
Sbjct: 61  TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATD---LKNLQKLLETLKDVPDDQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +   E+T EE
Sbjct: 117 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKNAAELTHEE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 177 KSA---------------ISHRGQALKLLLDALRN 196


>gi|148980493|ref|ZP_01816090.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Vibrionales bacterium SWAT-3]
 gi|145961218|gb|EDK26532.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Vibrionales bacterium SWAT-3]
          Length = 199

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 68/217 (31%), Positives = 98/217 (45%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + IV+A+ N  K+ EM  ++   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MSKIVLATGNQGKVREMADILSEFGFDVVAQNEFNVSEVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR++     ++      Q IE  L +    +   R
Sbjct: 61  TGLPAIADDSGLEVDFLKGAPGIYSARYSGEGASDK------QNIEKLLDAMQGVETEKR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G+ GFGYDP+F     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPLVCHGKWEGQILTEEHGENGFGYDPVFFVPEDNCASAELDP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A          
Sbjct: 175 SRK---------------KQLSHRGKALASLFAALKE 196


>gi|257866170|ref|ZP_05645823.1| ribonuclease PH/Ham1 [Enterococcus casseliflavus EC30]
 gi|257872500|ref|ZP_05652153.1| ribonuclease PH/Ham1 [Enterococcus casseliflavus EC10]
 gi|257800104|gb|EEV29156.1| ribonuclease PH/Ham1 [Enterococcus casseliflavus EC30]
 gi|257806664|gb|EEV35486.1| ribonuclease PH/Ham1 [Enterococcus casseliflavus EC10]
          Length = 450

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 72/221 (32%), Positives = 103/221 (46%), Gaps = 22/221 (9%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTA 62
           + E  IVIA+ N  K  E  ++    G    +  +   L   EETG +FEENA +K+ T 
Sbjct: 247 IPEKTIVIATGNPGKAKEFKAVFGAAGYDVRTLKDYPSLPDVEETGTTFEENARLKAETI 306

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A+  G P L+DDSGL +D L G+PG++SAR+A     +   +         L      + 
Sbjct: 307 ARILGRPVLADDSGLKVDALGGRPGVYSARFAGEQKSDAANNA------KLLYELTDVED 360

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             RSA F   L  A P         +  G I   PRG+ GFGYDP+F P+G +++  +M+
Sbjct: 361 DKRSAQFHCTLVFAAPGKESLVVEAQWPGRIGRIPRGENGFGYDPLFIPDGSEQSAAQMS 420

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           +EEKN                +SHR  A K   +      E
Sbjct: 421 QEEKN---------------RVSHRGLAIKKLQEQWQEWLE 446


>gi|168177070|pdb|2Q16|A Chain A, Structure Of The E. Coli Inosine Triphosphate
           Pyrophosphatase Rgdb In Complex With Itp
 gi|168177071|pdb|2Q16|B Chain B, Structure Of The E. Coli Inosine Triphosphate
           Pyrophosphatase Rgdb In Complex With Itp
          Length = 219

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 70/216 (32%), Positives = 105/216 (48%), Gaps = 23/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK  
Sbjct: 22  QKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVT 81

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +PA++D SGL +DVL G PGI+SAR++  +  ++      + ++  L +        R 
Sbjct: 82  ALPAIADASGLAVDVLGGAPGIYSARYSGEDATDQ------KNLQKLLETXKDVPDDQRQ 135

Query: 127 AHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           A F  VL       D       G   G+I   P G  GFGYDPIF      +T  E+T E
Sbjct: 136 ARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTRE 195

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EK+                +SHR +A K  +D    
Sbjct: 196 EKSA---------------ISHRGQALKLLLDALRN 216


>gi|212709352|ref|ZP_03317480.1| hypothetical protein PROVALCAL_00388 [Providencia alcalifaciens DSM
           30120]
 gi|212688264|gb|EEB47792.1| hypothetical protein PROVALCAL_00388 [Providencia alcalifaciens DSM
           30120]
          Length = 197

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 66/217 (30%), Positives = 104/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K++E+  L+   G+   +   L +   EETG +F ENA++K+  A+ +
Sbjct: 1   MQKVVLATGNPGKVNELADLLRDFGMDIVAQTSLGVESAEETGLTFIENAILKARHASAH 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSG+ +D L G PGI+SAR+A  +  ++      Q ++  L +        R
Sbjct: 61  TGLPAIADDSGISVDALGGAPGIYSARYAGEDATDQ------QNLDKLLDAMKDVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  G++    +GQ GFGYDPIF       T  E+T+
Sbjct: 115 QAQFNCVLVYLRHAEDPTPLVFHGRWHGVLTREAKGQGGFGYDPIFYVPELGCTSAELTK 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            EK                 +SHR +A    +D    
Sbjct: 175 AEK---------------QAVSHRGKALAMMLDALKN 196


>gi|218296249|ref|ZP_03497005.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Thermus
           aquaticus Y51MC23]
 gi|218243321|gb|EED09851.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Thermus
           aquaticus Y51MC23]
          Length = 203

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 119/214 (55%), Gaps = 22/214 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+ + + PLG    S  +  L +P+E G++F ENA++K+   A+  
Sbjct: 1   MRVVLATSNPGKVRELKAGLEPLGWTLLSLADFPLRMPKEEGSTFLENALLKAAYVARAT 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +  L G+PG++SAR+      +R+ ++ + +    L+ +       R 
Sbjct: 61  GLPALADDSGLEVFALGGEPGVYSARYGGRE-TDRERNVYLLERMRHLKGEE------RR 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F++VL LA+PDGH E + G V G+I+  PRG+ GFGYDP+F      +TF EM+ EEK
Sbjct: 114 ARFVAVLVLAYPDGHAEAYEGSVEGVILEAPRGEGGFGYDPLFFIPEAGKTFAEMSLEEK 173

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
                             SHR RA +  +    +
Sbjct: 174 ---------------ARYSHRGRALQALLKAYEK 192


>gi|257465643|ref|ZP_05630014.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Actinobacillus minor 202]
 gi|257451303|gb|EEV25346.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Actinobacillus minor 202]
          Length = 197

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 99/218 (45%), Gaps = 23/218 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           + +  IV+A+ N  K+ EM  ++   G    +  E  +  PEETG +F ENA+IK+  A+
Sbjct: 1   MQKTKIVLATGNQGKVKEMADVLAEFGFEVVAQSEFGIESPEETGLTFVENALIKARYAS 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G+PA++DDSGL +D L G PG++SAR+A  +  ++            L         
Sbjct: 61  QMTGLPAIADDSGLAVDALGGAPGLYSARYAGEDGNDQANRK------KLLEEMANVADQ 114

Query: 124 FRSAHF--ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            R+A F    V+     D   +   G+  G I+   RGQ GFGYD +F       +F E+
Sbjct: 115 DRAAKFVSCIVMLQHPTDPTPKIAIGECFGEILKEERGQNGFGYDALFFYPPKQCSFAEL 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EK                 +SHRA A +       
Sbjct: 175 ETAEKKK---------------ISHRAIALQSLKQQLK 197


>gi|332655283|ref|ZP_08421023.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Ruminococcaceae bacterium D16]
 gi|332515788|gb|EGJ45398.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Ruminococcaceae bacterium D16]
          Length = 197

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 72/209 (34%), Positives = 111/209 (53%), Gaps = 24/209 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAKN 65
             +V+AS N  K+ EM+ ++  LGI   S  +  +    EETG +FEEN+M+K+    + 
Sbjct: 1   MKLVLASKNQKKLKEMNEILSQLGIEVCSEADAGVDVEVEETGTTFEENSMLKAKAVMEA 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +GMPA++DDSGL +D L+G PG++SAR+      +             L  +       R
Sbjct: 61  SGMPAIADDSGLCVDALNGAPGVYSARYGGEGLDDTGRYR--------LLLENMRGQTPR 112

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F+SV++  +P+G V    G+  G I + P G+ GFGYDP+F   G  +TF ++T EE
Sbjct: 113 TAKFVSVITCCFPNGDVLTARGECPGTIAFAPMGEGGFGYDPVFFMPGLKKTFAQLTPEE 172

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCF 214
           KN                +SHR +A + F
Sbjct: 173 KNA---------------ISHRGKALEDF 186


>gi|251788393|ref|YP_003003114.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Dickeya
           zeae Ech1591]
 gi|247537014|gb|ACT05635.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Dickeya
           zeae Ech1591]
          Length = 197

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 68/214 (31%), Positives = 103/214 (48%), Gaps = 19/214 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             N+V+A+ N  K+ E+  L+   G+   +   L +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQNVVLATGNAGKVRELAGLLADFGLDVVAQTTLGVDSAEETGLTFIENAILKARHAARE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A  N G++     +    +        +    
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYAGENAGDQQNLDKLLAALD----NVPDEQRQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           S H + V      D       G   G+I   P G+ GFGYDP+F      +T  E++ EE
Sbjct: 117 SFHCVLVYLRHAEDPTPLVCHGSWQGVIARTPAGEGGFGYDPVFFVPSIGKTAAELSREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           KN                LSHR +A +  +D   
Sbjct: 177 KNA---------------LSHRGQALRQLLDALR 195


>gi|241663553|ref|YP_002981913.1| deoxyribonucleotide triphosphate pyrophosphatase [Ralstonia
           pickettii 12D]
 gi|240865580|gb|ACS63241.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ralstonia pickettii 12D]
          Length = 201

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 98/214 (45%), Gaps = 18/214 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS+N  K+ E ++L+  LG   T    L +   EE   +F ENA+ K+  A++ 
Sbjct: 1   MRKIVLASNNAGKLTEFNALLGTLGFDVTPQGALGIPEAEEPYATFVENALTKARHASRA 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G+PAL+DDSG+ +  L G PG++SAR+A+     +       ++   L  K      + 
Sbjct: 61  SGLPALADDSGICVHALGGAPGVYSARYAQLAGEPKSDAANNARLVRELAGKADRGAHY- 119

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + V      D       G   G ++  PRG  GFGYDP F      +T  E+T+ E
Sbjct: 120 --VCVLVYVRHADDPQPIIAEGNWFGEVIDTPRGDGGFGYDPYFLLPNLGKTAAELTKAE 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           KN                +SHRA+A    V+   
Sbjct: 178 KNS---------------VSHRAQALAQLVERLR 196


>gi|227544195|ref|ZP_03974244.1| nucleoside-triphosphatase [Lactobacillus reuteri CF48-3A]
 gi|300908190|ref|ZP_07125656.1| nucleoside-triphosphatase [Lactobacillus reuteri SD2112]
 gi|227185831|gb|EEI65902.1| nucleoside-triphosphatase [Lactobacillus reuteri CF48-3A]
 gi|300894617|gb|EFK87973.1| nucleoside-triphosphatase [Lactobacillus reuteri SD2112]
          Length = 195

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 69/213 (32%), Positives = 104/213 (48%), Gaps = 22/213 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IVIA+ N  K  E   ++ PLGI   +  +   I   E G +FEENA IK+ TAA  
Sbjct: 1   MKTIVIATKNAGKAREYQDMLAPLGIEVKTLADFAPIAINENGKTFEENATIKATTAANQ 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +P ++DDSGL++D L G PG+HSAR+A  +    +           L +        R
Sbjct: 61  LQLPVMADDSGLMVDALGGAPGVHSARYAGDHDDAANNAKL-------LLALKEVPDEKR 113

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +AHF + +    PDG     +G+V G I+    G+ GFGYDP+F  +   ++  ++T ++
Sbjct: 114 TAHFHTTIVGIKPDGTKLVANGRVDGHILHQLTGENGFGYDPLFYVDELGKSMAQLTADQ 173

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN                +SHR RA + F+   
Sbjct: 174 KNQ---------------ISHRGRALRSFMKQF 191


>gi|325203730|gb|ADY99183.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis M01-240355]
          Length = 199

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 87/211 (41%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P GI      E ++    E  ++F ENA+ K+  AA+ +G
Sbjct: 7   KIVLASGNAGKLKEFGNLFEPYGITVLPQSEFSIPECPEPYSTFVENALAKARHAAEYSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A SN                              
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGSN-----PKSDTANNLKLAAELAGKADKSCCY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P G+ GFGYDP F   G+ +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGVWHGQWNGVPAGENGFGYDPYFYLPGHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALADLIRKL 197


>gi|300703570|ref|YP_003745172.1| nucleoside-triphosphate diphosphatase [Ralstonia solanacearum
           CFBP2957]
 gi|299071233|emb|CBJ42551.1| Nucleoside-triphosphate diphosphatase [Ralstonia solanacearum
           CFBP2957]
          Length = 206

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 102/217 (47%), Gaps = 19/217 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+AS+N  K+ E  +L+ PLG+  T+  EL +   EE   +F ENA+ K+  A++ A
Sbjct: 7   RRIVLASNNPGKLAEFGTLLAPLGLDVTAQGELGIPEAEEPHVTFVENALAKARHASRLA 66

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSG+    L G PG++SAR+A+     +       ++   L         +  
Sbjct: 67  GLPALADDSGICAHALGGAPGVYSARYAQLAGEPKSDAANNARLVRELAGHADRGAHY-- 124

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
              + V      D       G   G ++  PRG  GFGYDP F      +T  E+++ EK
Sbjct: 125 -VCVLVYVRHADDPQPIIAEGNWFGEVIDTPRGYGGFGYDPHFLLPALGKTAAELSKAEK 183

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           N                +SHRA+A    V+   R+ E
Sbjct: 184 NA---------------VSHRAQALTQLVERL-RLSE 204


>gi|121634431|ref|YP_974676.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria meningitidis FAM18]
 gi|218767772|ref|YP_002342284.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria meningitidis Z2491]
 gi|304388116|ref|ZP_07370242.1| nucleoside-triphosphatase [Neisseria meningitidis ATCC 13091]
 gi|22653775|sp|Q9JVG5|NTPA_NEIMA RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|120866137|emb|CAM09876.1| hypothetical protein NMC0582 [Neisseria meningitidis FAM18]
 gi|121051780|emb|CAM08086.1| hypothetical protein NMA0849 [Neisseria meningitidis Z2491]
 gi|304337886|gb|EFM04029.1| nucleoside-triphosphatase [Neisseria meningitidis ATCC 13091]
 gi|325131911|gb|EGC54611.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis M6190]
 gi|325137962|gb|EGC60537.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis ES14902]
          Length = 199

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 87/211 (41%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P GI      E ++    E  ++F ENA+ K+  AA ++G
Sbjct: 7   KIVLASGNAGKLKEFGNLFEPYGITVLPQSEFSIPECPEPYSTFVENALAKARHAAGHSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A SN                              
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGSN-----PKSDTANNLKLAAELAGKADKSCCY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P G+ GFGYDP F   G+ +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGVWHGQWNGVPAGENGFGYDPYFYLPGHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALAELLRKL 197


>gi|296315012|ref|ZP_06864953.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria polysaccharea ATCC 43768]
 gi|296838214|gb|EFH22152.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria polysaccharea ATCC 43768]
          Length = 199

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 66/211 (31%), Positives = 86/211 (40%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P GI      E  +    E  ++F ENA+ K+  AAK +G
Sbjct: 7   KIVLASGNAGKLKEFGNLFKPYGITVLPQSEFVIPECPEPYSTFVENALAKARHAAKYSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A SN                            S 
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGSN-----PKSDTANNLKLAAELAGKADKSCSY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P GQ GFGYDP F    + +T  E+  E KN
Sbjct: 122 VCVLVFVRHQDDPRPIIAEGVWHGQWNDTPLGQNGFGYDPYFYLPEHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALADLIRKL 197


>gi|307268764|ref|ZP_07550132.1| ribonuclease PH [Enterococcus faecalis TX4248]
 gi|306514892|gb|EFM83439.1| ribonuclease PH [Enterococcus faecalis TX4248]
          Length = 451

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 97/220 (44%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
           E  IVIA+ N  K  E  S+    G    + L+  NL   EETG +FEENA +K+ T A+
Sbjct: 253 EKVIVIATRNPGKAKEFSSIFDEKGYTVKTLLDYPNLPDVEETGRTFEENARLKAETIAE 312

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL++D L G PGI+SAR+A   T +   +         L          
Sbjct: 313 ILQKPVLADDSGLIVDALGGMPGIYSARFAGEPTNDASNNA------KLLHELTGVPKEK 366

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F   L  A P         +  G +   PRG+ GFGYD +F      +T  E++ E
Sbjct: 367 RQARFHCTLVFAEPKKESLVVEAEWPGEVGTIPRGEGGFGYDSLFYVPELGKTAAELSGE 426

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EKN                +SHR +A     +      +K
Sbjct: 427 EKNK---------------VSHRGQAVAKLKEQWEEWLKK 451


>gi|77165902|ref|YP_344427.1| Ham1-like protein [Nitrosococcus oceani ATCC 19707]
 gi|254433793|ref|ZP_05047301.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Nitrosococcus oceani AFC27]
 gi|76884216|gb|ABA58897.1| Ham1-like protein [Nitrosococcus oceani ATCC 19707]
 gi|207090126|gb|EDZ67397.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Nitrosococcus oceani AFC27]
          Length = 200

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 68/206 (33%), Positives = 98/206 (47%), Gaps = 19/206 (9%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           +  + IV+ASHN  K+ EM  ++  L I   S     +    ETG SF ENA++K+  AA
Sbjct: 1   MTSSKIVLASHNQGKLREMSEILNELRIEVISQSAFGVPDAMETGLSFVENALLKARNAA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           ++ G  A++DDSGL +D L G+PGIHSAR+A     ++     ++K+  +L+        
Sbjct: 61  QHTGFAAIADDSGLEVDALGGQPGIHSARYAGPKATDQ---ENLEKLLESLKEAP-EQQF 116

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
                 + V    W D       G   G I+  P+G  GFGYDPIF    +  T  E+  
Sbjct: 117 RARYQCVIVHMHHWRDPTPLICQGTWEGEILLVPQGNGGFGYDPIFYLPEHHCTVAELPP 176

Query: 184 EEKNGGIDSATLFSILSTDLLSHRAR 209
            EKN                LSHR +
Sbjct: 177 AEKN---------------RLSHRGK 187


>gi|154686971|ref|YP_001422132.1| YsnA [Bacillus amyloliquefaciens FZB42]
 gi|154352822|gb|ABS74901.1| YsnA [Bacillus amyloliquefaciens FZB42]
          Length = 195

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 68/214 (31%), Positives = 101/214 (47%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAK 64
               +IA+HN  K+ E   ++ P G   +S  E+      EETG++FEENA++K+   AK
Sbjct: 1   MKEAIIATHNQGKVKEFKEILEPKGYSVSSLAEIGFTEEIEETGHTFEENAILKAEAVAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL +D L G+PG++SAR+A     ++        ++  L      +   
Sbjct: 61  AVNKMVIADDSGLSVDNLGGRPGVYSARYAGEAKDDK------ANMDKVLSELKGIEKEQ 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L+++ P    +   G V G I   P G  GFGYDPIF     D+T  ++T  
Sbjct: 115 RTARFRCALAVSMPGQETKTVEGHVEGYIAEGPEGDNGFGYDPIFIVKDKDKTMAQLTSA 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                +SHRA A K      
Sbjct: 175 EKNK---------------ISHRAEALKKLSKLL 193


>gi|307132434|ref|YP_003884450.1| dITP/XTP pyrophosphatase [Dickeya dadantii 3937]
 gi|306529963|gb|ADM99893.1| dITP/XTP pyrophosphatase [Dickeya dadantii 3937]
          Length = 197

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 101/214 (47%), Gaps = 19/214 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             N+V+A+ N  K+ E+  L+   G+   +   L +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQNVVLATGNAGKVRELAGLLADFGLDVVAQTALGVDSAEETGLTFIENAILKARHAARE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL ++ L G PGI+SAR+A  +  +R     +    +        +    
Sbjct: 61  TGLPAIADDSGLAVNALGGAPGIYSARYAGEDASDRQNLDKLLAALD----NVPDEQRQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           S H + V      D       G   G+I   P G  GFGYDP+F      +T  E++ EE
Sbjct: 117 SFHCVLVYLRHADDPTPLVCHGSWQGVIARTPVGAGGFGYDPVFFVPSIGKTAAELSREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           KN                LSHR +A +  +D   
Sbjct: 177 KNA---------------LSHRGQALRQLLDALR 195


>gi|311741213|ref|ZP_07715037.1| nucleoside-triphosphatase [Corynebacterium pseudogenitalium ATCC
           33035]
 gi|311303383|gb|EFQ79462.1| nucleoside-triphosphatase [Corynebacterium pseudogenitalium ATCC
           33035]
          Length = 202

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 103/217 (47%), Gaps = 25/217 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALEL----NLIIPEETGNSFEENAMIKSLTAAK 64
           I++AS+N  K+ E++ ++   GI       L        P E G +F +NA+IK+   A 
Sbjct: 3   ILVASNNPKKLAELERILADAGIEGVELRPLSAVEPYPEPVEDGRTFADNALIKARAGAA 62

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G   ++DDSGL I+ L+G PG+ SARW+  +  ++  +  +      L          
Sbjct: 63  ATGFATVADDSGLAIEELNGMPGVLSARWSGQHGNDQANNDLV------LAQMADVPDER 116

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+SV +L  PDG      G+  G  +  PRG  GFGYDP+FQP G  R+  EM  E
Sbjct: 117 RAAAFVSVCALVTPDGAEHVAEGRWEGRFLREPRGDNGFGYDPLFQPEGESRSAAEMAPE 176

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EKN                +SHR RA    V     +
Sbjct: 177 EKNA---------------VSHRGRALSQLVPAIAEL 198


>gi|118444944|ref|YP_878896.1| deoxyribonucleotide triphosphate pyrophosphatase [Clostridium novyi
           NT]
 gi|118135400|gb|ABK62444.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Clostridium novyi NT]
          Length = 199

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 66/215 (30%), Positives = 102/215 (47%), Gaps = 23/215 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
              +++AS+N  KI E+  ++    +   S  E+ + I  EE G +F ENA IK+    K
Sbjct: 1   MKKLIVASNNQHKIEEIKEMLKEFDLDVISLKEVGIDIDVEENGTTFAENAHIKAYEIFK 60

Query: 65  NAGM-PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
                  L+DDSGL+++VL+G+PG++SAR+A  +  ++  +      E  L         
Sbjct: 61  IVKDAMVLADDSGLMVEVLNGEPGVYSARYAGEHGNDKKNN------EKLLSKLKEVKFE 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+  + L   +       G+V G I+   RG+ GFGYDP+F    Y +T  EMT 
Sbjct: 115 DRKAKFVCAMELIIDEARTITVQGEVKGYILEEQRGENGFGYDPLFYVPEYKKTTAEMTP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           +EKN                +SHR +A K      
Sbjct: 175 KEKNS---------------ISHRGKALKNLKKVL 194


>gi|313680800|ref|YP_004058539.1| non-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Oceanithermus profundus DSM 14977]
 gi|313153515|gb|ADR37366.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Oceanithermus profundus DSM 14977]
          Length = 203

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 81/211 (38%), Positives = 118/211 (55%), Gaps = 22/211 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +VIA+ N  K  E+   + PLG       +  + +PEETG +FE+NA++K+ T A+  
Sbjct: 1   MQVVIATSNPGKYRELARGLEPLGWELRPLPDFGVELPEETGTTFEDNALMKAATVAQKT 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            +PAL+DDSGLV+D L G+PGI+SAR+             +++            P  R+
Sbjct: 61  RLPALADDSGLVVDALGGEPGIYSARYGGRTNDRDRNVYLLER-------LRGVPPEQRT 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F++VL+LA+PDGHVE++ G+V G+I+  PRG+ GFGYDP+F     +RTF EM  EEK
Sbjct: 114 ARFVAVLALAYPDGHVESYRGEVEGVILEAPRGEGGFGYDPLFYLPELERTFAEMAPEEK 173

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
                             SHRARA    ++ 
Sbjct: 174 ARH---------------SHRARALAKLLEA 189


>gi|270263062|ref|ZP_06191332.1| nucleoside-triphosphatase [Serratia odorifera 4Rx13]
 gi|270042750|gb|EFA15844.1| nucleoside-triphosphatase [Serratia odorifera 4Rx13]
          Length = 197

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+  L+   G+   +  EL +   +ETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNPGKVRELADLLADFGLNVVAQTELGVDSADETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A  +  ++      Q ++  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYAGVDASDQ------QNLDKLLVALKDVPQGSR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G  +G I +   G  GFGYDP+F      RT  E++ 
Sbjct: 115 GAQFHCVLVYMRHAEDPTPLVFHGSWAGEITFESAGAGGFGYDPVFYVPELGRTAAELSR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +EK+                +SHR +A K  ++    
Sbjct: 175 DEKSA---------------VSHRGKALKLMLEAMRN 196


>gi|304317495|ref|YP_003852640.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778997|gb|ADL69556.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 198

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 74/218 (33%), Positives = 105/218 (48%), Gaps = 24/218 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKN 65
             IV+A+HN  K+ E+            SA ++      EETG++ EENA++K+ + A  
Sbjct: 1   MKIVVATHNKHKVDEIREFFKD-DFEVLSADDIGSYDEIEETGDTIEENALLKARSLANL 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                ++DD+GL +D LDGKPG++SAR+A SN    D +         LR         R
Sbjct: 60  TDYIVIADDTGLFVDYLDGKPGVYSARFAGSNATYEDNNR------KLLRLLEGVPIEKR 113

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F +V++L +         GKV G I+  PRGQ GFGYDP+F  +   +T  E+T EE
Sbjct: 114 KATFRTVVALIYKGKETII-EGKVEGTILDSPRGQFGFGYDPVFFVDKVGKTLAELTLEE 172

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           KN                +SHRA A K   +      E
Sbjct: 173 KNE---------------VSHRANALKKLKEYLKNNLE 195


>gi|125972713|ref|YP_001036623.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Clostridium thermocellum ATCC 27405]
 gi|256004872|ref|ZP_05429846.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium thermocellum DSM 2360]
 gi|125712938|gb|ABN51430.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium thermocellum ATCC 27405]
 gi|255991182|gb|EEU01290.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium thermocellum DSM 2360]
 gi|316941051|gb|ADU75085.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium thermocellum DSM 1313]
          Length = 199

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 62/216 (28%), Positives = 100/216 (46%), Gaps = 22/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAK 64
               VIA+ N  K+ E+  ++  L     S  E+ +    EE+G++FEENA+IK+    K
Sbjct: 1   MRKFVIATKNKGKLKEIQEILDGLDFEVVSMEEMGITKDIEESGSTFEENALIKAREVYK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G   ++DDSGL +D L+G PGI+S+R+A     +        +    L          
Sbjct: 61  ACGEIVMADDSGLEVDYLNGAPGIYSSRFAGEGASDE------DRNNKLLSLLKDVPFEQ 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F+ V+++   D       G V G I + P+G  GFGYDP+F    Y+ T  +M   
Sbjct: 115 RKARFVCVIAVILSDEEYFTVRGTVEGYIGFEPKGDNGFGYDPLFFIPEYNMTAAQMKPS 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +K+                +SHR +A +  ++   +
Sbjct: 175 KKHE---------------ISHRGKAMRMMLEELKK 195


>gi|313887976|ref|ZP_07821654.1| non-canonical purine NTP pyrophosphatase RdgB [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312845931|gb|EFR33314.1| non-canonical purine NTP pyrophosphatase RdgB [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 194

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 105/218 (48%), Gaps = 26/218 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN--LIIPEETGNSFEENAMIKSLTAA 63
              IV+++ N +K+ E+  ++  L I      ++        E G +  +NA+ K+   A
Sbjct: 1   MKKIVLSTDNKNKLREIREILEDLDIEIFGKSDIEGLDFEVIEDGETLYDNALKKADAMA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +   +  L+DD+GL ++ L G+PG+HSAR+      E D     +K+ N L+        
Sbjct: 61  RRVDLAVLADDTGLFVNALKGEPGVHSARY----ASEHDDKKNREKLLNNLKD-----KE 111

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            RSA+F + + L   + ++    G   G I    RG  GFGYD IF P+G+D+TF EM+ 
Sbjct: 112 DRSAYFKTQIILIDSEKNIIPIEGVCQGRISEVERGDNGFGYDSIFIPDGFDKTFAEMSH 171

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EEKN                +SHRARA K   +    +
Sbjct: 172 EEKNE---------------ISHRARALKNLKEKLENL 194


>gi|295695310|ref|YP_003588548.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bacillus tusciae DSM 2912]
 gi|295410912|gb|ADG05404.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bacillus tusciae DSM 2912]
          Length = 207

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 72/219 (32%), Positives = 107/219 (48%), Gaps = 21/219 (9%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              +V+A+HN  K+ E   ++ PLG            + P ETG +F ENA+IK+  AA+
Sbjct: 1   MYTVVLATHNKGKVREFREMLRPLGWDVFPLSAFPGYVPPPETGATFCENALIKARDAAE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PAL+DDSGL ++ L+G+PG+ SAR+A     + + +  +           +  P  
Sbjct: 61  RLGLPALADDSGLEVEALEGRPGVFSARFAGPGATDEENNRLLLAELER-----SPAPPP 115

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
            +A F+  L+   P G    F G+  G I+  PRG  GFGYDP+F      +TFGE   E
Sbjct: 116 WAARFVCCLAWVEPSGETHTFHGETRGWILAQPRGSGGFGYDPLFWSPELQQTFGEAPPE 175

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
            KN                +SHR RA +  V    R ++
Sbjct: 176 AKN---------------RVSHRKRALEALVQALSRPEK 199


>gi|240144027|ref|ZP_04742628.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Roseburia intestinalis L1-82]
 gi|257204068|gb|EEV02353.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Roseburia intestinalis L1-82]
 gi|291534896|emb|CBL08008.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Roseburia intestinalis M50/1]
          Length = 198

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 61/214 (28%), Positives = 98/214 (45%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAK 64
            N I+ A+ N  K+ E+  ++  +     S  E  +     E G +FEENA IK+   A+
Sbjct: 1   MNRIIFATGNAGKMKEIREILGDMDAEILSMKEAGIQTDIVENGTTFEENARIKAKAVAQ 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 L+DDSGL +D L+ +PG++SAR+   +T     + A+                 
Sbjct: 61  FTKDIVLADDSGLEVDYLNKEPGVYSARYMGEDTSYTIKNQAILDRLK------GVPKEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+  ++ A P+G V      + G I   P G  GFGYDPIF  + +  +  E+TE+
Sbjct: 115 RTARFVCAIAAAMPNGDVLVTRETIEGYIGEKPAGSNGFGYDPIFYVDEFGCSTAELTEK 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           +KN                +SHR +A +   +  
Sbjct: 175 QKNQ---------------ISHRGKALRAMKEKL 193


>gi|148652120|ref|YP_001279213.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Psychrobacter sp. PRwf-1]
 gi|148571204|gb|ABQ93263.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Psychrobacter sp. PRwf-1]
          Length = 217

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 67/211 (31%), Positives = 98/211 (46%), Gaps = 17/211 (8%)

Query: 10  VIASHNVDKIHEMDSLI--MPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
           V+AS+N  K+ E   L     L I      ELN+    E G SF ENA+IK+  A++ +G
Sbjct: 19  VLASNNQGKLSEFKRLFGAAKLNIDIVPQGELNIEDAVEDGLSFIENAIIKARHASRISG 78

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PA++DDSGL + VL   PGI+SAR+A  +  + + +  +      LR K  + P     
Sbjct: 79  LPAIADDSGLCVPVLGNAPGIYSARYAGEHGNDANNNTKLLADLLPLRHKNPNAPITAYF 138

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             +  L     D       G   G I+  P+G+ GFGYDP+F       T  +M  E+KN
Sbjct: 139 VCVLALVRHADDPLPIIAQGLWQGEILEAPQGEHGFGYDPLFWVPELKLTAAQMPAEQKN 198

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                           +SHR RA +  +   
Sbjct: 199 A---------------ISHRGRAMQSLLQQL 214


>gi|296127249|ref|YP_003634501.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brachyspira murdochii DSM 12563]
 gi|296019065|gb|ADG72302.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brachyspira murdochii DSM 12563]
          Length = 197

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 73/217 (33%), Positives = 113/217 (52%), Gaps = 23/217 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           + N +VIA+ N  K+ E++ +     I     +  ++    E GN+F +N++IK+     
Sbjct: 1   MLNKLVIATSNKHKLKEIEDIFKGRAIKEILPMPKDIGEIIEDGNTFIKNSIIKAKAVYN 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
              +P+L+DDSGL ++ L+G+PGI SAR+   N G ++           +  +   D + 
Sbjct: 61  FTKLPSLADDSGLCVNALEGRPGIFSARYGGENLGYKEK--------MHMLLEELKDKSD 112

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           RSA+FI+       D +     G+V+GII+  PRG  GFGYDPIFQP+GY+ T+ EM+ E
Sbjct: 113 RSAYFITSAVCVLDDNYYIAVEGRVNGIIIDNPRGFDGFGYDPIFQPDGYNVTYAEMSLE 172

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EKN                +SHR+ A     D  L I
Sbjct: 173 EKNS---------------MSHRSIAMNKMKDILLSI 194


>gi|325662572|ref|ZP_08151172.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471069|gb|EGC74295.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 202

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 72/221 (32%), Positives = 110/221 (49%), Gaps = 22/221 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAA 63
           +E  I+ A+ N DK+ E+  ++  LGI+ +S  E  +     E G +FEENAMIK+   A
Sbjct: 1   MERKIIFATGNQDKMKEIRMILEDLGIVVSSMKEAGIDVDIVEDGTTFEENAMIKAEAIA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K      L+DDSGL ID L+ +PGI+SAR+A ++T     +  +      L+        
Sbjct: 61  KLTDAIVLADDSGLEIDYLNKEPGIYSARYAGTDTSYEIKNNLL------LQRLEGVPDE 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+  ++  +PDG  E   G + G I +   G+ GFGYDPIF    Y  T  E+  
Sbjct: 115 KRTARFVCAIAAVFPDGSKETVRGTIEGRIGYEIAGEHGFGYDPIFYLPEYGCTTAELDP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           E+KN                LSHR +A +   +   +  ++
Sbjct: 175 EKKNE---------------LSHRGKALRLMREIIEQKMQQ 200


>gi|281416901|ref|ZP_06247921.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium thermocellum JW20]
 gi|281408303|gb|EFB38561.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Clostridium thermocellum JW20]
          Length = 199

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 62/216 (28%), Positives = 100/216 (46%), Gaps = 22/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAK 64
               VIA+ N  K+ E+  ++  L     S  E+ +    EE+G++FEENA+IK+    K
Sbjct: 1   MRKFVIATKNKGKLKEIQEILDGLDFEVVSMEEMGITKDIEESGSTFEENALIKAREVYK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G   ++DDSGL +D L+G PGI+S+R+A     +        +    L          
Sbjct: 61  ACGEIVMADDSGLEVDYLNGAPGIYSSRFAGEGASDE------DRNNKLLSLLKDVPFEQ 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F+ V+++   D       G V G I + P+G  GFGYDP+F    Y+ T  +M   
Sbjct: 115 RKARFVCVIAVILSDEEYFTVRGTVEGYIGFEPKGDNGFGYDPLFFIPEYNMTVAQMKPS 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +K+                +SHR +A +  ++   +
Sbjct: 175 KKHE---------------ISHRGKAMRMMLEELKK 195


>gi|188586563|ref|YP_001918108.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|226737268|sp|B2A6I7|NTPA_NATTJ RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|179351250|gb|ACB85520.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 201

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 74/213 (34%), Positives = 113/213 (53%), Gaps = 22/213 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKN 65
             +V+AS N  K++E+ +L+    +   S  + N +   +ETG +F ENA+IK+   A +
Sbjct: 1   MKLVLASGNQGKLNELKALLSKQPVEIYSMSDFNNIKEAQETGKTFAENAIIKAQNVADS 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  +L+DDSGL +D LDG PG++SAR+A  N  ++D +         LRS        R
Sbjct: 61  TGYLSLADDSGLEVDALDGAPGVYSARYAGENACDQDNN------NKLLRSLKDIPYKQR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F  V+++A+PD     F+G   G I+  P+G  GFGYDP+F      +TFGE+ +EE
Sbjct: 115 TARFKCVIAIAYPDTPPVTFTGTCEGYILREPKGDRGFGYDPLFYHPDMGKTFGELYQEE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           K                 +SHR +A +  V N 
Sbjct: 175 K---------------SSISHRGKALEKLVANF 192


>gi|170718312|ref|YP_001785324.1| deoxyribonucleotide triphosphate pyrophosphatase [Haemophilus
           somnus 2336]
 gi|168826441|gb|ACA31812.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Haemophilus somnus 2336]
          Length = 198

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 101/217 (46%), Gaps = 21/217 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  AAK
Sbjct: 1   MKQKIVLATANPGKVKEMADVLSEFGFDVVAQKDLGIDSPEETGLTFVENALLKARYAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+ VL+G PG++SAR+     G  D D   +  E  L          
Sbjct: 61  MSGLPAIADDSGLVVPVLNGAPGLYSARY----AGVEDKDAEQKNREKLLAELANVPVNE 116

Query: 125 RSAHF--ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F    V+     D       G+  GII +   G  GF YD +F       TF E+ 
Sbjct: 117 RHAKFVSCIVMLQHDTDPSPIIAEGECHGIIAFSESGSNGFAYDSLFFYPETGCTFAELE 176

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             EK                 +SHRA+A     +   
Sbjct: 177 TSEKKK---------------ISHRAKALAVLKERLK 198


>gi|149927823|ref|ZP_01916074.1| Ham1-like protein [Limnobacter sp. MED105]
 gi|149823445|gb|EDM82676.1| Ham1-like protein [Limnobacter sp. MED105]
          Length = 209

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 63/220 (28%), Positives = 95/220 (43%), Gaps = 19/220 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            +  V+AS N  K+ E   L  P G+   +  EL +   EE  ++F ENA+ K+  A++ 
Sbjct: 4   NSEWVLASGNKGKLREFQDLFAPWGVNWLAQGELGVPDAEEPFHTFVENALTKARHASRL 63

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G PAL+DDSGL +  + G PG+ SAR+A     E+        +   L+        F 
Sbjct: 64  TGRPALADDSGLCVPAIAGAPGVLSARYATLFGQEKSDANNNACLVEKLKGIEDRRAYFV 123

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A      +    D           G ++  P+G  GFGYDP+F    +  T  +M +E 
Sbjct: 124 CAMVWVAHAD---DPTPTIAQKMWWGEVIDVPQGDHGFGYDPLFWLPEHQCTAAQMPKEL 180

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC-LRIDEK 224
           KN                 SHRA+A +  +     R+D K
Sbjct: 181 KNK---------------FSHRAQATQALLQELQQRLDLK 205


>gi|330997279|ref|ZP_08321132.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Paraprevotella xylaniphila YIT 11841]
 gi|329571074|gb|EGG52781.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Paraprevotella xylaniphila YIT 11841]
          Length = 195

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 68/218 (31%), Positives = 103/218 (47%), Gaps = 27/218 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTA 62
           +   +V  ++N  K+ E+ +++    I   S  ++     IPE T ++ E NA  KS   
Sbjct: 1   MRKRLVFVTNNAHKLEEIRTILGER-IEILSLSDIGCHADIPE-TADTLEGNARQKSRYV 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            ++ G+   +DD+GL ++ L G PG++SAR+A     +      M K+   +        
Sbjct: 59  YEHYGLDCFADDTGLEVESLGGAPGVYSARYAGRQGHDSQ--ANMNKLLKEMEE-----K 111

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F +++SL    G    F G V G I    RG+ GFGYDPIFQP+GYD TF E+ 
Sbjct: 112 NNRKAQFRTIISL-IEKGEERQFEGIVKGQITKEKRGESGFGYDPIFQPDGYDTTFAELG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            + KN                +SHRARA     D   +
Sbjct: 171 SDIKN---------------RISHRARAVAALCDYLTK 193


>gi|241767032|ref|ZP_04764817.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Acidovorax delafieldii 2AN]
 gi|241362435|gb|EER58379.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Acidovorax delafieldii 2AN]
          Length = 199

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 62/214 (28%), Positives = 99/214 (46%), Gaps = 18/214 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E+ +++ PLG+      +L +   EE   +F ENA+ K+  AA++ 
Sbjct: 1   MKLVLASNNRGKLSELQAMLAPLGVELVRQADLGVGEAEEPHRTFVENALAKARFAAQHT 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DD+GL +D   G PG+ +A +A     E+  D  ++ +   ++       A  S
Sbjct: 61  GLPALADDAGLCVDAFGGLPGVDTAYYATQFGYEKGDDTNVRALLEQMQGHDNRRAAMVS 120

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
                V   +  D       G+V G I   PRG  GFG+DP+     + +TF E+  E K
Sbjct: 121 ---TLVAVRSPQDPEPLIAVGRVVGEITREPRGSNGFGFDPVMFIPEFGKTFAELPPEVK 177

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           N                 SHR RA    +     
Sbjct: 178 NAH---------------SHRGRAALQMLALMRE 196


>gi|291539458|emb|CBL12569.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Roseburia intestinalis XB6B4]
          Length = 198

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 61/214 (28%), Positives = 97/214 (45%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAK 64
            N I+ A+ N  K+ E+  ++  +     S  E  +     E G +FEENA IK+   A 
Sbjct: 1   MNRIIFATGNAGKMKEIREILGDMDAEILSMKEAGIQTDIVENGTTFEENARIKAKAVAH 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 L+DDSGL +D L+ +PG++SAR+   +T     + A+                 
Sbjct: 61  FTKDIVLADDSGLEVDYLNKEPGVYSARYMGEDTSYTIKNQAILDRLK------GVPKEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+  ++ A P+G V      + G I   P G  GFGYDPIF  + +  +  E+TE+
Sbjct: 115 RTARFVCAIAAAMPNGDVLVTRETIEGYIGEKPAGSNGFGYDPIFYVDEFGCSTAELTEK 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           +KN                +SHR +A +   +  
Sbjct: 175 QKNQ---------------ISHRGKALRAMKEKL 193


>gi|268608885|ref|ZP_06142612.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Ruminococcus flavefaciens FD-1]
          Length = 190

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 68/215 (31%), Positives = 99/215 (46%), Gaps = 29/215 (13%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAA 63
           +   +V+A++N +K+ E   ++ PLGI   S  E      PEE G +F ENAMIK+    
Sbjct: 1   MNKKLVMATNNANKLREAREILAPLGIEVISQREAGADCEPEENGTTFAENAMIKAKAVY 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
               +P ++DDSGL ++ LDG+PG++SAR+A             Q+ +  L         
Sbjct: 61  DIVKLPTIADDSGLCVNALDGRPGVYSARYAPKG----------QECQKLLEEMKDVPDD 110

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F   ++    +      +G   G I    RG  GFGYDP+F     DRT  E+T 
Sbjct: 111 RRTASFQCTIAYIDENEVKTM-NGGCIGRIGHEMRGTNGFGYDPVFMV--GDRTMAELTA 167

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           +EKN                +SHR  A K   D  
Sbjct: 168 DEKNA---------------ISHRGAALKALFDYL 187


>gi|300718249|ref|YP_003743052.1| deoxyribonucleoside triphosphate pyrophosphatase [Erwinia
           billingiae Eb661]
 gi|299064085|emb|CAX61205.1| putative deoxyribonucleoside triphosphate pyrophosphatase [Erwinia
           billingiae Eb661]
          Length = 197

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 72/217 (33%), Positives = 102/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ EM  L+   G+   +  EL +   EETG +F ENA++K+  AA  
Sbjct: 1   MQKVVLATGNPGKVREMADLLAAFGLDIVAQTELGVESAEETGLTFIENAILKARHAAAI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A  +  +R      Q +   L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYAGEDASDR------QNLLKLLAALENVPDDKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G   G I     G+ GFGYDPIF      +T GEMT+
Sbjct: 115 QAQFHCVLVYLRHAEDPTPLVFHGSWQGEITRSAVGEGGFGYDPIFFVPKLGKTAGEMTK 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            EK+                +SHR +A    ++    
Sbjct: 175 AEKHA---------------VSHRGKAMTLLLEAMRN 196


>gi|261380180|ref|ZP_05984753.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria subflava NJ9703]
 gi|284797027|gb|EFC52374.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria subflava NJ9703]
          Length = 197

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 62/217 (28%), Positives = 87/217 (40%), Gaps = 20/217 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   IV+AS N  K+ E   L   L I      + N     E  ++F ENA+ K+  AAK
Sbjct: 1   MFEKIVLASGNAGKLKEFSRLFADLNIEVLPQSQFNTPECPEPYHTFVENALAKARHAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PAL+DDSG+  + L+G PGI SAR+A  N      D A     +A  +       +
Sbjct: 61  YSGLPALADDSGICTNALNGAPGIFSARYAGENP---KSDAANNAKLSADLADKDDKSCY 117

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                + V              G   G       G  GFGYDP F    +  T  E+  E
Sbjct: 118 YVCVLVLVRHEND--PQPIIAEGIWRGQWQAEAAGTNGFGYDPHFYLAEHGCTAAELDPE 175

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            KN                 SHRA+A +  +     +
Sbjct: 176 IKNAE---------------SHRAQALRELLRKIESL 197


>gi|311106531|ref|YP_003979384.1| nucleoside-triphosphatase [Achromobacter xylosoxidans A8]
 gi|310761220|gb|ADP16669.1| nucleoside-triphosphatase [Achromobacter xylosoxidans A8]
          Length = 207

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 103/214 (48%), Gaps = 22/214 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E  +L  PLG+      EL +   EE   +F ENA+ K+  A++  
Sbjct: 11  RRVVLASNNPGKLREFSALFAPLGMELVPQGELGVPEAEEPHVTFVENALAKARHASRLT 70

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +  L G PG++SAR+A+ + GE+          N L  +     A RS
Sbjct: 71  GLPALADDSGLCVAALGGAPGVYSARYAKMHGGEKSDQAN-----NELLVRKLAGVADRS 125

Query: 127 AHFISVLSLAW--PDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           A +++VL+L     D       G   G I+  P G  GFGYDP F       T   +  E
Sbjct: 126 AWYVAVLALVRAENDPRPLIGEGLWHGEIIDQPEGANGFGYDPHFYLPDQALTAAALDPE 185

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                LSHRARA +  +   
Sbjct: 186 EKN---------------RLSHRARALRELLSKL 204


>gi|291521954|emb|CBK80247.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Coprococcus catus GD/7]
          Length = 202

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 97/214 (45%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAK 64
              I+ A+ N +K+ E+  ++    +   S  E  +    +E G+SFEENA IK+    +
Sbjct: 1   MQRIIFATTNENKMKEIREILADFPVEILSLKEAGIQADIDENGSSFEENAAIKAEAIER 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G   L+DDSGL ID L+G+PGI+SAR+    T     +  + +               
Sbjct: 61  MTGAIVLADDSGLEIDYLNGEPGIYSARYMGEETSYHIKNANLIERL------AGVPDEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+  ++ A+PD   E   G + G I +   G+ GFGYDPIF    Y  T   M+ E
Sbjct: 115 RTARFVCCVAAAFPDRKTEVVRGTIEGRIGYKEEGKNGFGYDPIFYVPEYGCTTASMSSE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            KN                +SHR +A +      
Sbjct: 175 TKNA---------------ISHRGKALQLIKPVI 193


>gi|39996893|ref|NP_952844.1| nucleoside-triphosphatase [Geobacter sulfurreducens PCA]
 gi|62900242|sp|Q74C80|NTPA_GEOSL RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|39983781|gb|AAR35171.1| HAM1 protein [Geobacter sulfurreducens PCA]
 gi|298505906|gb|ADI84629.1| xanthosine/inosine triphosphate pyrophosphohydrolase, HAM1
           domain-containing [Geobacter sulfurreducens KN400]
          Length = 199

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 72/214 (33%), Positives = 107/214 (50%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              +V+A+ N  K+ E+ +++  L     S  +  +    EE G +FEENA+ K+  AA 
Sbjct: 1   MTRLVVATRNKGKLREIAAILDGLPFTLLSLEDFPDFPEVEEDGKTFEENALKKASVAAN 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PAL+DDSGLV+D LDGKPG++SAR++  N  +   +         L    +     
Sbjct: 61  ITGLPALADDSGLVVDALDGKPGVYSARYSGENASDEANNA------KLLSELESVPYEE 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   ++L  P G    FSG++ G+I+  PRG  GFGYDP+F  +    T  E+  E
Sbjct: 115 RTAAFRCTIALCSPGGKRYTFSGELHGVILDSPRGTGGFGYDPLFFVSEKGATMAELPLE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            KN                +SHR RA     D+ 
Sbjct: 175 AKNA---------------VSHRGRALALLKDHL 193


>gi|288553635|ref|YP_003425570.1| non-canonical purine NTP pyrophosphatase [Bacillus pseudofirmus
           OF4]
 gi|288544795|gb|ADC48678.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
           [Bacillus pseudofirmus OF4]
          Length = 195

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 70/214 (32%), Positives = 107/214 (50%), Gaps = 22/214 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAA 63
           ++N  +IA+ N  K+ E + +    G   TS LE + +   EETG +F ENA +K+ T A
Sbjct: 1   MKNQFIIATKNKGKVREFEQMFAHDGYQVTSLLEYDEIPDIEETGKTFAENAALKAETLA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K      ++DDSGLVID LDG+PG++SAR+A     ++  +      E  L         
Sbjct: 61  KALNQKVIADDSGLVIDALDGRPGVYSARYAGEEKSDKANN------EKVLNEMKDIPSE 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+  +++A P        G   GII   P G  GFGYDPI    G+++T  +++ 
Sbjct: 115 DRTARFVCTIAVASPGEPTYVVEGTCEGIIALEPAGANGFGYDPIMFLPGFNKTMAQLSA 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           +EKN                +SHRA+A +  +  
Sbjct: 175 QEKNQ---------------ISHRAKALEKLMKQ 193


>gi|271501908|ref|YP_003334934.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Dickeya
           dadantii Ech586]
 gi|270345463|gb|ACZ78228.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Dickeya
           dadantii Ech586]
          Length = 197

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 102/214 (47%), Gaps = 19/214 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             N+V+A+ N  K+ E+  L+   G+   +   L +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQNVVLATGNAGKVRELAGLLADFGLDVVAQTTLGVDSAEETGLTFIENAILKARHAARA 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL ++ L G PGI+SAR+A  +  ++     +  + +        +    
Sbjct: 61  TGLPAIADDSGLAVNALGGAPGIYSARYAGEDASDQQNLDKLLAVLD----NVPDEQRQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           S H + V      D       G   G+I   P G+ GFGYDP+F      +T  E++ EE
Sbjct: 117 SFHCVLVYLRHADDPTPLVCHGSWQGVITRAPVGEGGFGYDPVFFVPQLGKTAAELSREE 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           KN                 SHR +A +  +D   
Sbjct: 177 KNAH---------------SHRGQALRQLLDALR 195


>gi|95929459|ref|ZP_01312202.1| Ham1-like protein [Desulfuromonas acetoxidans DSM 684]
 gi|95134575|gb|EAT16231.1| Ham1-like protein [Desulfuromonas acetoxidans DSM 684]
          Length = 195

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 63/216 (29%), Positives = 103/216 (47%), Gaps = 22/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             +V+A+ N  K+ E+  ++   GI         +L+  +E G +F +NA  K+L  A+ 
Sbjct: 1   MQLVVATQNQGKLKEIRRVLADCGIEVVGMDSFADLVPAQEDGETFADNAHKKALAIARQ 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            GM  L+DDSGL +  LDG+PG++SAR+A   + +   +  +      +          R
Sbjct: 61  TGMLCLADDSGLTVAALDGRPGVYSARYAGEGSTDAQNNALL------IEELAGVPEPRR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F  V++L  PD   + F G++ G I+   +GQ GFGYDP+F    +  T  E+  +E
Sbjct: 115 QAAFWCVMALCTPDDDCQLFEGRIEGRILDQAQGQGGFGYDPLFFVESHGCTMAELPLDE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           KN                +SHR +A +  V     +
Sbjct: 175 KN---------------RISHRGQALQKVVAALKSL 195


>gi|163813945|ref|ZP_02205339.1| hypothetical protein COPEUT_00098 [Coprococcus eutactus ATCC 27759]
 gi|158450815|gb|EDP27810.1| hypothetical protein COPEUT_00098 [Coprococcus eutactus ATCC 27759]
          Length = 200

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 69/220 (31%), Positives = 106/220 (48%), Gaps = 24/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALE--LNLIIPEETGNSFEENAMIKSLTAA 63
            + ++ A+ N  K+ E+  ++  LG    S  E  +N+ I E  G +FEENA+IK+   +
Sbjct: 1   MDKLIFATGNEGKMKEVRMILADLGYEIQSMKEAGINVDIVE-DGKTFEENALIKARAIS 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G   L+DDSGL +D +D  PGI+SAR+   +T  R  +  +      +        +
Sbjct: 60  KETGCLVLADDSGLEVDYMDKAPGIYSARFLGEDTSYRIKNQYI------IDKLAGVPDS 113

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+  ++  +PDG      G + GII +  RG+ GFGYDPIF      +T  E+  
Sbjct: 114 ERTARFVCAIAAVFPDGSEYTTRGTIEGIIGYEERGENGFGYDPIFFLPEKGKTTAELDP 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EEKN                +SHR  A +   D   +  E
Sbjct: 174 EEKNE---------------ISHRGNALRLMKDVIRKHRE 198


>gi|329121124|ref|ZP_08249755.1| ribonuclease PH/Ham1 protein [Dialister micraerophilus DSM 19965]
 gi|327471286|gb|EGF16740.1| ribonuclease PH/Ham1 protein [Dialister micraerophilus DSM 19965]
          Length = 195

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 70/216 (32%), Positives = 109/216 (50%), Gaps = 22/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKN 65
             IV+A+ N  KI E   +   LG    +  ++  +  PEETG +FEENA+ K+   +K 
Sbjct: 1   MKIVLATKNKGKIKEFKKVFSELGWEAVAISDIAYVKEPEETGKTFEENAINKAKYYSKA 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             MP L+DDSG++ DVL  +PGI+SAR+A  +  ++  +  +       +         R
Sbjct: 61  VSMPVLADDSGIIADVLKDRPGIYSARYAGVHGDDKANNSKLVDKLRLYKENE------R 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           S +++ V++L WP+G V    GK  GII     G+ GFGYDP+F       T  ++T EE
Sbjct: 115 SGYYMCVIALVWPNGKVITAQGKCEGIIRDFEEGENGFGYDPLFYLPEKKCTMAQLTLEE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           KN                +SHR +A K  ++   ++
Sbjct: 175 KNK---------------ISHRGKAIKNLIEKLKKL 195


>gi|319410023|emb|CBY90357.1| putative HAM1-like protein [Neisseria meningitidis WUE 2594]
          Length = 199

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 63/211 (29%), Positives = 86/211 (40%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS NV K+ E  +L  P GI      E  +    E  ++F ENA+ K+  AA+ +G
Sbjct: 7   KIVLASGNVGKLEEFGNLFKPYGITVLPQSEFGIPECPEPYSTFVENALAKARHAAEYSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A  +                              
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGDH-----PKSDTANNLKLAAELVGKADKSCCY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P G+ GFGYDP F   G+ +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGVWHGQWNGVPAGENGFGYDPYFYLPGHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALAELLRKL 197


>gi|186475432|ref|YP_001856902.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Burkholderia phymatum STM815]
 gi|184191891|gb|ACC69856.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Burkholderia phymatum STM815]
          Length = 207

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 93/214 (43%), Gaps = 18/214 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV+AS+N  K+ E  +L    GI       LN+   EE   +F ENA+ K+  A+K  
Sbjct: 10  RKIVLASNNAGKLREFAALFGTAGIELIPQGALNVPEAEEPHPTFVENALTKARHASKLT 69

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PA++DDSGL +  L G PG++SAR+A+   GE+       ++   L+        +  
Sbjct: 70  GLPAIADDSGLCVRALRGAPGVYSARYAQLAGGEKSDAANNARLVEQLKDTSDRRAYYF- 128

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
              +  L     D       G+  G ++  PRG+ GFGYDP F     + T  E+    K
Sbjct: 129 --CVLALVRHAGDPEPLIAEGRWHGEMLDAPRGKNGFGYDPYFFLPALNATAAELEPAVK 186

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           N                 SHRA A +        
Sbjct: 187 NAT---------------SHRALALQQLFARLKE 205


>gi|269128061|ref|YP_003301431.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermomonospora curvata DSM 43183]
 gi|268313019|gb|ACY99393.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermomonospora curvata DSM 43183]
          Length = 205

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 109/218 (50%), Gaps = 19/218 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              IV+A+ N  K+ E+  ++   GI      E  +    +ET  +F  NA++K+   A 
Sbjct: 1   MTKIVLATRNFGKVAELRRILG--GIEVVGLEEFPDAPDVQETEPTFAGNALLKARAIAA 58

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           + G+PA++DDSGL +D L+G PG+ SARW+    G+   D     +E  L       P  
Sbjct: 59  HTGLPAIADDSGLCVDALNGMPGVLSARWSGRF-GQAAGDKDRANLELVLDQLADVPPER 117

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R AHF   ++L  P G      G+++G I+  PRG+ GFGYDPIF P+G  RT  E++ +
Sbjct: 118 RGAHFACAVALVTPGGIERIVEGRMTGRIIDRPRGEGGFGYDPIFVPDGGTRTSAELSPQ 177

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           EK               D +SHR +A +   +    + 
Sbjct: 178 EK---------------DAVSHRGKALRALAEILPEVL 200


>gi|295677345|ref|YP_003605869.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Burkholderia sp. CCGE1002]
 gi|295437188|gb|ADG16358.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Burkholderia sp. CCGE1002]
          Length = 220

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 98/217 (45%), Gaps = 18/217 (8%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           +    +V+AS+N  K+ E  +L+   GI      ELN+   EE   +F ENA+ K+  AA
Sbjct: 20  MPLKKVVLASNNAGKLREFAALLGAAGIELIPQGELNVPEAEEPHPTFVENALAKARHAA 79

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G+PAL+DDSGL +  L G PG++SAR+A+   GE+       ++   LRS       
Sbjct: 80  KLTGLPALADDSGLCVRALRGAPGVYSARFAQLAGGEKSDAANNARLVEELRSASDRRGY 139

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +     +  L     D       G+  G I+  PRG+ GFGYDP F     + +  E+  
Sbjct: 140 YY---CVLALVRHADDPEPLIAEGRWHGEILDAPRGEHGFGYDPYFYLPSLNASAAELEP 196

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             KN                 SHRA A +  +     
Sbjct: 197 AVKNAS---------------SHRAIALRQLLARLSE 218


>gi|197304059|ref|ZP_03169087.1| hypothetical protein RUMLAC_02792 [Ruminococcus lactaris ATCC
           29176]
 gi|197296866|gb|EDY31438.1| hypothetical protein RUMLAC_02792 [Ruminococcus lactaris ATCC
           29176]
          Length = 204

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 70/218 (32%), Positives = 98/218 (44%), Gaps = 23/218 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSL-TA 62
           ++  I+ A+ N +K+ E+  ++  LG+   S  E  +    EE G SFEENA IK+   +
Sbjct: 1   MKKRIIFATGNENKMKEIRMILADLGLEILSMKEAGVFEEIEEDGMSFEENAEIKARAIS 60

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
                   L+DDSGL ID LD  PGI+SAR+A  +T     +  +      L        
Sbjct: 61  RVMTNDIVLADDSGLEIDYLDKAPGIYSARFAGEDTSYDIKNRIL------LDRLEGVPD 114

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F+  ++  +PDG V+     + G I     G+ GFGYDPIF    Y  T  EMT
Sbjct: 115 EERRARFVCAVAAVFPDGTVKVVRETIEGQIAHEIVGENGFGYDPIFYVPEYGCTTAEMT 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            E KN                LSHR +A +        
Sbjct: 175 PELKNE---------------LSHRGKALRAMKKILEE 197


>gi|91784889|ref|YP_560095.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Burkholderia xenovorans LB400]
 gi|91688843|gb|ABE32043.1| Ham1-like protein [Burkholderia xenovorans LB400]
          Length = 215

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 67/214 (31%), Positives = 99/214 (46%), Gaps = 18/214 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E  +L+   GI   +  ELN+   EE   +F ENA+ K+  AAK  
Sbjct: 18  KKVVLASNNAGKLREFAALLGAAGIELIAQGELNVPEAEEPHPTFVENALAKARHAAKLT 77

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +  L G PG++SAR+A+   GE+        + +ALR +      +  
Sbjct: 78  GLPALADDSGLCVRALGGAPGVYSARYAQLAGGEKSDAANNAHLMSALRGETDRRAYYF- 136

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
              +  L     D       G+  G ++  PRG  GFGYDP F     + +  E+    K
Sbjct: 137 --CVLALVRHADDPEPLIAEGRWHGEMLDAPRGTHGFGYDPYFFLPALNASAAELDPAVK 194

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           N G               SHRA A +  +     
Sbjct: 195 NAG---------------SHRAIALRQLLARLTE 213


>gi|148543777|ref|YP_001271147.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Lactobacillus reuteri DSM 20016]
 gi|184153183|ref|YP_001841524.1| xanthosine triphosphate pyrophosphatase [Lactobacillus reuteri JCM
           1112]
 gi|227363243|ref|ZP_03847375.1| nucleoside-triphosphatase [Lactobacillus reuteri MM2-3]
 gi|325682149|ref|ZP_08161667.1| ribonuclease PH/Ham1 protein [Lactobacillus reuteri MM4-1A]
 gi|148530811|gb|ABQ82810.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Lactobacillus reuteri DSM 20016]
 gi|183224527|dbj|BAG25044.1| xanthosine triphosphate pyrophosphatase [Lactobacillus reuteri JCM
           1112]
 gi|227071699|gb|EEI09990.1| nucleoside-triphosphatase [Lactobacillus reuteri MM2-3]
 gi|324978793|gb|EGC15742.1| ribonuclease PH/Ham1 protein [Lactobacillus reuteri MM4-1A]
          Length = 195

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 69/213 (32%), Positives = 104/213 (48%), Gaps = 22/213 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IVIA+ N  K  E   ++ PLGI   +  +   I   E G +FEENA IK+ TAA  
Sbjct: 1   MKTIVIATKNTGKAREYQEMLAPLGIEVKTLADFAPITINENGKTFEENATIKATTAANQ 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +P ++DDSGL++D L G PG+HSAR+A  +    +           L +        R
Sbjct: 61  LQLPVMADDSGLMVDALGGAPGVHSARYAGDHDDAANNAKL-------LLALKEVPDEKR 113

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +AHF + +    PDG     +G+V G I+    G+ GFGYDP+F  +   ++  ++T ++
Sbjct: 114 TAHFHTTIVGIKPDGTKLVANGRVDGHILHQLTGKNGFGYDPLFYVDELGKSMAQLTADQ 173

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN                +SHR RA + F+   
Sbjct: 174 KNQ---------------ISHRGRALRSFMKQF 191


>gi|313891750|ref|ZP_07825355.1| non-canonical purine NTP pyrophosphatase RdgB [Dialister
           microaerophilus UPII 345-E]
 gi|313119744|gb|EFR42931.1| non-canonical purine NTP pyrophosphatase RdgB [Dialister
           microaerophilus UPII 345-E]
          Length = 195

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 70/216 (32%), Positives = 109/216 (50%), Gaps = 22/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKN 65
             IV+A+ N  KI E   +   LG    +  ++  +  PEETG +FEENA+ K+   +K 
Sbjct: 1   MKIVLATKNKGKIKEFKKVFSKLGWEAVAISDIAYVKEPEETGKTFEENAINKAKYYSKA 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             MP L+DDSG++ DVL  +PGI+SAR+A  +  ++  +  +       +         R
Sbjct: 61  VSMPVLADDSGIIADVLKDRPGIYSARYAGVHGDDKANNSKLVDKLRLYKENE------R 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           S +++ V++L WP+G V    GK  GII     G+ GFGYDP+F       T  ++T EE
Sbjct: 115 SGYYMCVVALVWPNGKVITAQGKCEGIIRDFEEGENGFGYDPLFYLPEKKCTMAQLTLEE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           KN                +SHR +A K  ++   ++
Sbjct: 175 KNK---------------ISHRGKAIKNLIEKLKKL 195


>gi|262369933|ref|ZP_06063260.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Acinetobacter johnsonii SH046]
 gi|262314972|gb|EEY96012.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Acinetobacter johnsonii SH046]
          Length = 208

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 64/215 (29%), Positives = 101/215 (46%), Gaps = 19/215 (8%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLG--IMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            +V+AS+N  KI E + L   L   +   +  +L++    E G SF ENA+IK+  A++ 
Sbjct: 11  TLVLASNNKGKIAEFEKLFAELNLPVEVIAQGKLDIEDAIEDGLSFVENAIIKARHASRI 70

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G PA++DDSG+ + VL G PGI+SAR+A  +  +   +  +      LR          
Sbjct: 71  SGKPAIADDSGICVPVLGGAPGIYSARYAGEHGDDAANNQKLLAELKPLRKDGQAIEGMF 130

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
                 V     P   +  F G   G ++   RG+ GFGYDP+F       +  EM++EE
Sbjct: 131 VCVLALVQHADDPLPQI--FQGIWKGEVLEAARGENGFGYDPLFWLPELGLSSAEMSKEE 188

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           KN                +SHR +A + F  +  +
Sbjct: 189 KNK---------------ISHRGQAMQLFKASLEQ 208


>gi|302381543|ref|YP_003817366.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302192171|gb|ADK99742.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 200

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 89/218 (40%), Positives = 116/218 (53%), Gaps = 22/218 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           R +    +V A+HN  K  E+ +L+        +A E+NL  P ET  +F  NAM+K+  
Sbjct: 4   RLIKGMRLVAATHNAGKAREIHALLDGH-YTVVTATEVNLPEPAETETTFVGNAMLKARH 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AA   G   L+DDSGL +  LDG PGI SARW      +RDF++AM KIE  L    A  
Sbjct: 63  AAAFCGEVCLADDSGLSVTALDGAPGIFSARWGGP---QRDFNVAMDKIETRLEELGA-- 117

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F S L++AWPDG      G+V G++ +P RG  GFGYDPIF P+G+  TFGEM
Sbjct: 118 -HDRTAWFTSALAVAWPDGPCVVVEGRVDGVVTFPRRGDRGFGYDPIFIPDGHTLTFGEM 176

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
               K               D LSHR RAF+      +
Sbjct: 177 KPALK---------------DSLSHRTRAFEMLKAALI 199


>gi|313905743|ref|ZP_07839103.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Eubacterium cellulosolvens 6]
 gi|313469450|gb|EFR64792.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Eubacterium cellulosolvens 6]
          Length = 203

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 62/223 (27%), Positives = 100/223 (44%), Gaps = 27/223 (12%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAK 64
              ++ A+ N +K+ E+  ++  L +   S  E  +   P+E G +FEENA+IK+   A 
Sbjct: 1   MKRVIFATGNENKMREVREILAELPVEILSMKEAGISSDPDENGETFEENALIKAKAVAA 60

Query: 65  NAGMP-----ALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
                      L+DDSGL +D +D  PG+ SARW   +T  R  +         + +   
Sbjct: 61  VLPEQLKDSVVLADDSGLEVDAMDKMPGVQSARWMGHDTSYRIKNA------KIIENLEG 114

Query: 120 HDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
                R+A F+  ++   PDG      G + G I +  +G+ GFGYDPIF      R+  
Sbjct: 115 VPVEKRTARFVDAIAAVLPDGRDLVVRGVIEGKIGYEEKGENGFGYDPIFMLPDMSRSTA 174

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           E++ EEKN                +SHR +A +   +    + 
Sbjct: 175 ELSPEEKNE---------------ISHRGKALRQIAEKLREVL 202


>gi|317049430|ref|YP_004117078.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Pantoea
           sp. At-9b]
 gi|316951047|gb|ADU70522.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Pantoea
           sp. At-9b]
          Length = 197

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 68/217 (31%), Positives = 104/217 (47%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+  L+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQKVVLATGNPGKVRELADLLAAFGLDIVAQTELGVESAEETGLTFIENAILKARHAAQI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A  +  ++      Q ++  L +        R
Sbjct: 61  TGLPAIADDSGLAVDALGGAPGIYSARYAGLDASDQ------QNLDKLLIALENVPEGER 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G  +G I     G+ GFGYDPIF      +T  E+++
Sbjct: 115 QAQFHCVLVYVRHAADPTPLVFHGSWAGEITRAAAGEGGFGYDPIFYVPELGKTAAELSK 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +EK                 +SHR +A    +D    
Sbjct: 175 DEK---------------RAVSHRGKALTLLLDAMRN 196


>gi|293391739|ref|ZP_06636073.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952273|gb|EFE02392.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 226

 Score =  148 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 101/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  AA+
Sbjct: 30  MKQKIVLATGNQGKVREMADVLADFGFDVIAQTDLGIDSPEETGLTFVENAILKARYAAE 89

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+D L+G PG++SAR+     GE   D   +    A  +    +   
Sbjct: 90  KSGLPAIADDSGLVVDALNGAPGLYSARY----AGEEGNDAKNRAKLLAELAYVPAEQRK 145

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  VL     D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 146 AKFVSTIVLLQHPTDPSPIIAQGECHGVIAFEEKGENGFGYDALFFSPQQGCTFAELDTV 205

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRARA        
Sbjct: 206 EKKK---------------ISHRARALAVLKTKL 224


>gi|117620363|ref|YP_855388.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117561770|gb|ABK38718.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 198

 Score =  148 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 68/206 (33%), Positives = 101/206 (49%), Gaps = 23/206 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            N +V+A+ N  K+ E+ +++  + I      E  +   EETG +F ENA+IK+  AA+ 
Sbjct: 1   MNKLVLATGNQKKVKELAAMLADMKIQVIPQSEFAVSDAEETGTTFVENAIIKARHAARI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D+L G+PG++SAR+A     ++        I+  L          +
Sbjct: 61  TGLPAVADDSGLEVDLLHGRPGVYSARFAGEGASDK------DNIDKLLGELKGAPEYLK 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL       D           G+I+  PRGQ GFGYDP+F    +D T  +M  
Sbjct: 115 SARFWCVLVYMRHADDPTPIICQASWEGMIIDEPRGQHGFGYDPVFFVPDHDCTSAQMPA 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRAR 209
           E KN                LSHR +
Sbjct: 175 ELKNQ---------------LSHRGQ 185


>gi|332305442|ref|YP_004433293.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172771|gb|AEE22025.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 201

 Score =  148 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 74/221 (33%), Positives = 107/221 (48%), Gaps = 23/221 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   IV+A+ N  K+ E+  L+ PL +      E ++    ETG +F ENA+IK+  AAK
Sbjct: 1   MTRKIVLATGNQGKVSELSQLLTPLAVNIVPQSEFDVPEVPETGTTFVENAIIKARHAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PA++DDSGL +D L G PG++SAR+A SN  + D    + K+  AL+      PA 
Sbjct: 61  ITGLPAIADDSGLAVDALGGAPGVYSARYAGSNATDSD---NIDKLLGALQEIE---PAR 114

Query: 125 RSAHFISVLSLAW--PDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F+ VL       D       G+  G I     G  GFGYDPIF       T  +++
Sbjct: 115 RQARFLCVLVYMRSSEDPTPIICQGEWHGTITHERSGDSGFGYDPIFWVEQKQCTSAQLS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           + +KN                LSHR +A +  +       E
Sbjct: 175 KAQKNA---------------LSHRGQALQQLLGKLSAELE 200


>gi|15615629|ref|NP_243933.1| hypothetical protein BH3067 [Bacillus halodurans C-125]
 gi|22653777|sp|Q9K8D9|NTPA2_BACHD RecName: Full=Nucleoside-triphosphatase 2; AltName: Full=Nucleoside
           triphosphate phosphohydrolase 2; Short=NTPase 2
 gi|10175689|dbj|BAB06786.1| BH3067 [Bacillus halodurans C-125]
          Length = 194

 Score =  148 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 104/214 (48%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
               ++A+ N  K+ E ++++   G    S L+   +   EETG++F ENA IK+   A+
Sbjct: 1   MKEWIVATKNKGKVAEFEAILGKRGFSVKSLLDYPAIEDIEETGSTFNENATIKAEAIAE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL+ID LDG+PGI SAR+A     ++      + IE  LR         
Sbjct: 61  RFQRPVLADDSGLIIDALDGRPGIFSARYAGEEKDDQ------KNIEKVLRELQDIPWKA 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   ++LA P      F G   G I   P+G  GFGYDPIF    +D+T  E+T+E
Sbjct: 115 RTARFHCSIALARPQAETIVFEGTCEGYITTEPKGTGGFGYDPIFYVPSHDKTMAELTQE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                LSHR  A K      
Sbjct: 175 EKNK---------------LSHRYHALKQLDKWL 193


>gi|326797255|ref|YP_004315075.1| nucleoside-triphosphatase rdgB [Marinomonas mediterranea MMB-1]
 gi|326548019|gb|ADZ93239.1| Nucleoside-triphosphatase rdgB [Marinomonas mediterranea MMB-1]
          Length = 202

 Score =  148 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 68/218 (31%), Positives = 98/218 (44%), Gaps = 23/218 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   IV+AS+N  KI E +SL    GI      E N+   +ETG SF ENA++K+  A  
Sbjct: 1   MNKTIVLASNNSGKIKEFNSLFSQYGIDVKPQGEFNVEEADETGLSFIENAILKARNACA 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
              +PA++DDSG+ +D L+G PGI+SAR+A  +      +  + +  +            
Sbjct: 61  RTNLPAIADDSGIEVDYLNGAPGIYSARFAGEHGDNDANNALLLEKLD------GVPTEQ 114

Query: 125 RSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R+A F  VL+      D       G   G I+    G  GFGYDPIF       +   + 
Sbjct: 115 RTARFHCVLAYMRHKDDPTPIVVQGSWEGRILESNEGVEGFGYDPIFFVPEQGCSSASLP 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +E KN                LSHRA+A K  +     
Sbjct: 175 KEVKNS---------------LSHRAKALKLLMAAFKE 197


>gi|254418110|ref|ZP_05031834.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brevundimonas sp. BAL3]
 gi|196184287|gb|EDX79263.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Brevundimonas sp. BAL3]
          Length = 192

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 88/213 (41%), Positives = 117/213 (54%), Gaps = 22/213 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             IV A+HN  K+ E+ +L+        +A +LNL  P+ET  +F  NAM+K+  AA  +
Sbjct: 1   MRIVAATHNPGKVPEIAALLGE-DYEILTAGQLNLSEPDETETTFAGNAMLKARHAAALS 59

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G  AL+DDSG+ +  LDG PGI SARWA      +DF +AM+K+E+ L    A     R+
Sbjct: 60  GEVALADDSGMSVAALDGAPGIFSARWAGPG---KDFAVAMKKVEDRLEEIGAT---DRA 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F S L++AWPDG      G+V G + +PPRG  GFGYDPIF P G D TFGEM    K
Sbjct: 114 AWFTSALAVAWPDGPCVVVEGEVHGRLTFPPRGDRGFGYDPIFIPEGGDLTFGEMEPAAK 173

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
                          + +SHR RAF       +
Sbjct: 174 ---------------EAISHRTRAFAKLRAALI 191


>gi|291295491|ref|YP_003506889.1| non-canonical purine NTP pyrophosphatase rdgB/HAM1 family
           [Meiothermus ruber DSM 1279]
 gi|290470450|gb|ADD27869.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Meiothermus ruber DSM 1279]
          Length = 203

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 75/211 (35%), Positives = 115/211 (54%), Gaps = 22/211 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
            +++IA+ N  K  E+   + PLG    S L+    +P E G++FE+NA++K+  AAK++
Sbjct: 1   MHLLIATSNPGKFREIREGLAPLGWTLFSLLDYPFKLPPEEGSTFEDNAVLKAAFAAKHS 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+P L+DDSGL +  L G+PG++SAR+     G +  D         L        A R 
Sbjct: 61  GLPTLADDSGLEVAALGGEPGVYSARY-----GNKSTDTERNVYL--LERLKGVPRAERK 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F++VL +A+PDG++E + G+  G I+  PRG+ GFGYDP+F      +TF EMT EEK
Sbjct: 114 ARFVAVLVMAYPDGYMELYRGETEGEILEAPRGEWGFGYDPLFYLPEAGKTFAEMTLEEK 173

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
                             SHR +A +  ++ 
Sbjct: 174 AA---------------YSHRGKALRQLLEA 189


>gi|293369281|ref|ZP_06615868.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides ovatus SD CMC 3f]
 gi|292635611|gb|EFF54116.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides ovatus SD CMC 3f]
          Length = 194

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 64/217 (29%), Positives = 102/217 (47%), Gaps = 27/217 (12%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLT 61
           +++  +V A++N  K+ E+ +++    +   S  ++     IPE T  + E NA++KS  
Sbjct: 1   MMKRKLVFATNNAHKLEEVAAILGDQ-VELLSLNDIGCQADIPE-TAETLEGNALLKSSY 58

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
             KN  +   +DD+GL ++ L+G PG++SAR+A     +   +M     E          
Sbjct: 59  IYKNYHLDCFADDTGLEVETLNGAPGVYSARYAGGEGHDAQANMLKLLHE-------LDG 111

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F + +SL         F G + G I+   RG  GFGYDP+F P GYDRTF E+
Sbjct: 112 KENRKAQFRTAISLILDGKEYL-FEGVIKGEIIKEKRGDSGFGYDPVFMPEGYDRTFAEL 170

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
             + KN                +SHRA A +   +  
Sbjct: 171 GNDIKNQ---------------ISHRALAVQKLCEFL 192


>gi|293394480|ref|ZP_06638776.1| non-canonical purine NTP pyrophosphatase RdgB [Serratia odorifera
           DSM 4582]
 gi|291422945|gb|EFE96178.1| non-canonical purine NTP pyrophosphatase RdgB [Serratia odorifera
           DSM 4582]
          Length = 200

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 102/219 (46%), Gaps = 23/219 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           +    +V+A+ N  K+ E+  L+   G+   +  EL +   EETG +F ENA++K+  AA
Sbjct: 1   MTMQKVVLATGNPGKVRELADLLADFGLDVVAQTELGVDSAEETGLTFIENAILKARHAA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G+PA++DDSGL +D L G PGI+SAR+A  +  ++     +      L         
Sbjct: 61  KITGLPAIADDSGLAVDALGGAPGIYSARYAGEDASDQQNLDKLLVALKDL------PQG 114

Query: 124 FRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            R A F  VL       D       G  SG I +   GQ GFGYDPIF      RT  E+
Sbjct: 115 QRGAQFHCVLVYLRHAEDPTPLVCHGSWSGEITFASAGQGGFGYDPIFYVPALSRTAAEL 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           + +EK+                +SHR +A    ++    
Sbjct: 175 SRDEKSA---------------VSHRGQALTLLLEAMRN 198


>gi|255025219|ref|ZP_05297205.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family protein
           [Listeria monocytogenes FSL J2-003]
          Length = 203

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 105/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +  ++   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPDIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L++    +P  
Sbjct: 61  LLNQTVIADDSGLIVDALDGAPGVYSARYAGVAHDDAKNN------EKLLKNLEGVEPDN 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNE---------------ISHRANAIKQLEKDLAEVVEK 199


>gi|317495244|ref|ZP_07953614.1| Ham1 family protein [Gemella moribillum M424]
 gi|316914666|gb|EFV36142.1| Ham1 family protein [Gemella moribillum M424]
          Length = 194

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 117/219 (53%), Gaps = 26/219 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             N+++AS+N  K+ E+  ++    I+T   +     I E  G+SFEENA+IK+ T AK 
Sbjct: 1   MKNLILASNNAHKVKEIKQILTGYNILTLKEVNFTEDIIE-DGDSFEENALIKARTIAKY 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G  A++DDSGL +D L+G+PG++SAR++   T E++ +  + ++               
Sbjct: 60  SGKAAIADDSGLSVDKLNGRPGVYSARYSPEQTDEKNIEKVLTELAG----------EQS 109

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F+SV+++  P+G    F G+  G I++  RG  GFGYDPIF     ++TF E++ +E
Sbjct: 110 KAKFVSVIAMVTPEGDEFTFRGECEGEIIFEKRGTNGFGYDPIFYVPELNKTFAEISSDE 169

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           KN                +SHR ++ + F       D +
Sbjct: 170 KNA---------------ISHRKKSLEKFAKFLKEQDNE 193


>gi|289577833|ref|YP_003476460.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermoanaerobacter italicus Ab9]
 gi|289527546|gb|ADD01898.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermoanaerobacter italicus Ab9]
          Length = 198

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 68/220 (30%), Positives = 108/220 (49%), Gaps = 24/220 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAKN 65
             I+IA++N  K  E+ +      +   S  +L +    EETGN+ EENA++K+    + 
Sbjct: 1   MKIIIATNNPHKTEEIKNFFKGYPVEIYSMADLGIKEDIEETGNTIEENALVKARFLKEK 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                ++DD+GL ++ L+G+PG++SAR+A  N    D +         L+         R
Sbjct: 61  VDGIVIADDTGLFVEYLNGQPGVYSARFAGENATYEDNNK------KLLKLLEGVPYEKR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A+F +V+++   +       GK+ G I+  PRG+ GFGYDPIF  +   +T  E+T EE
Sbjct: 115 KAYFKTVIAVVEREKETLL-EGKLEGYILDRPRGKNGFGYDPIFYVDDLGKTLAELTMEE 173

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL-RIDEK 224
           KN                +SHRA A     +  L R+ EK
Sbjct: 174 KNK---------------ISHRANALVKLKNYILQRLGEK 198


>gi|329766986|ref|ZP_08258514.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Gemella
           haemolysans M341]
 gi|328837711|gb|EGF87336.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Gemella
           haemolysans M341]
          Length = 194

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 75/219 (34%), Positives = 117/219 (53%), Gaps = 26/219 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +++AS+N  K+ E+ S++    I+T   +     I E  G++FEENA+IK+ T +K 
Sbjct: 1   MKELILASNNAHKVEEIKSILEDYNILTLKDINYTEEIVE-DGSTFEENALIKARTISKY 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G  A+SDDSGL +D+LDG+PG++SAR+++  T E+        IE  L           
Sbjct: 60  SGKTAISDDSGLSVDLLDGRPGVYSARYSKEQTDEK-------NIEKVLLELNG---QKS 109

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F+SV++L  PDG    F G+  G I++  RG  GFGYDPIF     D+TF E++ E+
Sbjct: 110 KAKFVSVIALVKPDGTELTFRGECHGEIIFEKRGTNGFGYDPIFYVPSLDKTFAELSAEQ 169

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           KN                +SHR ++ + F        ++
Sbjct: 170 KNS---------------ISHRKQSLEKFSQYLKEESDE 193


>gi|187929360|ref|YP_001899847.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Ralstonia pickettii 12J]
 gi|309781785|ref|ZP_07676518.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Ralstonia sp. 5_7_47FAA]
 gi|187726250|gb|ACD27415.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ralstonia pickettii 12J]
 gi|308919426|gb|EFP65090.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Ralstonia sp. 5_7_47FAA]
          Length = 201

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 98/214 (45%), Gaps = 18/214 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS+N  K+ E ++L+  LG   T    L +   EE   +F ENA+ K+  A++ 
Sbjct: 1   MRKIVLASNNAGKLAEFNTLLGTLGFDVTPQGALGIPEAEEPYATFVENALTKARHASRA 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G+PAL+DDSG+ +  L G PG++SAR+A+     +       ++   L  K      + 
Sbjct: 61  SGLPALADDSGICVHALGGAPGVYSARYAQLVGEPKSDAANNARLVRELVGKADRGAHY- 119

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               + V      D       G   G ++  PRG  GFGYDP F      +T  E+T+ E
Sbjct: 120 --VCVLVYVRHADDPQPIIAEGNWFGEVIDTPRGDGGFGYDPHFLLPNLGKTAAELTKAE 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           KN                +SHRA+A    V+   
Sbjct: 178 KNS---------------VSHRAQALAQLVERLR 196


>gi|325524721|gb|EGD02708.1| dITP/XTP pyrophosphatase [Burkholderia sp. TJI49]
          Length = 209

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 63/213 (29%), Positives = 94/213 (44%), Gaps = 18/213 (8%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS+N  K+ E  +L   +GI      +L +   +E  ++F ENA+ K+  A++  G
Sbjct: 12  RIVLASNNAGKLREFSALFSTVGIEIVPQGDLAVPEADEPFHTFIENALTKARHASRLTG 71

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PA++DDSGL +  L G PG++SAR+A+    ++        +   LR        +   
Sbjct: 72  LPAIADDSGLCVRALRGAPGVYSARYAQRAGRDKGDAANNAYLVEQLRDVADRRAYYC-- 129

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             +  L     D       G+  G IV  PRG+ GFGYDP F       T  E+    KN
Sbjct: 130 -CVLALVRHADDPEPLFAEGRWDGEIVDAPRGEHGFGYDPYFYLPALGATAAELEPAVKN 188

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
                            SHRARA K  +     
Sbjct: 189 AH---------------SHRARALKALLARLEE 206


>gi|239628302|ref|ZP_04671333.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239518448|gb|EEQ58314.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 206

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 68/221 (30%), Positives = 100/221 (45%), Gaps = 22/221 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAA 63
           + + I+ A+ N  K+ E+  L+  LG+   S  E  +     E G  F ENA IK+    
Sbjct: 1   MGHRIIFATGNEGKMREIRVLLADLGLPVLSMKEAGVNPEIVEDGADFGENAEIKARAVW 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
              G   L+DDSGLV+D + G+PGI+SAR+   +T     +  +         +      
Sbjct: 61  NLTGDIVLADDSGLVVDYIGGEPGIYSARYMGEDTSYEIKNRNIIDRLKQAVGQE----- 115

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            RSA F+  ++   PDG V +    + G+I   P GQ GFGYDPI     Y  T  E+T 
Sbjct: 116 -RSARFVCNIAAVLPDGRVLHTEETMEGLIADEPAGQGGFGYDPILYLPAYGMTSAEITM 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EEKN                +SHR +A +        + +K
Sbjct: 175 EEKNA---------------ISHRGKALRAMKTVLEEVLKK 200


>gi|227518377|ref|ZP_03948426.1| tRNA nucleotidyltransferase [Enterococcus faecalis TX0104]
 gi|227074055|gb|EEI12018.1| tRNA nucleotidyltransferase [Enterococcus faecalis TX0104]
          Length = 451

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 97/220 (44%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
           E  IVIA+ N  K  E  S+    G    + L+  NL   EETG +FEENA +K+ T A+
Sbjct: 253 EKVIVIATRNPGKAKEFSSIFGEKGYTVKTLLDYPNLPDVEETGRTFEENARLKAETIAE 312

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
               P L+DDSGL++D L G PGI+SAR+A   T +   +         L          
Sbjct: 313 ILQKPVLADDSGLIVDALGGMPGIYSARFAGEPTNDASNNA------KLLHELTGVPKEK 366

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F   L  A P         +  G +   PRG+ GFGYD +F      +T  E++ E
Sbjct: 367 RQARFHCTLVFAEPKKESLVVEAEWPGEVGTIPRGEGGFGYDSLFYVAELGKTAAELSGE 426

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           EKN                +SHR +A     +      +K
Sbjct: 427 EKNK---------------VSHRGQAVAKLKEQWEEWLKK 451


>gi|254491919|ref|ZP_05105098.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylophaga thiooxidans DMS010]
 gi|224463397|gb|EEF79667.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Methylophaga thiooxydans DMS010]
          Length = 201

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 73/215 (33%), Positives = 106/215 (49%), Gaps = 23/215 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            +NIV+AS N  K+ E   L+ PL I      EL+++  EETG SF ENA++K+  A   
Sbjct: 1   MSNIVLASGNKGKLREFAQLLAPLNIEIVPQSELHVVEAEETGLSFVENAILKARNACMQ 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA+SDDSG+ +D L G PGI+S+R+A  N  ++D    +      L +      A R
Sbjct: 61  TGLPAISDDSGIEVDALQGAPGIYSSRYAGPNASDQDNIDTL------LAAIKDVPEAER 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  V+       D       G   G I+  P G  GFGYDPIF     + +  E++ 
Sbjct: 115 SARFQCVVVYMRHAKDPTPLICQGTWHGQIMLQPSGDGGFGYDPIFFVAETETSAAELSP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           E+K+                +SHR +A + F+   
Sbjct: 175 EQKHA---------------VSHRGQAMRRFIAEF 194


>gi|113460271|ref|YP_718329.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Haemophilus somnus 129PT]
 gi|112822314|gb|ABI24403.1| Ham1 family protein [Haemophilus somnus 129PT]
          Length = 198

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 100/217 (46%), Gaps = 21/217 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  AAK
Sbjct: 1   MKQKIVLATANPGKVKEMADVLSEFGFDVVAQKDLGIDSPEETGLTFVENALLKARYAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+ VL+G PG++SAR+     G    +   +  E  L          
Sbjct: 61  MSGLPAIADDSGLVVPVLNGAPGLYSARY----AGVEGKEAEQKNREKLLAELANVPVNE 116

Query: 125 RSAHF--ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F    V+     D       G+  GII +   G  GF YD +F       TF E+ 
Sbjct: 117 RHAKFVSCIVMLQHDTDPSPIIAEGECHGIIAFSESGSNGFAYDSLFFYPETGCTFAELE 176

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             EK                 +SHRA+A     +   
Sbjct: 177 TSEKKK---------------ISHRAKALAVLKERLK 198


>gi|320451389|ref|YP_004203485.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Thermus
           scotoductus SA-01]
 gi|320151558|gb|ADW22936.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Thermus
           scotoductus SA-01]
          Length = 203

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 78/211 (36%), Positives = 117/211 (55%), Gaps = 22/211 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+A+ N  K+ E+   + PLG    S  +  L +P+E G +F ENA++K+   AK  
Sbjct: 1   MRLVLATSNPGKVQELKEGLAPLGWTLLSLADFPLRMPKEEGATFLENALLKAAYVAKAT 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +  L G+PG++SAR+      +R+ ++ + +    L+ +       R 
Sbjct: 61  GLPALADDSGLEVPALGGEPGVYSARYGGRE-TDRERNVYLLERMRHLKGEE------RK 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F++VL LA+PDGHVE + G+V G I+  PRG+ GFGYDP+F      +TF EMT EEK
Sbjct: 114 ARFVAVLVLAYPDGHVETYEGQVEGYILEAPRGEGGFGYDPLFYVPEAGKTFAEMTLEEK 173

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
                             SHR +A K  +  
Sbjct: 174 ---------------ARYSHRGQAIKALLKA 189


>gi|313609162|gb|EFR84845.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Listeria monocytogenes FSL F2-208]
          Length = 203

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 104/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L++    +P  
Sbjct: 61  VLNQTVIADDSGLIVDALDGAPGVYSARYAGVAHDDAKNN------EKLLKNLEGVEPDK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTTFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNK---------------ISHRANAIKQLEKDLAEVVEK 199


>gi|262405763|ref|ZP_06082313.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|262356638|gb|EEZ05728.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
          Length = 194

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 64/217 (29%), Positives = 102/217 (47%), Gaps = 27/217 (12%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLT 61
           +++  +V A++N  K+ E+ +++    +   S  ++     IPE T  + E NA++KS  
Sbjct: 1   MMKRKLVFATNNAHKLEEVAAILGDQ-VELLSLNDIGCQTDIPE-TAETLEGNALLKSSY 58

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
             KN  +   +DD+GL ++ L+G PG++SAR+A     +   +M     E          
Sbjct: 59  IYKNYHLDCFADDTGLEVEALNGAPGVYSARYAGGEGHDAQANMLKLLHE-------LDG 111

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F + +SL         F G + G I+   RG  GFGYDP+F P GYDRTF E+
Sbjct: 112 KENRKAQFRTAISLILDGKEYL-FEGVIKGEIIKEKRGDSGFGYDPVFMPEGYDRTFAEL 170

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
             + KN                +SHRA A +   +  
Sbjct: 171 GNDIKNQ---------------ISHRALAVQKLCEFL 192


>gi|257468118|ref|ZP_05632214.1| ribonuclease PH [Fusobacterium ulcerans ATCC 49185]
 gi|317062403|ref|ZP_07926888.1| ribonuclease PH [Fusobacterium ulcerans ATCC 49185]
 gi|313688079|gb|EFS24914.1| ribonuclease PH [Fusobacterium ulcerans ATCC 49185]
          Length = 196

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 72/219 (32%), Positives = 106/219 (48%), Gaps = 26/219 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMP-LGIMTTSALE-LNLIIPEETGNSFEENAMIKSLTAAK 64
             I +A+ N  KI E+ ++      I   S  + +++    E G++FE N+  K+L  AK
Sbjct: 1   MKIFLATGNKHKIEEITAIFKNVKNIEILSIKDGIDIPEVVEDGDTFEANSAKKALEIAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             GM  ++DDSGL +D L G PG++SAR++  +  +   +  + K               
Sbjct: 61  YTGMITIADDSGLCVDALGGAPGVYSARYSGEHATDDSNNKKLIKEL--------QGKEN 112

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R AHF+SV++L  PDG   +F G+V G I+  PRG  GFGYDP F    Y +T  EM  +
Sbjct: 113 RKAHFVSVVTLGKPDGRSYSFRGEVPGEIIDEPRGDKGFGYDPHFFVAEYGKTLAEM-PD 171

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
            KN               L+SHRA A K        I +
Sbjct: 172 VKN---------------LISHRANALKKLEAELESILK 195


>gi|332184584|gb|AEE26838.1| Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Francisella cf. novicida 3523]
          Length = 192

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 66/213 (30%), Positives = 93/213 (43%), Gaps = 21/213 (9%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  KI E  ++     I        N+   EE G SF ENA++K+   AK 
Sbjct: 1   MKEIVLASSNKGKIREFTNIFRQKNIKIVPQTNFNVPDAEEVGLSFIENAILKARNCAKY 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +  L+G+PGI+SAR++  +  ++        IE  L +   +D    
Sbjct: 61  TGLPAIADDSGLEVFSLNGQPGIYSARYSGEHGNDK------ANIEKLLINLIGNDDRNA 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
                        D       G + G I     G  GFGYDPIF      +T  E+TE E
Sbjct: 115 RFVCALAYVKYELDPSPILAYGFLEGKIAHQMSGSNGFGYDPIFLLPQLQKTLAEITESE 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN                +SHRA A    ++  
Sbjct: 175 KNK---------------ISHRAIALDKIIELL 192


>gi|326798879|ref|YP_004316698.1| nucleoside-triphosphatase rdgB [Sphingobacterium sp. 21]
 gi|326549643|gb|ADZ78028.1| Nucleoside-triphosphatase rdgB [Sphingobacterium sp. 21]
          Length = 191

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 72/216 (33%), Positives = 106/216 (49%), Gaps = 27/216 (12%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMP-LGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
              +V A++N  K+ E+ +++     I + S ++  + IPE T ++FE NA +KS     
Sbjct: 1   MQQLVFATNNKHKLEEVQAMVKGLFSIQSLSEIQCEVDIPE-TADTFEGNASLKSEYILS 59

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           N      +DDSGL ++ L+G+PG++SAR++ S   E++ D         L      D   
Sbjct: 60  NYARDCFADDSGLEVEALNGEPGVYSARYSGSRDMEKNID---------LLLSKLADKTN 110

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F +V+SL     H   F G V G I     G  GFGYDPIF P+GY +TF EM+ +
Sbjct: 111 RKAQFRTVISLRLGGEH-HFFEGIVKGSITQERIGLRGFGYDPIFIPDGYIKTFAEMSAD 169

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EKN                +SHRA A +  V     
Sbjct: 170 EKNQ---------------ISHRAVAIQKLVTFLKN 190


>gi|298483220|ref|ZP_07001399.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides sp. D22]
 gi|295085809|emb|CBK67332.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bacteroides xylanisolvens XB1A]
 gi|298270537|gb|EFI12119.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides sp. D22]
          Length = 194

 Score =  147 bits (371), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 64/217 (29%), Positives = 102/217 (47%), Gaps = 27/217 (12%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLT 61
           +++  +V A++N  K+ E+ +++    +   S  ++     IPE T  + E NA++KS  
Sbjct: 1   MMKRKLVFATNNAHKLEEVAAILGDQ-VELLSLNDIGCQADIPE-TAETLEGNALLKSSY 58

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
             KN  +   +DD+GL ++ L+G PG++SAR+A     +   +M     E          
Sbjct: 59  IYKNYHLDCFADDTGLEVEALNGAPGVYSARYAGGEGHDAQANMLKLLHE-------LDG 111

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F + +SL         F G + G I+   RG  GFGYDP+F P GYDRTF E+
Sbjct: 112 KENRKAQFRTAISLILDGKEYL-FEGVIKGEIIKEKRGDSGFGYDPVFMPEGYDRTFAEL 170

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
             + KN                +SHRA A +   +  
Sbjct: 171 GNDIKNQ---------------ISHRALAVQKLCEFL 192


>gi|218133783|ref|ZP_03462587.1| hypothetical protein BACPEC_01665 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991158|gb|EEC57164.1| hypothetical protein BACPEC_01665 [Bacteroides pectinophilus ATCC
           43243]
          Length = 203

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 64/217 (29%), Positives = 102/217 (47%), Gaps = 22/217 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAA 63
           +   I+ A+ N  K+ E+  ++  L +   S  +  + I  +E G +FEENA+IK+    
Sbjct: 1   MAEKIIFATGNAGKMKEIQMIMSDLDVEVVSMKDAGINIDIDENGTTFEENALIKARAVM 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +   M  L+DDSGL +D L+ +PG++SAR+   +T     + ++                
Sbjct: 61  QECNMITLADDSGLEVDYLNKEPGVYSARYMGEDTSYDIKNRSIIDRLE------GVTGN 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            RSA F+ V++ A PDG      G + G+I +  +G+ GFGYDPI     YD T  E++ 
Sbjct: 115 DRSARFVCVIAAALPDGRTLTTRGTIEGLIGYEQKGENGFGYDPIVYVPEYDATTAELSM 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           E KN                +SHR +A        L 
Sbjct: 175 EVKNS---------------ISHRGKALAAMKAKLLE 196


>gi|328949912|ref|YP_004367247.1| Nucleoside-triphosphatase rdgB [Marinithermus hydrothermalis DSM
           14884]
 gi|328450236|gb|AEB11137.1| Nucleoside-triphosphatase rdgB [Marinithermus hydrothermalis DSM
           14884]
          Length = 203

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 82/213 (38%), Positives = 115/213 (53%), Gaps = 22/213 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             ++IA+ N  K  E+   + PLG    S L+  L +P+E G +FE+NA++K+  AAK  
Sbjct: 1   MRVLIATSNPGKFQELRQGLEPLGWACVSLLDYPLKMPKEEGATFEDNALLKAAFAAKET 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+ AL+DDSGL +D LDG+PG++SAR+    T         ++    L       P  R+
Sbjct: 61  GLAALADDSGLEVDALDGEPGVYSARYGGKTTD-------TERNIYLLERLRGVPPEQRT 113

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F+ VL+LA+PDGHVE + G+V G I+  PRG  GFGYDP+F      RTF EM  EEK
Sbjct: 114 ARFVCVLALAYPDGHVETYRGEVEGRILEAPRGSGGFGYDPLFYLPEAGRTFAEMPPEEK 173

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
                             SHR RA +  ++   
Sbjct: 174 ---------------ARYSHRGRALRALIEAYK 191


>gi|294634378|ref|ZP_06712915.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Edwardsiella tarda ATCC 23685]
 gi|291092186|gb|EFE24747.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Edwardsiella tarda ATCC 23685]
          Length = 197

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 65/211 (30%), Positives = 98/211 (46%), Gaps = 19/211 (9%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K+ E+ SL+   G+   +  EL +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQQVVLATGNAGKVRELASLLADFGLDIVAQSELGIDSAEETGLTFIENAILKARHAARQ 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G+PA++DDSGL +D L G PGI+SAR+     GE   D A  +                
Sbjct: 61  SGLPAIADDSGLAVDALGGAPGIYSARY----AGEEANDAANMEKLLHALRDIPTGQRQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G I   P G+ GFGYDP+F       T  +++ E+
Sbjct: 117 RFHCVLVYLRHADDPTPLVCHGVWQGEIATAPCGEGGFGYDPLFFIPALGCTAAQLSREQ 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           K                 +SHR +A +  +D
Sbjct: 177 K---------------RAISHRGQALQQLLD 192


>gi|332981493|ref|YP_004462934.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Mahella
           australiensis 50-1 BON]
 gi|332699171|gb|AEE96112.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Mahella
           australiensis 50-1 BON]
          Length = 199

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 107/217 (49%), Gaps = 22/217 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTA 62
           +   +I+IAS+N  KI E+  ++ PLG+   S  E  + +  EE GNSF+ENA+ K++T 
Sbjct: 1   MKIKDIIIASNNKGKIAEIKHILTPLGVNICSMQEKGIYVAVEEDGNSFQENAIKKAMTV 60

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            K A    L+DDSGL++  L G+PGI+SAR+A  N  + D           L        
Sbjct: 61  CKVANEWTLADDSGLIVQALGGRPGIYSARFAGLNASDEDNRR------KLLDMMRDVPW 114

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F   ++L  PDG+V    G+  G I +   G  GFGYDP+F    Y++TF ++ 
Sbjct: 115 DKRKAFFYCCVALVSPDGYVIMADGRCDGYIAYEEMGSDGFGYDPVFLIPEYNKTFAQLD 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              KN                +SHRARA     D   
Sbjct: 175 ISVKNE---------------MSHRARALDALKDKIK 196


>gi|16803279|ref|NP_464764.1| nucleoside-triphosphatase [Listeria monocytogenes EGD-e]
 gi|224503806|ref|ZP_03672113.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family protein
           [Listeria monocytogenes FSL R2-561]
 gi|255029954|ref|ZP_05301905.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family protein
           [Listeria monocytogenes LO28]
 gi|22653757|sp|Q8Y7N5|NTPA_LISMO RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|16410655|emb|CAC99317.1| lmo1239 [Listeria monocytogenes EGD-e]
          Length = 203

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 105/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L++    +P  
Sbjct: 61  VLNQTVIADDSGLIVDALDGAPGVYSARYAGVAHDDAKNN------EKLLKNLEGVEPDK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    + + + EK
Sbjct: 175 KKNE---------------ISHRANAIKQLEKDLVEVVEK 199


>gi|218710634|ref|YP_002418255.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           splendidus LGP32]
 gi|218323653|emb|CAV19951.1| HAM1 protein homolog [Vibrio splendidus LGP32]
          Length = 199

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 98/217 (45%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + IV+A+ N  K+ EM  ++   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MSKIVLATGNQGKVREMADILSEFGFDVVAQSEFNVSEVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR++     ++      Q IE  L +    D   R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYSGEGATDK------QNIEKLLDAMQGVDVEKR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G  GFGYDP+F     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPLVCHGKWEGRILTEEHGGNGFGYDPVFFVPEDNCASAELES 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A          
Sbjct: 175 SRK---------------KQLSHRGKALASLFKTLKE 196


>gi|57234033|ref|YP_181939.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Dehalococcoides ethenogenes 195]
 gi|57224481|gb|AAW39538.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Dehalococcoides ethenogenes 195]
          Length = 199

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 69/218 (31%), Positives = 107/218 (49%), Gaps = 22/218 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
              +++AS+N  K+ E  SL+   G    +  ++ + I   ETG +FEENA +K+   A+
Sbjct: 1   MPKLLLASNNRGKLREYASLLSGSGFELVTPADMGIDITVAETGTTFEENARLKAAALAE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+  L+DDSGL +D L G+PG++SAR+A  N  + D +  +      L          
Sbjct: 61  ASGILTLADDSGLAVDALGGEPGVYSARYAGENATDTDRNAYL------LSKMHTIPAEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F  V+++A P   +  F G   G I   PRG  GFGYDP+F    Y +T  E+  E
Sbjct: 115 RTARFCCVIAIAQPGHIIATFEGTCEGFISTEPRGTNGFGYDPVFYLPEYGKTMAELPSE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
            KN                +SHR+ A +      ++I 
Sbjct: 175 IKNS---------------ISHRSIAAQKASRFLIQIA 197


>gi|299142475|ref|ZP_07035607.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella oris C735]
 gi|298576197|gb|EFI48071.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella oris C735]
          Length = 206

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 106/218 (48%), Gaps = 20/218 (9%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAKN 65
             IV A++N  K+ E+  ++        S  ++       ETG + EENA +K+L   ++
Sbjct: 1   MKIVFATNNTHKLTEIREILGSA-FEIVSLKDIGCDADIPETGQTLEENAHLKALYVYEH 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+   +DD+GL ++ L+G+PG++SAR+AE    + + +    K+   +      +  FR
Sbjct: 60  YGLDCFADDTGLEVEALNGEPGVYSARYAEQ--YDHNSEANTVKLLRKMTDITRRNACFR 117

Query: 126 SAHFISVLSLAWPDGHVEN-FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           +   +       P  + E  F G V G I    RG  GFGYDP+F PNGYD++F E+ EE
Sbjct: 118 TVISLIQHDADNPGSYHETLFEGIVEGKIATEKRGTAGFGYDPVFIPNGYDKSFAELGEE 177

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
            KN                +SHRARA +    + +   
Sbjct: 178 IKNK---------------ISHRARAVEKLAKSLITNS 200


>gi|297565610|ref|YP_003684582.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Meiothermus silvanus DSM 9946]
 gi|296850059|gb|ADH63074.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Meiothermus silvanus DSM 9946]
          Length = 421

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 74/211 (35%), Positives = 114/211 (54%), Gaps = 22/211 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +++A+ N  K  E+   + PLG    S L+    +P E G++FE+NAM+K+  A K  
Sbjct: 219 MRVLVATSNAGKFKELREGLAPLGWQLFSLLDYPFKLPHEDGSTFEDNAMLKAAFATKQV 278

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL ++ L G+PG++SAR+   ++             + LR         R 
Sbjct: 279 GIPALADDSGLEVEALQGEPGVYSARYGGKSSDTERNLYL----LDRLRHVKGE---ERR 331

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F++VL LA+PDGH+E + G+  G+I+  PRG+ GFGYDP+F      +TF EM+ EEK
Sbjct: 332 AKFVAVLVLAYPDGHLEAYRGEAHGLILEAPRGEGGFGYDPLFYVPEAGKTFAEMSLEEK 391

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
                             SHR +A +  ++ 
Sbjct: 392 ---------------AHYSHRGKALRALLEA 407



 Score = 85.7 bits (210), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 58/209 (27%), Positives = 97/209 (46%), Gaps = 24/209 (11%)

Query: 10  VIASH-NVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           V+A+  N  K   +  L+ PLG    S  E  + IPE    S  ++A++++  AAK +G+
Sbjct: 3   VLATTTNPLKAQRLQELLRPLGWQVISLAEQQVPIPEVPHLSPLDSALVRAAAAAKASGI 62

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
           PA++D+S   + V +GK   +S  +         ++ A+++    L          R A 
Sbjct: 63  PAIADESVFELQV-NGKLEHYSMHFG-------PWNTALERNLRLLERLRGLPIERRGAR 114

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           FI+V++LA P G +E F G+ +G+I+     Q G GYDP+F      +T  +MT EE+  
Sbjct: 115 FITVMALAQPSGALEVFQGETAGLILQRMENQGGIGYDPLFFVTEASKTLADMTPEEREA 174

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFVDN 217
                               RA +  V+ 
Sbjct: 175 VSPW---------------RRAVERLVEA 188


>gi|296160048|ref|ZP_06842868.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Burkholderia sp. Ch1-1]
 gi|295889794|gb|EFG69592.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Burkholderia sp. Ch1-1]
          Length = 215

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 98/214 (45%), Gaps = 18/214 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E  +L+   GI   +  ELN+   EE   +F ENA+ K+  AAK  
Sbjct: 18  KKVVLASNNAGKLREFAALLGAAGIELIAQGELNVPEAEEPHPTFVENALAKARHAAKLT 77

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +  L G PG++SAR+A+   GE+        + +ALR +      +  
Sbjct: 78  GLPALADDSGLCVRALRGAPGVYSARYAQLAGGEKSDAANNAHLMSALRGETDRRAYYF- 136

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
              +  L     D       G+  G ++  PRG  GFGYDP F     + +  E+    K
Sbjct: 137 --CVLALVRHADDPEPLIAEGRWHGEMLDAPRGTHGFGYDPYFFLPALNASAAELEPAVK 194

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           N                 SHRA A +  +     
Sbjct: 195 NAS---------------SHRAIALRQLLARLTE 213


>gi|255535704|ref|YP_003096075.1| Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Flavobacteriaceae bacterium 3519-10]
 gi|255341900|gb|ACU08013.1| Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [Flavobacteriaceae bacterium 3519-10]
          Length = 191

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 73/215 (33%), Positives = 112/215 (52%), Gaps = 27/215 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAA 63
           +   I+IA+HN  K  E+  ++        S  + ++     E G+SF ENA+IK+    
Sbjct: 1   MAREILIATHNQHKKEEIQQILGE-DFHVDSLTDYDIHDEIVEDGDSFHENALIKAKYCF 59

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G P++ DDSGLV++ LDG+PGI+SAR+     G+ DF   M K+ + L+        
Sbjct: 60  EKTGKPSVGDDSGLVVEALDGRPGIYSARY----AGDHDFAKNMAKVLDELKETE----- 110

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A+F++V+      G    F G+V G +    RG  GFGYDPIF P+G+D TF EM  
Sbjct: 111 NRNAYFVTVMCHVDGAGE-HYFEGRVYGQLTREIRGAKGFGYDPIFIPDGHDITFAEMKA 169

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           E+KN                +SHR++A +  +   
Sbjct: 170 EDKNK---------------ISHRSQALEKLLAFL 189


>gi|313204825|ref|YP_004043482.1| noN-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Paludibacter propionicigenes WB4]
 gi|312444141|gb|ADQ80497.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Paludibacter propionicigenes WB4]
          Length = 205

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 69/216 (31%), Positives = 107/216 (49%), Gaps = 26/216 (12%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMP-LGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
              +V A++N  K+ E+ +++ P   I++ + L  N  IPE T ++ + NA++K+     
Sbjct: 1   MKKLVFATNNAHKLSEVRAILEPEFTIISLADLNCNEDIPE-TADTLDGNALLKAQYIHD 59

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+   +DD+GL I+ L+G+PG++SAR+A      R     M K+   L      D   
Sbjct: 60  KFGLDCFADDTGLEIEALNGEPGVYSARYAGIECDAR---KNMSKVLTKL-----GDNPN 111

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F +V++L      +  F GK+ G I   P G  GFGYDPIF    Y  TF +++ E
Sbjct: 112 RKACFRTVIAL-IQGDKILYFEGKIDGQITHQPHGNSGFGYDPIFIAKDYLMTFAQLSAE 170

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EKN                +SHRA A K  V+   +
Sbjct: 171 EKNQ---------------ISHRALAVKQLVNYLQQ 191


>gi|331086330|ref|ZP_08335410.1| Ham1 family protein [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330406096|gb|EGG85619.1| Ham1 family protein [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 202

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 72/211 (34%), Positives = 106/211 (50%), Gaps = 22/211 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAA 63
           +E  I+ A+ N DK+ E+  ++  LGI+ +S  E  +     E G +FEENAMIK+   A
Sbjct: 1   MERKIIFATGNQDKMKEIQMILEDLGIVVSSMKEAGIDVDIVEDGTTFEENAMIKAEAIA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K      L+DDSGL ID L+ +PGI+SAR+A ++T     +  +      L+        
Sbjct: 61  KLTDAIVLADDSGLEIDYLNKEPGIYSARYAGTDTSYEIKNNLL------LQRLEGVPDE 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+  ++  +PDG  E   G + G I +   G+ GFGYDPIF    Y  T  E+  
Sbjct: 115 KRTARFVCAIAAVFPDGSKETVRGTIEGRIGYEIAGEHGFGYDPIFYLPEYGCTTAELDP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCF 214
           E+KN                LSHR +A +  
Sbjct: 175 EKKNE---------------LSHRGKALRLM 190


>gi|284801559|ref|YP_003413424.1| hypothetical protein LM5578_1312 [Listeria monocytogenes 08-5578]
 gi|284994701|ref|YP_003416469.1| hypothetical protein LM5923_1265 [Listeria monocytogenes 08-5923]
 gi|284057121|gb|ADB68062.1| hypothetical protein LM5578_1312 [Listeria monocytogenes 08-5578]
 gi|284060168|gb|ADB71107.1| hypothetical protein LM5923_1265 [Listeria monocytogenes 08-5923]
          Length = 203

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 104/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L++    +P  
Sbjct: 61  VLNQTVIADDSGLIVDALDGAPGVYSARYAGVAHDDAKNN------EKLLKNLEGVEPDN 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNE---------------ISHRANAIKQLEKDLAEVVEK 199


>gi|210621777|ref|ZP_03292806.1| hypothetical protein CLOHIR_00751 [Clostridium hiranonis DSM 13275]
 gi|210154541|gb|EEA85547.1| hypothetical protein CLOHIR_00751 [Clostridium hiranonis DSM 13275]
          Length = 449

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 70/216 (32%), Positives = 108/216 (50%), Gaps = 23/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAK 64
            ++VIA+ N  K+ E+  ++        S  ++ L   E  E G +FE NA+IK+ T +K
Sbjct: 251 KDVVIATGNKHKLQEIGDILKDFDYNVMSLKDVELDGIEIVEDGKTFEHNALIKARTISK 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                +++DDSGLV+D L GKPGI+SAR+A  +  + +  +          +        
Sbjct: 311 LTKKISIADDSGLVVDCLGGKPGIYSARYAGEHATDEENRV------KLFEAMKDVPMED 364

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+S + +  PDG      G V G I +   G+ GFGYD +F P+G+D TFGE+  E
Sbjct: 365 RTARFVSAIGVVLPDGKEFTVRGTVEGKITFEEHGENGFGYDCMFMPDGFDTTFGEIDPE 424

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            KN                +SHRA A K   +  ++
Sbjct: 425 IKNS---------------MSHRANALKKMKEEFIK 445


>gi|330826508|ref|YP_004389811.1| nucleoside-triphosphatase rdgB [Alicycliphilus denitrificans K601]
 gi|329311880|gb|AEB86295.1| Nucleoside-triphosphatase rdgB [Alicycliphilus denitrificans K601]
          Length = 205

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 59/214 (27%), Positives = 102/214 (47%), Gaps = 18/214 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E+ +++ PLG+   +  EL +   EE  ++F ENA+ K+  A+ + 
Sbjct: 1   MKLVLASNNRGKLAELQAMLAPLGVELVAQAELGVGEAEEPFHTFVENALAKARFASAHT 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DD+GL ++   G+PG+ +A +A     ++     ++ +   +        A  S
Sbjct: 61  GLPALADDAGLCVEAFGGQPGVQTAYYATQFGYDKGDANNVRALLEQMEDIKDRRAAMVS 120

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
                V   +  D       G+V+G I   PRG  GFG+DP+     +++TF E+  E K
Sbjct: 121 ---TLVAVRSPQDPEPLIAVGRVAGEIARAPRGAGGFGFDPVMYIPAFEKTFAELPAEVK 177

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           N                 SHR RA +  +     
Sbjct: 178 NAH---------------SHRGRAAQQMLALMRE 196


>gi|303236745|ref|ZP_07323324.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella disiens FB035-09AN]
 gi|302482913|gb|EFL45929.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella disiens FB035-09AN]
          Length = 192

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 75/215 (34%), Positives = 110/215 (51%), Gaps = 25/215 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMP-LGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             IV A++N  K+ E+ +++     I++   +  N+ IPE T  + E NA IKS     N
Sbjct: 1   MKIVFATNNEHKLSEIKNILGSCFEIVSLKDIGCNVDIPE-TAQTLEGNASIKSHFIYDN 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +   +DD+GL +D L+G+PG+HSAR+ E    + D +  M+K+   L      D A R
Sbjct: 60  YHLNCFADDTGLEVDALNGEPGVHSARYDEH--TDHDSEANMRKLLAKL-----GDNANR 112

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +AHF +V+SL         F G+V G I     G  GFGYDPIF P GYD++F E+ E+ 
Sbjct: 113 NAHFRTVISLIIDGEE-HQFEGRVDGKIATEKSGTEGFGYDPIFIPEGYDKSFAELGEQI 171

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           KN                +SHRARA +       +
Sbjct: 172 KNQ---------------ISHRARAVQKLAAYLKQ 191


>gi|89091920|ref|ZP_01164875.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanospirillum sp. MED92]
 gi|89083655|gb|EAR62872.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanospirillum sp. MED92]
          Length = 200

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 69/216 (31%), Positives = 97/216 (44%), Gaps = 23/216 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   IV+AS N  K+ E + ++  LG+      E  +   +ETG SF ENA+IK+  AA+
Sbjct: 1   MSKKIVLASGNKGKLKEFNEVLADLGVEVLPQSEFQVSDADETGLSFVENAIIKARHAAE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PAL+DDSGL +D L G PGI+SAR++     +   +  +      L          
Sbjct: 61  ITGLPALADDSGLEVDALKGAPGIYSARFSGEGATDEKNNTLL------LEKLSGLPAEQ 114

Query: 125 RSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R+A F  VL       D       G   G IV    GQ GFGYDP+F     + T   ++
Sbjct: 115 RTARFRCVLVFMRHANDPTPLICQGTWEGRIVEEASGQNGFGYDPLFWVPELNITSAGLS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            E+KN                LSHR +A        
Sbjct: 175 PEQKN---------------RLSHRGQAVAELKRAI 195


>gi|260910753|ref|ZP_05917408.1| non-canonical purine NTP pyrophosphatase RdgB [Prevotella sp. oral
           taxon 472 str. F0295]
 gi|260635127|gb|EEX53162.1| non-canonical purine NTP pyrophosphatase RdgB [Prevotella sp. oral
           taxon 472 str. F0295]
          Length = 200

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 108/219 (49%), Gaps = 22/219 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL--NLIIPEETGNSFEENAMIKSLTA 62
           +   IV A++N  K+ E+  ++ P  +   S  ++  ++ IPE TG++ +ENA+IK+   
Sbjct: 1   MNTTIVFATNNAHKLEEIRQIM-PSNLQVLSLKDIGCDVDIPE-TGSTLQENALIKAQYV 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            ++ GM   +DD+GL +  L+ +PG++SAR+A  +  +   +  M K+ + L      + 
Sbjct: 59  LEHYGMACFADDTGLEVYALNNEPGVYSARYAGGDGHDS--EANMAKLLSRLADNTHREA 116

Query: 123 AFRSAHFISVLSLA-WPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            FR+   +   S           F G V G I     G  GFGYDP+F PNGY++TF E+
Sbjct: 117 RFRTVIALVAPSDNTLGVNEPMFFEGIVEGHIATERHGTEGFGYDPLFVPNGYEKTFAEL 176

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             + KN                +SHRARA    V    +
Sbjct: 177 GADIKNQ---------------ISHRARAVGKLVQFLSK 200


>gi|269101811|ref|ZP_06154508.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific)
           [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268161709|gb|EEZ40205.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific)
           [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 197

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 97/216 (44%), Gaps = 23/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + +V+A+ N  K+ EM  L+   G    +  + N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MSKLVLATGNQGKVKEMADLLSDFGFNVVAQSDFNVSSVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L G PGI+SAR+A  +  +         I+  L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLQGAPGIYSARYAGEDASD------SANIDKLLVAMENVPEDQR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL +   +         G+  G I+    G+ GFGYDPIF       +  ++  
Sbjct: 115 TARFHCVLVMMRHENDPTPLVCHGRWEGRILTERLGENGFGYDPIFWVPEDQCSSAQLEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             K                 LSHR +A +       
Sbjct: 175 ARK---------------KQLSHRGQALQQLFAALK 195


>gi|260775571|ref|ZP_05884468.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260608752|gb|EEX34917.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 200

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 97/219 (44%), Gaps = 23/219 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           +    IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AA
Sbjct: 1   MNAQKIVLATGNQGKVREMADLLADFGFDVVAQSEFNVSEVAETGTTFIENAIIKARHAA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G+ A++DDSGL +D L G PGI+SAR+A     ++      Q +E  L +       
Sbjct: 61  KETGLAAIADDSGLEVDFLKGAPGIYSARYAGEGASDQ------QNLEKLLDAMQGVPQE 114

Query: 124 FRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            R+A F  VL L     D       GK  G I+   +G  GFGYDP+F     +    E+
Sbjct: 115 QRTARFHCVLVLMRHELDPTPIVCHGKWEGRILTEAQGDNGFGYDPVFFVPEDNCASAEL 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
               K                 LSHR +A K        
Sbjct: 175 EPTRK---------------KQLSHRGKALKQLFATLSE 198


>gi|225021579|ref|ZP_03710771.1| hypothetical protein CORMATOL_01600 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224945570|gb|EEG26779.1| hypothetical protein CORMATOL_01600 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 207

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 65/224 (29%), Positives = 111/224 (49%), Gaps = 28/224 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKN 65
             I++AS+N  K HE+ +++   GI   +  ++     P E G +F +NA+IK+   A++
Sbjct: 1   MKILLASNNPKKAHELRTILANSGIEILTLADVPHYDEPIEDGRTFADNALIKARAGAQH 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+  ++DDSG  ++ L+G PG+ SARW+  +  ++  ++ +      L+         R
Sbjct: 61  TGLVTIADDSGFTVEELNGCPGVLSARWSGQHGDDQANNILL------LKQMAHVPEERR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGY---DRTFGEMT 182
            A F+SV +L  P+G     +G+  G ++  PRG  GFGYDP+F PN      R+  +++
Sbjct: 115 QAAFVSVCALVVPNGEEHVVTGQWDGWMLTEPRGDNGFGYDPLFLPNEEFPNGRSSAQLS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD---NCLRIDE 223
             EKN                LSHR +A    V       ++ E
Sbjct: 175 PAEKNA---------------LSHRGKALAQLVPIVTQLSQLSE 203


>gi|62900267|sp|Q7W6C6|NTPA_BORPA RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
          Length = 213

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 66/213 (30%), Positives = 94/213 (44%), Gaps = 18/213 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E  +L  PLGI      EL +    E   +F ENA+ K+  A+++ 
Sbjct: 11  RRVVLASNNAGKLREFSALFAPLGIELVPQSELGVSEAAEPHATFVENALAKARHASRHT 70

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +  L G PG+HSAR+A+   G R        +   L +       +  
Sbjct: 71  GLPALADDSGLCVVALGGAPGVHSARYAQQPGGARSDAANNALLVRELAAAGDRRAWY-- 128

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
              +  L     D       G   G IV  P G+ GFGYDP F       T  ++  E K
Sbjct: 129 -VALLALVRTENDPCPLIGEGLWHGEIVDAPAGEHGFGYDPHFYLPQQGCTAAQLAPEHK 187

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           N                +SHRA+A    +D   
Sbjct: 188 N---------------RISHRAQALAQLLDKLR 205


>gi|33597534|ref|NP_885177.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Bordetella parapertussis 12822]
 gi|33573962|emb|CAE38280.1| conserved hypothetical protein [Bordetella parapertussis]
          Length = 233

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 66/213 (30%), Positives = 94/213 (44%), Gaps = 18/213 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E  +L  PLGI      EL +    E   +F ENA+ K+  A+++ 
Sbjct: 31  RRVVLASNNAGKLREFSALFAPLGIELVPQSELGVSEAAEPHATFVENALAKARHASRHT 90

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +  L G PG+HSAR+A+   G R        +   L +       +  
Sbjct: 91  GLPALADDSGLCVVALGGAPGVHSARYAQQPGGARSDAANNALLVRELAAAGDRRAWY-- 148

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
              +  L     D       G   G IV  P G+ GFGYDP F       T  ++  E K
Sbjct: 149 -VALLALVRTENDPCPLIGEGLWHGEIVDAPAGEHGFGYDPHFYLPQQGCTAAQLAPEHK 207

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           N                +SHRA+A    +D   
Sbjct: 208 N---------------RISHRAQALAQLLDKLR 225


>gi|303258092|ref|ZP_07344100.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Burkholderiales bacterium 1_1_47]
 gi|330998695|ref|ZP_08322424.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Parasutterella excrementihominis YIT 11859]
 gi|302859111|gb|EFL82194.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Burkholderiales bacterium 1_1_47]
 gi|329576434|gb|EGG57946.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Parasutterella excrementihominis YIT 11859]
          Length = 199

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 63/216 (29%), Positives = 96/216 (44%), Gaps = 21/216 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   IV+AS+N  K+ EM  L+ P+     S   L +   EE   +F ENA+ K+  AAK
Sbjct: 1   MSKKIVLASNNKKKMKEMQELLAPMSAEVISQGSLGIPSAEEPFGTFVENALAKARWAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           ++G+PA++DDSG+  D L G PG+ SAR+A   + +   +         ++     D   
Sbjct: 61  HSGLPAIADDSGICSDALKGAPGVLSARFAGEPSSDAANNA------KLIKELEDKDNRN 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                + V      D          +G I + P+G+ GFGYDP F      +T  +MT E
Sbjct: 115 AHYTCVIVAVRDENDPEPLIAIDFWNGTIGYEPKGEGGFGYDPFFIVTPDGKTAAQMTAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           EKN                +SHR +A +        
Sbjct: 175 EKNA---------------VSHRGKAMRKMRTLLTE 195


>gi|257092563|ref|YP_003166204.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257045087|gb|ACV34275.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 195

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 63/215 (29%), Positives = 97/215 (45%), Gaps = 21/215 (9%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E+D+++ PLG       +L +   EE   +F EN++ K+  A++ A
Sbjct: 1   MKLVLASNNAKKLKELDAILAPLGWELVPQGQLGIPEVEEPHCTFVENSLAKARHASRLA 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +D   G PG+ SAR+A     +   +      E  L +          
Sbjct: 61  GLPALADDSGLCVDAFGGAPGVFSARYAGEPKSDARNN------EKLLSALGETAARGAR 114

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
              + V      D       G+  G I+   RG  GFGYDP+F     D++  E+   EK
Sbjct: 115 FVSVIVFVRHADDPQPIIAEGEWHGEILSAARGDDGFGYDPLFYIRELDKSAAELDAAEK 174

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           N                 SHR +A    V+   R+
Sbjct: 175 NRR---------------SHRGQALARLVERLQRL 194


>gi|304309824|ref|YP_003809422.1| Xanthosine triphosphate pyrophosphatase [gamma proteobacterium
           HdN1]
 gi|301795557|emb|CBL43755.1| Xanthosine triphosphate pyrophosphatase [gamma proteobacterium
           HdN1]
          Length = 204

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 68/215 (31%), Positives = 103/215 (47%), Gaps = 23/215 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +VIA+ N  K+ E+  ++ P      S     +   EETG SF ENA++K+  A K  
Sbjct: 5   RTLVIATGNAGKLREIQQILAPFCWEIVSQKVYCVTDAEETGLSFIENAILKARHACKQT 64

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSG+ +D L+G PGI+SAR++ ++  +       QK+ +ALR       A R+
Sbjct: 65  GLPALADDSGIEVDALNGAPGIYSARYSGNDATDA---RNNQKLLDALREIP---EAQRT 118

Query: 127 AHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           A F  V++L     D       G   G I+  P+G  GFGYDP+F    +  +  E+   
Sbjct: 119 ARFQCVIALMRHANDPTPLVCQGTWEGRILHAPQGNNGFGYDPLFWVESHQCSSAELEPT 178

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            K                 +SHRA+A     +   
Sbjct: 179 VK---------------SQISHRAQALLKLTEQMK 198


>gi|164686704|ref|ZP_02210732.1| hypothetical protein CLOBAR_00299 [Clostridium bartlettii DSM
           16795]
 gi|164604094|gb|EDQ97559.1| hypothetical protein CLOBAR_00299 [Clostridium bartlettii DSM
           16795]
          Length = 449

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 69/216 (31%), Positives = 105/216 (48%), Gaps = 23/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLTAAK 64
           N++VIA+ N  K+ E+  ++  L     S  +++L     EE G +FE NA+IK+   AK
Sbjct: 251 NDVVIATGNAHKLEEIGDILKDLDYNIYSLKDVDLGGLEIEENGKTFEHNALIKAREVAK 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
              M  ++DDSGL +D +  KPGI+SAR+A  N  + +           L+S      + 
Sbjct: 311 RTKMITIADDSGLEVDAIGKKPGIYSARYAGENATDEENRA------KLLKSLGNTPMSQ 364

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F+  +++ +PDG      G   G I +  +G  GFGYD +F  N YD+TF E+   
Sbjct: 365 RGARFVCCIAVVFPDGKEFVVRGTCEGTIGFEEKGSNGFGYDNLFIVNKYDKTFAELPAT 424

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            KN                +SHRA A +   +   R
Sbjct: 425 IKNA---------------ISHRANALQLMKEELSR 445


>gi|86146418|ref|ZP_01064742.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           sp. MED222]
 gi|85835897|gb|EAQ54031.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           sp. MED222]
          Length = 199

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 99/217 (45%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + IV+A+ N  K+ EM  ++   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MSKIVLATGNQGKVREMADILSEFGFDIVAQSEFNVSEVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR++     ++      Q IE  L +    D   R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYSGEGATDK------QNIEKLLDAMQGVDVEKR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G+ GFGYDP+F     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPLVCHGKWEGRILTEEHGENGFGYDPVFFVPEDNCASAELES 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A          
Sbjct: 175 SRK---------------KQLSHRGKALASLFKTLKE 196


>gi|260584033|ref|ZP_05851781.1| glutamate racemase [Granulicatella elegans ATCC 700633]
 gi|260158659|gb|EEW93727.1| glutamate racemase [Granulicatella elegans ATCC 700633]
          Length = 480

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 71/215 (33%), Positives = 103/215 (47%), Gaps = 22/215 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTA 62
           + +  +VIA+ N  K  E  S+  P G    + L+   L    ETG +FEENA +K+ T 
Sbjct: 277 MSQKELVIATKNAGKAKEFASIFEPKGYSVKTLLDFPELEDVAETGQTFEENARLKAETI 336

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A+      L+DDSGL +D L+G+PG++SAR+A +   +   +         L        
Sbjct: 337 AERLQKIVLADDSGLCVDALEGQPGVYSARYAGNQKSDAANNA------KLLAELGELPS 390

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             RSAHF   L +A P+       G   G I   P G+ GFGYDP+F      +TFG+++
Sbjct: 391 DKRSAHFHCCLVMAAPNHESLVVEGICDGEIAKFPSGEGGFGYDPLFFVPEIQKTFGQLS 450

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
            EEKN                +SHRA+A    V+ 
Sbjct: 451 REEKNQ---------------ISHRAKAVNLLVEQ 470


>gi|226940858|ref|YP_002795932.1| deoxyribonucleotide triphosphate pyrophosphatase [Laribacter
           hongkongensis HLHK9]
 gi|226715785|gb|ACO74923.1| NtpA [Laribacter hongkongensis HLHK9]
          Length = 198

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 62/218 (28%), Positives = 97/218 (44%), Gaps = 22/218 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGI-MTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           + + +V+AS+N  K+ E  +L+ PLG+        LN+   EE   +F ENA+ K+  A+
Sbjct: 1   MFSRLVLASNNAGKLREFSALLAPLGVDEVLPQRALNVPEAEEPYGTFLENALTKARHAS 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G+PAL+DDSGL +D L G PG+ SAR+A     +   +  +      L     +   
Sbjct: 61  RLTGLPALADDSGLCVDTLGGAPGVLSARFAGEPKSDARNNAYL------LERLAGNTRR 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
               + + VL  +  D           G I+  PRG  GFGYDP+F    +  +  E+  
Sbjct: 115 RGHYYCVLVLVRSEDDPQPIVADAMWPGEILTAPRGDGGFGYDPLFWLPDHQCSVAELDP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
             KN                 SHR +A +  V     +
Sbjct: 175 ATKNRD---------------SHRGQALRQLVSKLEAL 197


>gi|47097380|ref|ZP_00234932.1| HAM1 family protein [Listeria monocytogenes str. 1/2a F6854]
 gi|254828599|ref|ZP_05233286.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes FSL N3-165]
 gi|254898600|ref|ZP_05258524.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family protein
           [Listeria monocytogenes J0161]
 gi|254911910|ref|ZP_05261922.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes J2818]
 gi|254936236|ref|ZP_05267933.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes F6900]
 gi|47014252|gb|EAL05233.1| HAM1 family protein [Listeria monocytogenes str. 1/2a F6854]
 gi|258600997|gb|EEW14322.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes FSL N3-165]
 gi|258608826|gb|EEW21434.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes F6900]
 gi|293589870|gb|EFF98204.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes J2818]
          Length = 203

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 105/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L++    +P  
Sbjct: 61  LLNQTVIADDSGLIVDALDGAPGVYSARYAGVAHDDAKNN------EKLLKNLEGVEPDK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    + + + EK
Sbjct: 175 KKNE---------------ISHRANAIKQLEKDLVEVVEK 199


>gi|262273745|ref|ZP_06051558.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific)
           [Grimontia hollisae CIP 101886]
 gi|262222160|gb|EEY73472.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific)
           [Grimontia hollisae CIP 101886]
          Length = 199

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 68/220 (30%), Positives = 97/220 (44%), Gaps = 23/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + +V+A+ N  K+ EM  L+   G+   +  E  +   EETG +F ENA+IK+  AAK 
Sbjct: 1   MSKVVLATGNAGKVKEMADLLQDFGLEVFAQSEFAVKDAEETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PG++SAR+A    G++        +E  L          R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGVYSARFAGEGKGDQ------ANLEKLLECMADAPDDKR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL       D       G   G I   P G  GFGYDP+F    Y  T   +  
Sbjct: 115 TARFHCVLVYMRHANDPTPLVCHGTFEGSIAREPSGSHGFGYDPVFFVEEYGCTLANIEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
             K                 +SHR +A K          +
Sbjct: 175 AVK---------------KQISHRGQALKKLFAAMREEKK 199


>gi|227529709|ref|ZP_03959758.1| nucleoside-triphosphatase [Lactobacillus vaginalis ATCC 49540]
 gi|227350375|gb|EEJ40666.1| nucleoside-triphosphatase [Lactobacillus vaginalis ATCC 49540]
          Length = 198

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 109/220 (49%), Gaps = 23/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
            +++VIA+ N  K  E   +  P  I   +  + +  I   E G++F ENA IK+ T   
Sbjct: 1   MDSLVIATKNQGKAREYREMFAPYNIDIKTLADFSTPIKINENGSTFLENATIKAQTVMA 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+P ++DDSGLV+D L+G PG+HSAR+A  +  + +           LR         
Sbjct: 61  KLGVPVMADDSGLVVDALNGAPGVHSARYAGDHDDQANNKKL-------LRELAGVPTMK 113

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+AHF + +    PDG     +G+V G I+  PRG+ GFGYDP+F    +D +  E+T E
Sbjct: 114 RTAHFHTTIVALKPDGAKLVANGRVDGRILTSPRGKNGFGYDPLFYVEKFDCSMAELTAE 173

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHR +A + F+ +      K
Sbjct: 174 QKNS---------------ISHRGQALEEFLQHFAEWWNK 198


>gi|224499090|ref|ZP_03667439.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family protein
           [Listeria monocytogenes Finland 1988]
          Length = 203

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 104/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L++    +P  
Sbjct: 61  LLNQTVIADDSGLIVDALDGAPGVYSARYAGVAHDDAKNN------EKLLKNLEGVEPDN 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTTFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNE---------------ISHRANAIKQLEKDLAEVVEK 199


>gi|261250159|ref|ZP_05942735.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           orientalis CIP 102891]
 gi|260939275|gb|EEX95261.1| nucleoside 5-triphosphatase RdgB (dHAPTP dITP XTP-specific) [Vibrio
           orientalis CIP 102891]
          Length = 199

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 96/217 (44%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+A+ N  K+ EM  L+   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MKKIVLATGNQGKVREMADLLSDFGFDVVAQSEFNVSEVAETGATFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ A++DDSGL +D L G PGI+SAR+A     ++      Q +E  L +      A R
Sbjct: 61  TGLAAIADDSGLEVDALKGAPGIYSARYAGEGATDQ------QNLEKLLEAMKEVPEAER 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G  GFGYDPIF     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGDNGFGYDPIFFVPEDNCASAELEP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A K        
Sbjct: 175 VRK---------------KQLSHRGKALKTLFATLSE 196


>gi|325127749|gb|EGC50658.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis N1568]
          Length = 199

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 63/211 (29%), Positives = 85/211 (40%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS NV K+ E  +L  P GI      E  +    E   +F ENA+ K+  AA+ +G
Sbjct: 7   KIVLASGNVGKLEEFGNLFKPYGITVLPQSEFGIPECPEPYPTFVENALAKARHAAEYSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A     + +                         
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYA-----DDNPKSDTANNLKLATELAGKADKSCCY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P GQ GFGYDP F    + +T  E+  E KN
Sbjct: 122 VCVLVFVRHQDDPRPIIAEGVWHGQWHGTPLGQNGFGYDPYFYLPEHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALADLIRKL 197


>gi|29348537|ref|NP_812040.1| putative deoxyribonucleoside-triphosphatase [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|62900284|sp|Q8A327|NTPA_BACTN RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|29340442|gb|AAO78234.1| putative xanthosine triphosphate pyrophosphatase [Bacteroides
           thetaiotaomicron VPI-5482]
          Length = 193

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 108/218 (49%), Gaps = 27/218 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTA 62
           ++  +V A++N  K+ E+ +++    +   S  +++    IPE T  + E NA++KS   
Sbjct: 1   MKRKLVFATNNAHKLEEIAAILGDK-VELLSLNDIDCHTDIPE-TAETLEGNALLKSSFI 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            +N  +   +DD+GL ++ L+G PG++SAR+AE    +      M+K+ + L        
Sbjct: 59  YRNYQLDCFADDTGLEVEALNGAPGVYSARYAEGEGHDAQ--ANMRKLLHELEG-----K 111

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F + +SL         F G + G I+   RG  GFGYDPIF+P GY++TF E+ 
Sbjct: 112 ENRKAQFRTAISLILDGKEYL-FEGVIKGEIIKEKRGDSGFGYDPIFKPEGYEQTFAELG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            E KN                +SHRA A +   +   R
Sbjct: 171 NETKNK---------------ISHRALAVQKLCEFLQR 193


>gi|227833920|ref|YP_002835627.1| putative xanthosine triphosphate pyrophosphatase [Corynebacterium
           aurimucosum ATCC 700975]
 gi|262184923|ref|ZP_06044344.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Corynebacterium aurimucosum ATCC 700975]
 gi|227454936|gb|ACP33689.1| putative xanthosine triphosphate pyrophosphatase [Corynebacterium
           aurimucosum ATCC 700975]
          Length = 203

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 109/221 (49%), Gaps = 25/221 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN----LIIPEETGNSFEENAMIKSLT 61
              +++AS+N  K+ E++ ++   GI     L L+       P E G +F +NA+IK+  
Sbjct: 1   MVKLLVASNNAKKLKELEKILADAGIAGIELLPLSAVEAYPEPVEDGRTFADNALIKARA 60

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
             ++ G+  ++DDSGL ++ L+G PG+ SARW+  +  +   +  +      L       
Sbjct: 61  GVQHTGLATIADDSGLAVEELNGMPGVLSARWSGGHGDDEANNRLL------LGQMSDVP 114

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R+A F+SV +L  PDG      G+  G ++  P+G+ GFGYDP+FQP G  R+  EM
Sbjct: 115 AERRAAAFVSVCALVTPDGQEHVVEGRWPGSLLTAPQGENGFGYDPLFQPEGESRSAAEM 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           + EEKN                +SHR RA     +    + 
Sbjct: 175 SPEEKNA---------------VSHRGRALAQLREPLAALA 200


>gi|46199592|ref|YP_005259.1| nucleoside-triphosphatase [Thermus thermophilus HB27]
 gi|62900235|sp|Q72I42|NTPA_THET2 RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|46197218|gb|AAS81632.1| nucleoside-triphosphatase [Thermus thermophilus HB27]
          Length = 207

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 74/219 (33%), Positives = 118/219 (53%), Gaps = 24/219 (10%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M + +   +V+ + N  K+ E+   + PLG    +  +  L +P+E G +F ENA++K+ 
Sbjct: 1   MLRGM--KVVLTTGNPGKVRELKEGLAPLGWTLLTLADFALRMPKEEGATFLENALLKAA 58

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             AK  G+PAL+DDSGL +  L G+PG++SAR+      +R+ ++ + +    L+ +   
Sbjct: 59  YVAKATGLPALADDSGLEVYALGGEPGVYSARYGG-RATDRERNVYLLERMRHLKGEE-- 115

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R A F++VL LA+PDGH E + G V G+I+  PRG+ GFGYDP+F      +TF E
Sbjct: 116 ----RKARFVAVLVLAYPDGHAEAYEGSVEGVILEAPRGEGGFGYDPLFYVPEAGKTFAE 171

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           M  EEK                  SHR +A +  ++   
Sbjct: 172 MGLEEK---------------ARYSHRGKALRALLEAYK 195


>gi|150388787|ref|YP_001318836.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Alkaliphilus metalliredigens QYMF]
 gi|149948649|gb|ABR47177.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Alkaliphilus metalliredigens QYMF]
          Length = 203

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 104/214 (48%), Gaps = 24/214 (11%)

Query: 5   IENNIV-IASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLT 61
           +++ IV IA+ N  K+ E+  ++    I   S  ++ L      E G +FE+NA IK+  
Sbjct: 1   MKHQIVVIATGNKHKLEEIQEILKTFPIEIKSMKDVGLEGLEIIEDGVTFEDNAKIKARI 60

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
             +  G   ++DDSGL +D L+ +PG++SAR+A  N  +++ +      E  L+      
Sbjct: 61  IMEKTGYVTIADDSGLEVDYLNNEPGVYSARFAGENATDQENN------EKLLKLLKDIP 114

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F+  ++  +P+G      G+  G+I   PRG  GFGYDP+F    Y  TF E+
Sbjct: 115 MESRKARFVCAMAAIFPNGEEIVLRGECPGVIDTVPRGTGGFGYDPLFIVPEYQLTFAEL 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
             E KN                +SHRARA +   
Sbjct: 175 GAERKNE---------------ISHRARALEKMK 193


>gi|217964695|ref|YP_002350373.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Listeria monocytogenes HCC23]
 gi|217333965|gb|ACK39759.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Listeria monocytogenes HCC23]
 gi|307570744|emb|CAR83923.1| HAM1 family NTPase protein [Listeria monocytogenes L99]
          Length = 203

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 104/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L++    +P  
Sbjct: 61  VLNQTVIADDSGLIVDALDGAPGVYSARYAGVAHDDAKNN------EKLLKNLEGVEPDK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNE---------------ISHRANAIKQLEKDLAEVVEK 199


>gi|257869443|ref|ZP_05649096.1| ribonuclease PH/Ham1 [Enterococcus gallinarum EG2]
 gi|257803607|gb|EEV32429.1| ribonuclease PH/Ham1 [Enterococcus gallinarum EG2]
          Length = 450

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 75/221 (33%), Positives = 101/221 (45%), Gaps = 22/221 (9%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTA 62
           + E  IVIA+ N  K  E  ++    G    +  +   L   EETG +FEENA +K+ T 
Sbjct: 247 IPEKTIVIATGNPGKAREFTAVFGAAGYDVRTLKDYPALPDVEETGTTFEENARLKAETI 306

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           AK  G P L+DDSGL +D L G+PG++SAR+A     +   +         L        
Sbjct: 307 AKILGRPVLADDSGLKVDALGGRPGVYSARFAGEQKSDAANNA------KLLYELTDIPD 360

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F   L  A PD      +    G I   PRG+ GFGYDP+F P G D+T  EM+
Sbjct: 361 EQRTAQFHCTLVFAAPDKESLVVAADWPGRIGRIPRGENGFGYDPLFIPVGSDKTAAEMS 420

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
            EEKN                +SHR +A     +      E
Sbjct: 421 GEEKNQ---------------VSHRGQAIAKLRNVWQEWLE 446


>gi|238918243|ref|YP_002931757.1| deoxyribonucleotide triphosphate pyrophosphatase [Edwardsiella
           ictaluri 93-146]
 gi|238867811|gb|ACR67522.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family,
           putative [Edwardsiella ictaluri 93-146]
          Length = 197

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 68/216 (31%), Positives = 102/216 (47%), Gaps = 23/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             ++V+A+ N  K+ E+ SL+   G+   +   L +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQHVVLATGNAGKVRELASLLTDFGLDIVAQSTLGIDGAEETGLTFIENAILKARHAARL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G+PA++DDSGL +D L G PGI+SAR+A  +  +R        +E  L +        R
Sbjct: 61  SGLPAIADDSGLAVDALGGAPGIYSARYAGEDASDRT------NMEKLLAALQDVPADQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D       G   G I   P G  GFGYDPIF       T  +++ 
Sbjct: 115 QARFHCVLVYLRHADDPTPLVCHGVWEGEIADAPSGDGGFGYDPIFFVPAQGCTAAQLSR 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           E+K                 +SHR +A +  +D   
Sbjct: 175 EQK---------------RTISHRGQALQQLLDRIR 195


>gi|116493004|ref|YP_804739.1| xanthosine triphosphate pyrophosphatase [Pediococcus pentosaceus
           ATCC 25745]
 gi|116103154|gb|ABJ68297.1| Xanthosine triphosphate pyrophosphatase [Pediococcus pentosaceus
           ATCC 25745]
          Length = 198

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 77/220 (35%), Positives = 108/220 (49%), Gaps = 23/220 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAA 63
           + N I+IA+ N  K+ E   +    GI+  S  ++N      E G SFEENA +K+   A
Sbjct: 1   MNNEILIATKNDGKLKEFKQIFEQKGIVVKSLKDINDDVEIVENGLSFEENARLKADGYA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K+ G+P L+DDSGL ID L+G+PGI SAR+A  +    +           L         
Sbjct: 61  KSIGIPVLADDSGLEIDALNGRPGIFSARYAGDHNDAANNA-------KVLSELGGIPDE 113

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F S + +  PDG     +G + G I+  PRG  GFGYDP+F     ++T  EMT 
Sbjct: 114 KRTATFHSTVVVRKPDGSELVANGNLRGRILAVPRGDNGFGYDPLFFVEAKNKTLAEMTR 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EEKN                +SHRA A +  + N  +  E
Sbjct: 174 EEKNK---------------ISHRALAIEDLLVNFDKFWE 198


>gi|160884847|ref|ZP_02065850.1| hypothetical protein BACOVA_02837 [Bacteroides ovatus ATCC 8483]
 gi|156109882|gb|EDO11627.1| hypothetical protein BACOVA_02837 [Bacteroides ovatus ATCC 8483]
          Length = 194

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 65/217 (29%), Positives = 103/217 (47%), Gaps = 27/217 (12%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLT 61
           +++  +V A++N  K+ E+ +++    +   S  ++     IPE T  + E NA++KS  
Sbjct: 1   MMKRKLVFATNNAHKLEEVAAILGDQ-VELLSLNDIGCQTDIPE-TAETLEGNALLKSSY 58

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
             KN  +   +DD+GL ++ L+G PG++SAR+AE    +   +M     E          
Sbjct: 59  IYKNYHLDCFADDTGLEVEALNGAPGVYSARYAEGEGHDAQANMLKLLHE-------LDG 111

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F + +SL         F G + G I+   RG  GFGYDP+F P GYDRTF E+
Sbjct: 112 KENRKAQFRTAISLILDGKEYL-FEGVIKGEIIKEKRGDSGFGYDPVFMPEGYDRTFAEL 170

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
             + KN                +SHRA A +   +  
Sbjct: 171 GNDIKNQ---------------ISHRALAVQKLCEFL 192


>gi|291547043|emb|CBL20151.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ruminococcus sp. SR1/5]
          Length = 194

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 100/214 (46%), Gaps = 22/214 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAK 64
              I+ A+ N DK+ E+  ++    +   S  +  +    +E G SFEENAMIK+   +K
Sbjct: 1   MKKIIFATGNEDKMKEIRRILADPSLEILSLKDAGIHADIDENGKSFEENAMIKAEAISK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G   L+DDSGL ID L+ +PGI+SAR+   +T     +  + +               
Sbjct: 61  MTGEIVLADDSGLEIDYLNKEPGIYSARYMGEDTSYHIKNANLIQRLE------GVPDEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+  ++  +PDG  +     + G I +  +G+ GFGYDPIF    Y  T  E++ E
Sbjct: 115 RTARFVCAIAAVFPDGRRKTVRAAMEGRIGYEEKGENGFGYDPIFYLPEYGCTSAELSME 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                +SHR +A     +  
Sbjct: 175 EKN---------------RISHRGKALCLIKEEL 193


>gi|254830007|ref|ZP_05234662.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family protein
           [Listeria monocytogenes 10403S]
          Length = 203

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 104/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L++    +P  
Sbjct: 61  LLNQTVIADDSGLIVDALDGAPGVYSARYAGVAHDDAKNN------EKLLKNLEGVEPDN 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNE---------------ISHRANAIKQLEKDLAEVVEK 199


>gi|169829486|ref|YP_001699644.1| HAM1-like protein [Lysinibacillus sphaericus C3-41]
 gi|168993974|gb|ACA41514.1| HAM1-like protein [Lysinibacillus sphaericus C3-41]
          Length = 197

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 106/219 (48%), Gaps = 23/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              +VIA+ N  K  + ++L  PLG    +  E+   +  EETG +FEENA++K+   AK
Sbjct: 1   MKQVVIATKNKGKAKDFEALFGPLGYEVVTMFEVAPDMEIEETGTTFEENAILKAEALAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           N G   ++DDSGL +D L+G+PG++SAR+A  +  E +           L +    +   
Sbjct: 61  NLGTIVIADDSGLAVDALNGEPGVYSARYAGDHDDEANMVKL-------LENLQGVEDDK 113

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   +++A PD +     G   G+I    RG  GFGYDPIF     +R   E+T E
Sbjct: 114 RTARFCCCIAIAGPDFNTTTVFGTCEGVIAHEKRGTNGFGYDPIFFVPSLNRMMAELTPE 173

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EK                 +SHR  A +   +    + +
Sbjct: 174 EK---------------GAISHRGNAIRKLKEQLPNLMK 197


>gi|209519147|ref|ZP_03267952.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Burkholderia sp. H160]
 gi|209500447|gb|EEA00498.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Burkholderia sp. H160]
          Length = 220

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/217 (29%), Positives = 97/217 (44%), Gaps = 18/217 (8%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           +    +V+AS+N  K+ E  +L+   GI   +  ELN+   EE   +F ENA+ K+  AA
Sbjct: 20  MPLKKVVLASNNAGKLREFAALLGAAGIELVAQGELNVPETEEPHPTFVENALAKARHAA 79

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G+PAL+DDSGL +  L G PG++SAR+A+   GE+       ++   L         
Sbjct: 80  KLTGLPALADDSGLCVRALRGAPGVYSARFAQLAGGEKSDAANNARLVAELHGASDRRGY 139

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +     +  L     D       G+  G I+  PRG+ GFGYDP F     + +  E+  
Sbjct: 140 YC---CVLALVRHADDPEPLIAEGRWHGEILDAPRGEHGFGYDPYFYLPSLNASAAELEP 196

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             KN                 SHRA A +  +     
Sbjct: 197 AVKNAS---------------SHRAIALRQLLARLSE 218


>gi|126652648|ref|ZP_01724809.1| hypothetical protein BB14905_22818 [Bacillus sp. B14905]
 gi|126590497|gb|EAZ84615.1| hypothetical protein BB14905_22818 [Bacillus sp. B14905]
          Length = 197

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 105/219 (47%), Gaps = 23/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              +VIA+ N  K  + ++L  PLG    +  E+   +  EETG +FEENA++K+   AK
Sbjct: 1   MKQVVIATKNKGKAKDFEALFGPLGYEVVTMFEVAPDMEIEETGTTFEENAILKAEALAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           N G   ++DDSGL +D L+G+PG++SAR+A  +  E +           L +    +   
Sbjct: 61  NLGTIVIADDSGLAVDALNGEPGVYSARYAGDHDDEANMVKL-------LENLQGVEDGK 113

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   +++A PD       G   G+I    RG  GFGYDPIF     +R   E+T E
Sbjct: 114 RTARFCCCIAIAGPDFETTTVFGTCEGVIAHEKRGTNGFGYDPIFFVPSLNRMMAELTPE 173

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EK                 +SHR  A +   +    + +
Sbjct: 174 EK---------------GAISHRGNAIRKLKEQLPNLIK 197


>gi|281491801|ref|YP_003353781.1| purine NTP pyrophosphatase [Lactococcus lactis subsp. lactis KF147]
 gi|281375515|gb|ADA65025.1| Purine NTP pyrophosphatase, rdgB/HAM1 family [Lactococcus lactis
           subsp. lactis KF147]
 gi|326406819|gb|ADZ63890.1| purine NTP pyrophosphatase [Lactococcus lactis subsp. lactis CV56]
          Length = 201

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 69/221 (31%), Positives = 98/221 (44%), Gaps = 21/221 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAA 63
           +E  ++IA+ N  K  E   L    G       +   L   EETG +FEENA +K+   A
Sbjct: 1   MEKTLIIATRNSGKTKEFKKLFADFGYEIKDLTDYPELPEIEETGTTFEENARLKAEQIA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G   + DDSGL +DVL G PGI S R++  +  +               +  A  P 
Sbjct: 61  EITGQVVIGDDSGLCVDVLGGLPGIWSHRFSAPDPTDEKNIAK----LLHELAPTAITPE 116

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            RSAHF + L  A P            G I   P+G+ GFGYDPIF  + + RT  E++E
Sbjct: 117 RRSAHFHTTLVAAKPGRESLVVEADWDGYIALAPKGENGFGYDPIFMVDAF-RTAAELSE 175

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +EKN                +SHR +A +  +       +K
Sbjct: 176 KEKNQ---------------VSHRGQALRKLMAELPEWLDK 201


>gi|261346266|ref|ZP_05973910.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Providencia rustigianii DSM 4541]
 gi|282565575|gb|EFB71110.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Providencia rustigianii DSM 4541]
          Length = 197

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 62/215 (28%), Positives = 103/215 (47%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K++E+  L+   G+   +   L +   EETG +F ENA++K+  A+  
Sbjct: 1   MQKVVLATGNPGKVNELADLLRDFGMDIVAQTSLGVESAEETGLTFIENAILKARHASAQ 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSG+ +D L G PGI+SAR+A     ++     + K+ +A++    +     
Sbjct: 61  TGLPAIADDSGISVDALGGAPGIYSARYAGEEASDQ---QNLDKLLDAMKDIPDNQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             + + V      D     F G+  GI+    +GQ GFGYDPIF       T  E+T+ +
Sbjct: 117 QFNCVLVYLRHAEDPTPLVFHGRWHGILTREAKGQGGFGYDPIFYVPELGCTSAELTKAQ 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K                 +SHR +A    +D    
Sbjct: 177 K---------------QAVSHRGKALAMMLDVLKN 196


>gi|29653406|ref|NP_819098.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Coxiella burnetii RSA 493]
 gi|153207125|ref|ZP_01945904.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Coxiella burnetii 'MSU Goat Q177']
 gi|154706051|ref|YP_001425365.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Coxiella
           burnetii Dugway 5J108-111]
 gi|161831286|ref|YP_001596039.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Coxiella
           burnetii RSA 331]
 gi|165923905|ref|ZP_02219737.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Coxiella burnetii RSA 334]
 gi|212219451|ref|YP_002306238.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Coxiella
           burnetii CbuK_Q154]
 gi|62900273|sp|Q83FA3|NTPA_COXBU RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|29540668|gb|AAO89612.1| xanthosine triphosphate pyrophosphatase [Coxiella burnetii RSA 493]
 gi|120576786|gb|EAX33410.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Coxiella burnetii 'MSU Goat Q177']
 gi|154355337|gb|ABS76799.1| xanthosine triphosphate pyrophosphatase [Coxiella burnetii Dugway
           5J108-111]
 gi|161763153|gb|ABX78795.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Coxiella burnetii RSA 331]
 gi|165916659|gb|EDR35263.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Coxiella burnetii RSA 334]
 gi|212013713|gb|ACJ21093.1| xanthosine triphosphate pyrophosphatase [Coxiella burnetii
           CbuK_Q154]
          Length = 200

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 76/217 (35%), Positives = 107/217 (49%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  K+ EM  L+  L I      E ++   EETG++F ENA+IK+  AAK 
Sbjct: 1   MLEIVLASQNSSKLAEMQELLRDLEIKFIPQTEFSVPDIEETGSTFVENAIIKARHAAKQ 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PAL+DDSGL I  L+  PG+ S+R+A  N  +       ++I+  L +  A D + R
Sbjct: 61  TGLPALADDSGLTIAALNSAPGVFSSRYAGKNATDA------ERIQKVLEALEAADDSDR 114

Query: 126 SAHFISVLSLAWPDGHV--ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  V++L   +         G   G I   PRG+ GFGYDPIF    + RT  E+  
Sbjct: 115 SASFHCVIALMENENDPAPLICHGVWEGEIAREPRGKNGFGYDPIFYVPSHQRTAAELDP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +EKN                +SHR +A +        
Sbjct: 175 QEKNA---------------ISHRGQALEQLSTVLTE 196


>gi|153807055|ref|ZP_01959723.1| hypothetical protein BACCAC_01332 [Bacteroides caccae ATCC 43185]
 gi|149130175|gb|EDM21385.1| hypothetical protein BACCAC_01332 [Bacteroides caccae ATCC 43185]
          Length = 194

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 66/217 (30%), Positives = 104/217 (47%), Gaps = 27/217 (12%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLT 61
           +++  +V A++N  K+ E+ +++    I   S  ++     IPE T  + E NA++KS  
Sbjct: 1   MMKRKLVFATNNAHKLEEVAAILGDQ-IELLSLNDIGCHTDIPE-TAETLEGNALLKSSF 58

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
             KN G+   +DD+GL ++ LDG PG++SAR+A     +   +M     E          
Sbjct: 59  IFKNYGLDCFADDTGLEVEALDGAPGVYSARYAGGEGHDAQANMLKLLHE-------LEG 111

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F + +SL         F G + G I+   RG  GFGYDP+F+P GY+RTF E+
Sbjct: 112 KENRKAQFRTAISLILDGKEYL-FEGVIKGEIIREKRGDSGFGYDPVFKPEGYERTFAEL 170

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
             + KN                +SHRA A +   +  
Sbjct: 171 GNDVKNK---------------ISHRALAVQKLCEFL 192


>gi|325207682|gb|ADZ03134.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis NZ-05/33]
          Length = 199

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 61/211 (28%), Positives = 82/211 (38%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P  I         +    E   +F ENA+ K+  AA+ +G
Sbjct: 7   KIVLASGNAGKLEEFGNLFKPYSITVLPQSAFGIPECPEPYPTFVENALAKARHAAEYSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A  N                              
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGDN-----PKSDTANNLKLAAELAGKTDKSCCY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P G+ GFGYDP F   G+ +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGVWHGQWNGVPAGENGFGYDPYFYLPGHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALADLIRKL 197


>gi|315302797|ref|ZP_07873562.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Listeria ivanovii FSL F6-596]
 gi|313628834|gb|EFR97202.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Listeria ivanovii FSL F6-596]
          Length = 203

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 68/220 (30%), Positives = 104/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAQYNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L +    +PA 
Sbjct: 61  LLNQTVIADDSGLIVDALDGAPGVYSARYAGVAHDDAKNN------EKLLANLQGVEPAK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTSFYTGEVEGVIAEELCGTNGFGYDPLFFLPEFGCTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNQ---------------ISHRANAIKMLEKDLAEVVEK 199


>gi|260172786|ref|ZP_05759198.1| putative xanthosine triphosphate pyrophosphatase [Bacteroides sp.
           D2]
 gi|315921072|ref|ZP_07917312.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313694947|gb|EFS31782.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 194

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/217 (29%), Positives = 104/217 (47%), Gaps = 27/217 (12%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLT 61
           +++  +V A++N  K+ E+ +++    +   S  +++    IPE T  + E NA++KS  
Sbjct: 1   MMKRKLVFATNNAHKLEEVAAILGDQ-VELLSLNDISCQTDIPE-TAETLEGNALLKSSY 58

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
             KN  +   +DD+GL ++ L+G PG++SAR+A     +   +M     E          
Sbjct: 59  IYKNYHLDCFADDTGLEVEALNGAPGVYSARYAGGEGHDAQANMLKLLHE-------LEG 111

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F + +SL         F G + G I+   RG  GFGYDPIF+P GYDRTF E+
Sbjct: 112 KENRKAQFRTAISLILDGKEYL-FEGVIKGEIIKEKRGDSGFGYDPIFKPEGYDRTFAEL 170

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
             + KN                +SHRA A +   +  
Sbjct: 171 GNDIKNQ---------------ISHRALAVQKLCEFL 192


>gi|46907458|ref|YP_013847.1| nucleoside-triphosphatase [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47093491|ref|ZP_00231253.1| HAM1 family protein [Listeria monocytogenes str. 4b H7858]
 gi|226223839|ref|YP_002757946.1| hypothetical protein Lm4b_01244 [Listeria monocytogenes Clip81459]
 gi|254823507|ref|ZP_05228508.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes FSL J1-194]
 gi|254932883|ref|ZP_05266242.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes HPB2262]
 gi|290893279|ref|ZP_06556265.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes FSL J2-071]
 gi|62900232|sp|Q720J0|NTPA_LISMF RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|46880726|gb|AAT04024.1| HAM1 family protein [Listeria monocytogenes serotype 4b str. F2365]
 gi|47018109|gb|EAL08880.1| HAM1 family protein [Listeria monocytogenes str. 4b H7858]
 gi|225876301|emb|CAS05010.1| unnamed protein product [Listeria monocytogenes serotype 4b str.
           CLIP 80459]
 gi|290557087|gb|EFD90615.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes FSL J2-071]
 gi|293584437|gb|EFF96469.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes HPB2262]
 gi|293592727|gb|EFG00488.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes FSL J1-194]
 gi|328466633|gb|EGF37768.1| nucleoside-triphosphatase [Listeria monocytogenes 1816]
 gi|328475257|gb|EGF46038.1| nucleoside-triphosphatase [Listeria monocytogenes 220]
 gi|332311625|gb|EGJ24720.1| Nucleoside-triphosphatase [Listeria monocytogenes str. Scott A]
          Length = 203

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 104/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L++    +P  
Sbjct: 61  VLNQTVIADDSGLIVDALDGAPGVYSARYAGIAHDDAKNN------EKLLKNLEGVEPDK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNE---------------ISHRANAIKQLEKDLAEVVEK 199


>gi|319761728|ref|YP_004125665.1| non-canonical purine ntp pyrophosphatase, rdgb/ham1 family
           [Alicycliphilus denitrificans BC]
 gi|317116289|gb|ADU98777.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Alicycliphilus denitrificans BC]
          Length = 205

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 59/214 (27%), Positives = 101/214 (47%), Gaps = 18/214 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E+ +++ PLG+   +  EL +   EE  ++F ENA+ K+  A+ + 
Sbjct: 1   MKLVLASNNRGKLAELQAMLAPLGVELVAQAELGVGEGEEPFHTFVENALAKARFASAHT 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DD+GL ++   G+PG+ +A +A     ++     ++ +   +        A  S
Sbjct: 61  GLPALADDAGLCVEAFGGQPGVQTAYYATQFGYDKGDANNVRALLEQMEGIEDRRAAMVS 120

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
                V   +  D       G+V+G I   PRG  GFG+DP+     + +TF E+  E K
Sbjct: 121 ---TLVAVRSPQDPEPLIAVGRVAGEIARAPRGAGGFGFDPVMYIPAFGKTFAELPAEVK 177

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           N                 SHR RA +  +     
Sbjct: 178 NAH---------------SHRGRAAQQMLALMRE 196


>gi|323705985|ref|ZP_08117555.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534599|gb|EGB24380.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 198

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 101/218 (46%), Gaps = 24/218 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKN 65
             IV+ASHN  K+ E+            SA ++      EETG + EENA++K+   A  
Sbjct: 1   MKIVVASHNKHKVDEIREFFKG-DYEVLSADDIGSYDEVEETGKTIEENALLKARAIAYL 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
                ++DD+GL +D LDG+PG+++AR+A  N    D +  +                 R
Sbjct: 60  TDELVIADDTGLFVDYLDGEPGVYTARFAGVNATYEDNNNKLLN------LLKGVPMEKR 113

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F +V++L +         GKV G I+  PRGQ GFGYDPIF  +   +T  E+T EE
Sbjct: 114 KATFKTVIALIYKGREAII-EGKVDGRIIDAPRGQYGFGYDPIFYVDEIGKTLAELTLEE 172

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           KN                +SHRA A K   +      E
Sbjct: 173 KNK---------------VSHRANALKKLKEYIKNNLE 195


>gi|222152579|ref|YP_002561754.1| putative fused deoxyribonucleotide triphosphate
           pyrophosphatase/unknown domain protein [Streptococcus
           uberis 0140J]
 gi|222113390|emb|CAR41039.1| HAM1 protein homolog [Streptococcus uberis 0140J]
          Length = 333

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 71/224 (31%), Positives = 103/224 (45%), Gaps = 22/224 (9%)

Query: 3   KLI-ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSL 60
           KL+ ++ I+IA+HN  K  E   L   LG       +  +L   EETG +FEENA +K+ 
Sbjct: 128 KLMWDDTILIATHNKGKTKEFAELFGQLGYKVQDLNDFPDLPEVEETGITFEENARLKAE 187

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           T +   G   ++DDSGL +DVL G PG+ SAR++     +   +  +      +  + A 
Sbjct: 188 TISNLTGKMVIADDSGLKVDVLGGLPGVWSARFSGPEANDDKNNAKLLHELAMVFDQKA- 246

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               RSA F S L +A P+           G I + P+G  GFGYDP+F      +   E
Sbjct: 247 ----RSAQFHSTLVVAAPEKESLVVEADWPGYIAFQPKGDNGFGYDPLFIVGETGKHAAE 302

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +  EEKN                +SHR  AFK  ++       K
Sbjct: 303 LLPEEKNQ---------------ISHRGLAFKKLMEVFPEWQRK 331


>gi|291550467|emb|CBL26729.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ruminococcus torques L2-14]
          Length = 204

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 60/213 (28%), Positives = 90/213 (42%), Gaps = 23/213 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII--PEETGNSFEENAMIKSLTA 62
           ++  IV A+ N +K+ E+  ++  LG+   S  E  +     E+  +  E   +     +
Sbjct: 1   MKRRIVFATGNENKMKEIRMILADLGMEIVSMREAGVDEEIVEDGMSFEENAEIKARAVS 60

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
                   L+DDSGL ID LD  PGI+SAR+A  +T     +  +      L        
Sbjct: 61  RVLVNDIVLADDSGLEIDYLDKAPGIYSARFAGEDTSYDIKNRIL------LDRLEGVPD 114

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R+A F+  ++  +PDG        + G I     G  GFGYDPIF    +  T  EMT
Sbjct: 115 DERTARFVCAVAAVFPDGTTSVVRETIEGQIGHEIVGANGFGYDPIFYVPEFGCTTAEMT 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
            E+KN                LSHR +A +   
Sbjct: 175 PEQKNK---------------LSHRGKALQAIK 192


>gi|158319609|ref|YP_001512116.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Alkaliphilus oremlandii OhILAs]
 gi|158139808|gb|ABW18120.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Alkaliphilus oremlandii OhILAs]
          Length = 210

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 68/219 (31%), Positives = 109/219 (49%), Gaps = 26/219 (11%)

Query: 6   ENNI---VIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSL 60
              I   VI++ N  K+ E+ +++    +   S  ++NL      E GN+FEENA+IK+ 
Sbjct: 7   IKKIHQAVISTGNKHKLEEIGAILEDFNLEVLSMKDVNLEGLEIIEDGNTFEENALIKAK 66

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
              +  G   L+DDSGL +DVLD +PGI+SAR++  N  +   +         L+     
Sbjct: 67  AVMERTGKLTLADDSGLEVDVLDNQPGIYSARFSGENATDEKNNA------KLLKMLEEV 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
               R+A F+  ++  +P+G      G+  G+I +  +G+ GFGYDP+F    Y++TF E
Sbjct: 121 PFEKRTARFVCAMAAVFPNGDTIVLRGECPGVIGFEAKGKSGFGYDPLFIVEEYNQTFAE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           + EE KN                +SHRARA +      +
Sbjct: 181 LGEEIKNK---------------ISHRARALEKLKKELI 204


>gi|254669636|emb|CBA03692.1| HAM1 protein [Neisseria meningitidis alpha153]
          Length = 199

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 87/211 (41%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS NV K+ E  +L  P GI      E ++    E  ++F ENA+ K+   A ++G
Sbjct: 7   KIVLASGNVGKLEEFGNLFEPYGITVLPQSEFSIPECPEPYSTFVENALAKARHVAGHSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A SN                              
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGSN-----PKSDTANNLKLAAELAGKADKSCCY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P G+ GFGYDP F   G+ +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGVWHGQWNGVPAGENGFGYDPYFYLPGHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALADLIRKL 197


>gi|188534961|ref|YP_001908758.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Erwinia
           tasmaniensis Et1/99]
 gi|259514630|sp|B2VEZ3|NTPA_ERWT9 RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|188030003|emb|CAO97887.1| HAM1 protein homolog [Erwinia tasmaniensis Et1/99]
          Length = 205

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 73/224 (32%), Positives = 106/224 (47%), Gaps = 26/224 (11%)

Query: 1   MRK---LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMI 57
           M++   L    +V+A+ N  K+ E+  L+   G+   +   L +   EETG +F ENA++
Sbjct: 1   MKQQSGLTMQQVVLATGNPGKVRELADLLAAFGLDIVAQTALGVESAEETGLTFIENAIL 60

Query: 58  KSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSK 117
           K+  A+   G+PA++DDSGL +DVL G PGI+SAR+A     +R      Q ++  L + 
Sbjct: 61  KARHASAVTGLPAIADDSGLAVDVLGGAPGIYSARYAGEEATDR------QNLDKLLAAL 114

Query: 118 FAHDPAFRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYD 175
            A     R AHF  VL       D     F G  +G I     G  GFGYDPIF      
Sbjct: 115 NAVPDGERQAHFHCVLVYLRHAADPTPLVFHGSWTGEIAHSAAGVGGFGYDPIFFVPELG 174

Query: 176 RTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           +T  EM++ EK                 +SHR +A    +D   
Sbjct: 175 KTAAEMSKSEK---------------LAVSHRGKALNLLLDAMK 203


>gi|299535539|ref|ZP_07048860.1| HAM1-like protein [Lysinibacillus fusiformis ZC1]
 gi|298728739|gb|EFI69293.1| HAM1-like protein [Lysinibacillus fusiformis ZC1]
          Length = 197

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 103/219 (47%), Gaps = 23/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
              +VIA+ N  K  + ++L  PLG    +  E+   +  EETG +FEENA++K+   AK
Sbjct: 1   MKQVVIATKNKGKAKDFEALFGPLGYEVVTMFEVAPDMEIEETGTTFEENAILKAEALAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL +D L+G+PG++SAR+A  +  E         +   L +    +   
Sbjct: 61  ELNTIVIADDSGLAVDALNGEPGVYSARYAGDHDDE-------ANMIKLLENLQGVEDDK 113

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   +++A PD       G   G+I    RG  GFGYDPIF     +R   E++ E
Sbjct: 114 RTARFCCCIAIAGPDFATTTVFGTCEGVIAHEKRGTNGFGYDPIFFVPSLNRMMAELSPE 173

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           EK                 +SHR  A +   +    + +
Sbjct: 174 EK---------------GSISHRGNAIRKLKEQLPNLIK 197


>gi|281426058|ref|ZP_06256971.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella oris F0302]
 gi|281399951|gb|EFB30782.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Prevotella oris F0302]
          Length = 206

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 66/215 (30%), Positives = 105/215 (48%), Gaps = 20/215 (9%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAKN 65
             IV A++N  K+ E+  ++        S  ++       ETG + EENA +K+L   ++
Sbjct: 1   MKIVFATNNTHKLTEIREILGSA-FEIVSLKDIGCDADIPETGQTLEENAHLKALYVYEH 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+   +DD+GL ++ LDG+PG++SAR+AE    + + +    K+   +      +  FR
Sbjct: 60  YGLDCFADDTGLEVEALDGEPGVYSARYAEQ--YDHNSEANTVKLLRKMTDITHRNARFR 117

Query: 126 SAHFISVLSLAWPDGHVEN-FSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           +   +       P  + E  F G V G I    RG  GFGYDP+F P GYD++F E+ EE
Sbjct: 118 TVISLIQHDADNPGSYHETLFEGIVEGKIATEKRGTAGFGYDPVFIPEGYDKSFAELGEE 177

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            KN                +SHRARA +    + +
Sbjct: 178 VKN---------------RISHRARAVEKLAKSLI 197


>gi|237716995|ref|ZP_04547476.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|294644877|ref|ZP_06722615.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides ovatus SD CC 2a]
 gi|229442978|gb|EEO48769.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|292639771|gb|EFF58051.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides ovatus SD CC 2a]
          Length = 193

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 101/216 (46%), Gaps = 27/216 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTA 62
           ++  +V A++N  K+ E+ +++    +   S  ++     IPE T  + E NA++KS   
Sbjct: 1   MKRKLVFATNNAHKLEEVAAILGDQ-VELLSLNDIGCQTDIPE-TAETLEGNALLKSSYI 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            KN  +   +DD+GL ++ L+G PG++SAR+A     +   +M     E           
Sbjct: 59  YKNYHLDCFADDTGLEVEALNGAPGVYSARYAGGEGHDAQANMLKLLHE-------LDGK 111

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F + +SL         F G + G I+   RG  GFGYDP+F P GYDRTF E+ 
Sbjct: 112 ENRKAQFRTAISLILDGKEYL-FEGVIKGEIIKEKRGDSGFGYDPVFMPEGYDRTFAELG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            + KN                +SHRA A +   +  
Sbjct: 171 NDIKNQ---------------ISHRALAVQKLCEFL 191


>gi|15838107|ref|NP_298795.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Xylella
           fastidiosa 9a5c]
 gi|9106538|gb|AAF84315.1|AE003980_7 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 204

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 104/220 (47%), Gaps = 23/220 (10%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M   +   +V+AS N  K+ E+ +++  + +  T+  E  +    ETG +F ENA+IK+ 
Sbjct: 1   MEPKMMKQLVLASGNAGKLGELRAMLAGVALQITAQSEFGVQDVPETGLTFIENALIKAR 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            A    G PAL+DDSGL++D L G PG++SAR+A + T     +  + ++          
Sbjct: 61  HACLMTGFPALADDSGLIVDALGGAPGLYSARYAGTPTDAAANNAKLLEMLR------DV 114

Query: 121 DPAFRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
               RSA F +V+ L     D       G   G IV+ P G  GFGY+PIF    Y  T 
Sbjct: 115 PVGRRSARFYAVIVLLRHAEDPQPLIADGCWEGEIVFEPCGSGGFGYNPIFFDPLYGMTA 174

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +M  E KN                +SHRARA +   D  
Sbjct: 175 AQMGAELKNK---------------ISHRARALEQLRDCL 199


>gi|268593077|ref|ZP_06127298.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Providencia rettgeri DSM 1131]
 gi|291311346|gb|EFE51799.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Providencia rettgeri DSM 1131]
          Length = 197

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 101/217 (46%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ N  K++E+  L+   G+   +   L +   EETG +F ENA++K+  AA  
Sbjct: 1   MQKVVLATDNPGKVNELADLLHDFGMDIVAQTSLGVESAEETGLTFIENAILKARHAAAQ 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSG+ +D L G PGI+SAR+A  +  +       Q +   L +        R
Sbjct: 61  TGLPAIADDSGISVDALGGAPGIYSARYAGEDATDE------QNLIKLLEAMKNVPDDQR 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  VL       D     F G+  G+I    +GQ GFGYDPIF       T  E+T+
Sbjct: 115 QAQFNCVLVYLRHAEDPTPLVFHGRWHGVITHERKGQGGFGYDPIFYVPELGCTSAELTK 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            EK                 +SHR RA    +D    
Sbjct: 175 AEK---------------QAVSHRGRALTMMLDALKN 196


>gi|319786147|ref|YP_004145622.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317464659|gb|ADV26391.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 198

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 103/218 (47%), Gaps = 23/218 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS N  K+ E+  L+   GI   +  +L +   EETG +F ENA+IK+  A++  
Sbjct: 1   MKLVLASSNRGKLDELRHLLAGSGIELVAQSDLGVEDAEETGLTFIENALIKARHASRVT 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +D L G PG++SAR+A      +      + I+  L      D   R 
Sbjct: 61  GLPALADDSGLCVDALGGAPGLYSARYAGEPADPQ------RNIDKLLTELEGVDDDRRG 114

Query: 127 AHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           AHF  VL +     D       G+  G I+   RG  G GYDP+F    + +T  EM  E
Sbjct: 115 AHFQCVLVVLRHAEDPQPLLVEGQWRGRIIHERRGAGGHGYDPVFLDPEHGQTAAEMPME 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
            KN               L+SHR +A +        + 
Sbjct: 175 LKN---------------LISHRGKALERLRARLPEVL 197


>gi|253680863|ref|ZP_04861666.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Clostridium botulinum D str. 1873]
 gi|253562712|gb|EES92158.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Clostridium botulinum D str. 1873]
          Length = 197

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 59/215 (27%), Positives = 98/215 (45%), Gaps = 23/215 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALE--LNLIIPEETGNSFEENAMIKSLTAA 63
              I++AS+N  KI E+  ++    +   S  E  +N+ I E      E   +  S    
Sbjct: 1   MKKIIVASNNQHKIQEIKEILKEFDLDILSLKEAGINVDIEENGTTFAENAHIKASEIFK 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
              G   L+DDSGL++D+L+G+PG++SAR++  +  ++  +      E  L         
Sbjct: 61  LVKGYMVLADDSGLMVDILNGEPGVYSARYSGEHGNDKKNN------EKLLSKLNGVKFT 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R A F+  + L   +  + +  G+V G I+   RG  GFGYDP+F    + ++  E+T 
Sbjct: 115 ERKAKFVCAMELIVDEDTIIDVQGEVEGYILEEERGVSGFGYDPLFYVPQFKKSMAEITP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EEKN                +SHR +A K    + 
Sbjct: 175 EEKNS---------------ISHRGKALKNLKKSI 194


>gi|241758746|ref|ZP_04756859.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria flavescens SK114]
 gi|241320954|gb|EER57167.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria flavescens SK114]
          Length = 197

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 61/217 (28%), Positives = 86/217 (39%), Gaps = 20/217 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   IV+AS N  K+ E   L   L I      + N     E  ++F ENA+ K+  AAK
Sbjct: 1   MFEKIVLASGNAGKLKEFSRLFADLNIEVLPQSQFNTPECPEPYHTFVENALAKARHAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            + +PAL+DDSG+  + L+G PGI SAR+A  N      D A     +A  +       +
Sbjct: 61  YSSLPALADDSGICTNALNGAPGIFSARYAGENP---KSDAANNAKLSADLADKDDKSCY 117

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                + V              G   G       G  GFGYDP F    +  T  E+  E
Sbjct: 118 YVCVLVLVRHEND--PQPIIAEGIWRGQWQAEAAGTNGFGYDPHFYLAEHGCTAAELHPE 175

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            KN                 SHRA+A +  +     +
Sbjct: 176 TKNAE---------------SHRAQALRELLRKIETL 197


>gi|116872610|ref|YP_849391.1| HAM1 family protein [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|116741488|emb|CAK20612.1| HAM1 family protein [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 203

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 70/220 (31%), Positives = 105/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L++    +PA 
Sbjct: 61  LLNQTVIADDSGLIVDALDGAPGVYSARYAGVAHDDAKNN------EKLLKNLEGVEPAK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V GII     G  GFGYDP+F    Y  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTTFYTGEVEGIIAEQLCGTNGFGYDPLFFLPEYGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNE---------------ISHRANAIKQLEKDLTEVVEK 199


>gi|255011973|ref|ZP_05284099.1| putative xanthosine triphosphate pyrophosphatase [Bacteroides
           fragilis 3_1_12]
 gi|313149809|ref|ZP_07812002.1| nucleoside triphosphate phosphohydrolase [Bacteroides fragilis
           3_1_12]
 gi|313138576|gb|EFR55936.1| nucleoside triphosphate phosphohydrolase [Bacteroides fragilis
           3_1_12]
          Length = 194

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 67/219 (30%), Positives = 101/219 (46%), Gaps = 27/219 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTA 62
           ++  +V A++N  K+ E+ S++    +   S  ++N    IPE T ++ E NA +KS   
Sbjct: 1   MKRKLVFATNNAHKLEEVSSILADK-VELLSLDDINCHTDIPE-TADTLEGNAYLKSSFI 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            +N G+    DD+GL ++ L G PG++SAR+A       + ++     E           
Sbjct: 59  YQNYGLDCFGDDTGLEVEALGGAPGVYSARFAGGEGHNAEANILKLMQE-------LEGK 111

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F + +SL         F G + G I+   RG  GFGYDP+F P GYDRTF E+ 
Sbjct: 112 ENRRAQFRTAISLILDGKEYL-FEGVIKGEIIKEKRGNSGFGYDPVFIPEGYDRTFAELG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            E KN                +SHRA A     +    I
Sbjct: 171 NEIKNK---------------ISHRALAVNKLCEFLRSI 194


>gi|163942227|ref|YP_001647111.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Bacillus
           weihenstephanensis KBAB4]
 gi|163864424|gb|ABY45483.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bacillus weihenstephanensis KBAB4]
          Length = 202

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/216 (30%), Positives = 106/216 (49%), Gaps = 24/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              +V+A+ N+ K+ E   L     +   S  +   +   EETG +FEENA++K+ + ++
Sbjct: 1   MKQVVVATKNLGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D L+GKPG++SAR+A     ++        I+  L+     D   
Sbjct: 61  QLNSIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQ------ANIDKVLQGLTDVDLEK 114

Query: 125 RSAHFISVLSLAWPDGHVENF--SGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R+A F   L++A+P+   E    +G   G I+   RG+ GFGYDPIF    Y +   E+ 
Sbjct: 115 RTARFYCALAVAFPEVDKEPVIVNGTCEGKILEQRRGENGFGYDPIFYVEEYKKAMAELN 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +EKN                +SHR RA +   +  
Sbjct: 175 SDEKNA---------------ISHRGRALRKLEEKI 195


>gi|254852892|ref|ZP_05242240.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes FSL R2-503]
 gi|300764388|ref|ZP_07074382.1| HAM1 family protein [Listeria monocytogenes FSL N1-017]
 gi|258606227|gb|EEW18835.1| ribonuclease PH/Ham1 protein [Listeria monocytogenes FSL R2-503]
 gi|300515040|gb|EFK42093.1| HAM1 family protein [Listeria monocytogenes FSL N1-017]
          Length = 203

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 104/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L++    +P  
Sbjct: 61  LLNQTVIADDSGLIVDALDGAPGVYSARYAGVAHDDAKNN------EKLLKNLEGVEPDK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNE---------------ISHRANAIKQLEKDLAEVVEK 199


>gi|84394060|ref|ZP_00992796.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           splendidus 12B01]
 gi|84375302|gb|EAP92213.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           splendidus 12B01]
          Length = 199

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 68/217 (31%), Positives = 98/217 (45%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + IV+A+ N  K+ EM  ++   G    +  E N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MSKIVLATGNQGKVREMADILSEFGFDVVAQSEFNVSEVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR++     ++      Q IE  L +        R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARYSGEGATDQ------QNIEKLLDAMQGVATEKR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL L   +         GK  G I+    G+ GFGYDP+F     +    E+  
Sbjct: 115 TARFHCVLVLMRHENDPTPLVCHGKWEGRILTEEHGENGFGYDPVFFVPEDNCASAELES 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
             K                 LSHR +A          
Sbjct: 175 SRK---------------KQLSHRGKALASLFKTLKE 196


>gi|121534592|ref|ZP_01666414.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermosinus carboxydivorans Nor1]
 gi|121306844|gb|EAX47764.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermosinus carboxydivorans Nor1]
          Length = 205

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 67/215 (31%), Positives = 97/215 (45%), Gaps = 22/215 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKN 65
             IV+A+ N  K+ E+ + +  L +   S  +   +    E G++FE NA++K+   A+ 
Sbjct: 9   KEIVVATRNAGKVAEITAALADLPVTLRSLRDFGAVPDAVEDGDTFEANAVLKAKHYARY 68

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            GM  L+DDSGL +D L G PG+ SAR+A    G+   +         LR         R
Sbjct: 69  TGMACLADDSGLEVDALGGAPGVFSARYAGEGAGDAANNA------KLLRELAGVPAHRR 122

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           SA F  VL+    DG +    G   GII+  PRG  GFGYDP+       +T  E+T  E
Sbjct: 123 SARFRCVLAFLDEDGTLLVTEGTCEGIILEQPRGTGGFGYDPLLYLPELGKTVAELTIAE 182

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           KN                +SHR +A +        
Sbjct: 183 KNA---------------VSHRGKALRQMAAMLAE 202


>gi|258516734|ref|YP_003192956.1| nucleoside-triphosphatase [Desulfotomaculum acetoxidans DSM 771]
 gi|257780439|gb|ACV64333.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 199

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 69/218 (31%), Positives = 103/218 (47%), Gaps = 22/218 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAKN 65
             +V+A+ N  K+ E+  L+    +   S  +  +    EE G++FE NA+ K+   A  
Sbjct: 1   MRLVLATRNNGKVRELVELLKDYQVEVLSLEQYPDFPEIEEDGDTFEANAIKKAKDTAAY 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+  L+DDSGL +D L+G+PG++SAR+A     +R  +      E  LR         R
Sbjct: 61  TGLLVLADDSGLEVDCLNGEPGVYSARFAGEPKDDRANN------EKLLRLLTDVPREKR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            A F  V ++A P G V    G  SG I+   RG+ GFGYDP+F    YD+TF E+    
Sbjct: 115 GARFRCVAAIAVPGGPVYTAEGVCSGFIITDLRGEEGFGYDPLFYLPEYDKTFAELDLAL 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           KN                +SHR RA         ++ +
Sbjct: 175 KNK---------------ISHRGRALAEAKVILSKLLQ 197


>gi|269137630|ref|YP_003294330.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Edwardsiella tarda EIB202]
 gi|267983290|gb|ACY83119.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Edwardsiella tarda EIB202]
 gi|304557695|gb|ADM40359.1| Nucleoside 5-triphosphatase RdgB [Edwardsiella tarda FL6-60]
          Length = 197

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 68/214 (31%), Positives = 105/214 (49%), Gaps = 19/214 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             ++V+A+ N  K+ E+ SL+   G+   +   L +   EETG +F ENA++K+  AA+ 
Sbjct: 1   MQHVVLATGNAGKVRELASLLTDFGLDIVAQSSLGIEGAEETGLTFIENAILKARHAARL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G+PA++DDSGL +D L G PGI+SAR+A  +  +R     ++K+ +ALR   A      
Sbjct: 61  SGLPAIADDSGLAVDALGGAPGIYSARYAGEDASDR---ANLEKLLHALRDVPAGQ-RQA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G I   P G  GFGYDPIF       T  +++ E+
Sbjct: 117 RFHCVLVYLRHADDPTPLVCHGVWEGEIADAPSGDGGFGYDPIFFVPALGCTAAQLSREQ 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           K                 +SHR +A +  +D   
Sbjct: 177 K---------------RAISHRGQALQQLLDRMR 195


>gi|198274105|ref|ZP_03206637.1| hypothetical protein BACPLE_00242 [Bacteroides plebeius DSM 17135]
 gi|198273183|gb|EDY97452.1| hypothetical protein BACPLE_00242 [Bacteroides plebeius DSM 17135]
          Length = 210

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 66/211 (31%), Positives = 101/211 (47%), Gaps = 25/211 (11%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAKNAG 67
           +V A++N  K+ E+ +++    +   S  ++       ET ++ E NA +K+     + G
Sbjct: 21  LVFATNNAHKLEEIRAILGDK-VEVLSLKDIRCEADIPETADTLEGNAALKAEYIHAHYG 79

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           M   +DD+GL ++ LDG PG++SAR+A     +   +  M+K+   L+ K      FR+A
Sbjct: 80  MDCFADDTGLEVEALDGAPGVYSARYAGGEGHDS--EANMKKLLAELKGKENRKAQFRTA 137

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             +         G    F G V G I+   +G  GFGYDP+F P GY  TF EM  EEKN
Sbjct: 138 ICL------IEGGEKHLFEGIVKGEIIREKKGSSGFGYDPVFVPEGYSETFAEMGAEEKN 191

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                           +SHRARA +   D  
Sbjct: 192 ---------------RISHRARAVQRLCDYL 207


>gi|16800271|ref|NP_470539.1| nucleoside-triphosphatase [Listeria innocua Clip11262]
 gi|22653763|sp|Q92CH0|NTPA_LISIN RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|16413661|emb|CAC96433.1| lin1202 [Listeria innocua Clip11262]
          Length = 203

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 68/220 (30%), Positives = 106/220 (48%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++DVL+G PG++SAR+A     +   +      E  L++    +PA 
Sbjct: 61  LLNQTVIADDSGLIVDVLNGAPGVYSARYAGVAHDDAKNN------EKLLKNLEGVEPAK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNE---------------ISHRANAIKQLEKDLAEVVEK 199


>gi|237722038|ref|ZP_04552519.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|229448907|gb|EEO54698.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
          Length = 193

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 101/216 (46%), Gaps = 27/216 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTA 62
           ++  +V A++N  K+ E+ +++    +   S  ++     IPE T  + E NA++KS   
Sbjct: 1   MKRKLVFATNNAHKLEEVAAILGDQ-VELLSLNDIGCQADIPE-TAETLEGNALLKSSYI 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            KN  +   +DD+GL ++ L+G PG++SAR+A     +   +M     E           
Sbjct: 59  YKNYHLDCFADDTGLEVEALNGAPGVYSARYAGGEGHDAQANMLKLLHE-------LDGK 111

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F + +SL         F G + G I+   RG  GFGYDP+F P GYDRTF E+ 
Sbjct: 112 ENRKAQFRTAISLILDGKEYL-FEGVIKGEIIKEKRGDSGFGYDPVFMPEGYDRTFAELG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            + KN                +SHRA A +   +  
Sbjct: 171 NDIKNQ---------------ISHRALAVQKLCEFL 191


>gi|289434488|ref|YP_003464360.1| HAM1 family protein [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|289170732|emb|CBH27272.1| HAM1 family protein [Listeria seeligeri serovar 1/2b str. SLCC3954]
          Length = 203

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 68/220 (30%), Positives = 104/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAQYNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L +    +PA 
Sbjct: 61  LLNQTVIADDSGLIVDALDGAPGVYSARYAGVAHDDAKNN------EKLLANLQGVEPAK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTSFYTGEVEGVIAEELCGTNGFGYDPLFFLPEFGCTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNE---------------ISHRANAIKMLEKDLAEVVEK 199


>gi|220905154|ref|YP_002480466.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219869453|gb|ACL49788.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 209

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 69/211 (32%), Positives = 101/211 (47%), Gaps = 16/211 (7%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKNA 66
            IV+A+HN  K+ E+   +   G+   S      +   EETG +FEENA IK+   A+  
Sbjct: 7   RIVLATHNAGKVRELADPLARFGVEVLSLEAFPHIGEIEETGVTFEENACIKAREVARLT 66

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+ +++DDSGL +D LDGKPG++SAR+++      D     + I   L          R 
Sbjct: 67  GLVSIADDSGLEVDALDGKPGVYSARYSDDWQSLPDESRDDRNIRKLLHELADVPENKRG 126

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
             F+S ++   PDG      G   G ++  PRGQ GFGYDP+F      +T  E+T +EK
Sbjct: 127 CRFVSCMACVRPDGAEMVVRGNWEGTLLHAPRGQNGFGYDPVFFDKDIQKTAAELTRDEK 186

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDN 217
           N                 SHR  A +  +  
Sbjct: 187 NAR---------------SHRGNALRALLAK 202


>gi|15895923|ref|NP_349272.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Clostridium acetobutylicum ATCC 824]
 gi|22653766|sp|Q97FR2|NTPA_CLOAB RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|15025695|gb|AAK80612.1|AE007764_4 Xanthosine triphosphate pyrophosphatase, HAM1-like protein
           [Clostridium acetobutylicum ATCC 824]
          Length = 201

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 67/219 (30%), Positives = 103/219 (47%), Gaps = 23/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
              I+IAS+N +KI E+  ++        S  E N+ I  EE G +F ENA  K+    K
Sbjct: 1   MKKIIIASNNQNKIREIKQILKEFDFNIVSLKEENIDIDVEEDGKTFIENAYKKAYEIYK 60

Query: 65  N-AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
                  ++DDSGL +D L+G PGI+SAR+A  +  ++  +      E  L         
Sbjct: 61  MRKDCMVIADDSGLTVDELEGAPGIYSARFAGIHGDDKKNN------EKLLSLLEGVPFE 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+  + L   + +     G++SG I     G  GFGYDP+F    + +TF E+TE
Sbjct: 115 KRNAQFVCSIVLIIDEANSIKVEGEISGFITDKEIGTKGFGYDPLFYVPEFKKTFAELTE 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           +EKN                +SHRA A +       +++
Sbjct: 175 DEKNS---------------ISHRAIALEKLCSEMKKLN 198


>gi|325202568|gb|ADY98022.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis M01-240149]
          Length = 199

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 61/211 (28%), Positives = 82/211 (38%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P  I         +    E   +F ENA+ K+  AA+ +G
Sbjct: 7   KIVLASGNAGKLEEFGNLFKPYSITVLPQSAFGIPECPEPYPTFVENALAKARHAAEYSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A  N                              
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGDN-----PKSDTANNLKLAAELVGKADKSCCY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P G+ GFGYDP F   G+ +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGVWHGQWNGVPAGENGFGYDPYFYLPGHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALADLIRKL 197


>gi|295425842|ref|ZP_06818522.1| nucleoside-triphosphatase [Lactobacillus amylolyticus DSM 11664]
 gi|295064445|gb|EFG55373.1| nucleoside-triphosphatase [Lactobacillus amylolyticus DSM 11664]
          Length = 206

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/219 (29%), Positives = 102/219 (46%), Gaps = 26/219 (11%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGN---SFEENAMIKSLT 61
           +   I+ A++N  K+ E+       G+      + +L  P        +FE NA IK+  
Sbjct: 1   MTREILFATNNQGKVKELKEAFKQAGVDLIVKTDADLDNPPHPIESGKTFEANAKIKAHE 60

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
            AK +G+P ++DDSGL++D L+G PG+ SAR+A     +   +         L       
Sbjct: 61  LAKFSGLPTIADDSGLMVDKLNGAPGVRSARYAGEAHNDAHNNA------KLLAELGGVP 114

Query: 122 PAFRSAHFIS--VLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
            A R+A F +  V+S+          SG+ +G I+  P G+ GFGYDP+F     ++TF 
Sbjct: 115 QAERTAKFNTTIVVSMPGHFDQDLVVSGQCAGEIMPGPVGEDGFGYDPLFYVPEKEKTFA 174

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           +MT +EKN                +SHR RA K  +   
Sbjct: 175 QMTTDEKNE---------------ISHRGRAIKKLLKEL 198


>gi|255038125|ref|YP_003088746.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dyadobacter fermentans DSM 18053]
 gi|254950881|gb|ACT95581.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Dyadobacter fermentans DSM 18053]
          Length = 223

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 69/214 (32%), Positives = 105/214 (49%), Gaps = 26/214 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMP-LGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             +  A++N  K+ E+ +L+     ++T S +  +  IPE   ++  EN+  K+    ++
Sbjct: 33  MKLCFATNNRHKLEEIQALLGDQFELVTLSDIGCDTDIPE-PFDTIAENSRGKAHYVHEH 91

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+   +DD+GLV+  L+G+PG+ SAR+A         +         L  K   D   R
Sbjct: 92  FGIDCFADDTGLVVGALNGEPGVKSARYAG--------EQRDSNDNIDLLVKSLADKPDR 143

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           SAHF++V++L+    +   F G V G I+   RG  GFGYDP+F P G+ RTF EMT +E
Sbjct: 144 SAHFLTVITLSLDGEY-YQFEGTVEGTIINEKRGSNGFGYDPVFVPKGHSRTFAEMTMQE 202

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           K                 LSHR RAF   V    
Sbjct: 203 K---------------SDLSHRGRAFAKLVAFLR 221


>gi|229822945|ref|ZP_04449015.1| hypothetical protein GCWU000282_00237 [Catonella morbi ATCC 51271]
 gi|229787758|gb|EEP23872.1| hypothetical protein GCWU000282_00237 [Catonella morbi ATCC 51271]
          Length = 203

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 79/224 (35%), Positives = 110/224 (49%), Gaps = 25/224 (11%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKS 59
           MR L    +VIA+ N  K+ E + L+ P GI   S L+  +L   EETG+SFE NA +K+
Sbjct: 1   MRFL---KLVIATQNKGKVAEFERLLGPKGIEVVSLLDYPDLPEVEETGDSFEANARLKA 57

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
            + AK   +P L+DDSGLV+  L+G PGI+SAR+A     ++        I+  LR    
Sbjct: 58  ESIAKLLNLPVLADDSGLVVPYLNGAPGIYSARYAGQPKSDK------ANIDKLLREMSQ 111

Query: 120 HDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
                R A+F++ L LA PD       G+  G I   P G  GFGYDP+F  +    TF 
Sbjct: 112 ARGDQRQAYFVTCLVLASPDHDSYVVEGRAYGTIALEPSGDSGFGYDPVFYVDQEGATFA 171

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           ++    KN                +SHRA A K  + +     E
Sbjct: 172 QIPLSRKNQ---------------ISHRANAIKALLASLPEWLE 200


>gi|212213419|ref|YP_002304355.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Coxiella
           burnetii CbuG_Q212]
 gi|212011829|gb|ACJ19210.1| xanthosine triphosphate pyrophosphatase [Coxiella burnetii
           CbuG_Q212]
          Length = 200

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS N  K+ EM  L+  L I      E ++   EETG++F ENA+IK+  AAK 
Sbjct: 1   MLEIVLASQNSSKLAEMQELLRDLEIKFIPQTEFSVPDIEETGSTFVENAIIKARHAAKQ 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PAL+DDSGL I  L+  PG+ S+R+A  N  +       ++I+  L +  A D   R
Sbjct: 61  TGLPALADDSGLTIAALNSAPGVFSSRYAGKNATDA------ERIQKVLEALEAADDLDR 114

Query: 126 SAHFISVLSLAWPDGHV--ENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            A F  V++L   +         G   G I   PRG+ GFGYDPIF    + RT  E+  
Sbjct: 115 GASFHCVIALMENENDPAPLICHGVWEGEIAREPRGKNGFGYDPIFYVPSHQRTAAELDP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           +EKN                +SHR +A +        
Sbjct: 175 QEKNA---------------ISHRGQALEQLSTVLTE 196


>gi|217961975|ref|YP_002340545.1| HAM1 protein [Bacillus cereus AH187]
 gi|222097943|ref|YP_002532000.1| nucleoside-triphosphatase [Bacillus cereus Q1]
 gi|217065400|gb|ACJ79650.1| HAM1 protein [Bacillus cereus AH187]
 gi|221242001|gb|ACM14711.1| Nucleoside-triphosphatase [Bacillus cereus Q1]
          Length = 202

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 105/216 (48%), Gaps = 24/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              +V+A+ N+ K+ E   L     +   S  +   +   EETG +FEENA++K+ + ++
Sbjct: 1   MKQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D L+GKPG++SAR+A     ++        I+  L+         
Sbjct: 61  QLNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQ------ANIDKVLQELNEIPFDK 114

Query: 125 RSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P  D      +G   G I+   RG+ GFGYDPIF    Y ++  E++
Sbjct: 115 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKSMAELS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +EKN                +SHR RA +   +  
Sbjct: 175 SDEKNA---------------ISHRGRALRKLEEKI 195


>gi|330831108|ref|YP_004394060.1| HAM1 protein [Aeromonas veronii B565]
 gi|328806244|gb|AEB51443.1| HAM1 protein [Aeromonas veronii B565]
          Length = 197

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 69/203 (33%), Positives = 103/203 (50%), Gaps = 8/203 (3%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            N +V+A+ N  K+ E+ +++  + I      E  +   +ETG +F ENA+IK+  AA+ 
Sbjct: 1   MNKLVLATGNQKKVKELAAMLADMKIQVIPQSEFAVSDADETGTTFVENAIIKARHAARI 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D+L G+PG++SAR+A    G++        IE  L          +
Sbjct: 61  TGLPAVADDSGLEVDLLQGRPGVYSARFAGVGAGDK------ANIEKLLGELQGAPEYLK 114

Query: 126 SAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           SA F  VL       D           G+I+  PRGQ GFGYDP+F    +D T  +M  
Sbjct: 115 SARFWCVLVYMRHADDPTPIICQASWEGMIIDEPRGQHGFGYDPVFFVPDHDCTAAQMPA 174

Query: 184 EEKNGGIDSATLFSILSTDLLSH 206
           E KN     A   + L   L +H
Sbjct: 175 ELKNQLSHRAQALAKLKAALAAH 197


>gi|163782631|ref|ZP_02177628.1| hypothetical protein HG1285_17145 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882204|gb|EDP75711.1| hypothetical protein HG1285_17145 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 200

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 103/214 (48%), Gaps = 17/214 (7%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             ++ A+ N  K+ E+  ++ PLG       E   I  EE+G +F ENA IK+    ++ 
Sbjct: 1   MKLLAATTNPGKLREIRRILQPLGYEVIEPPE--KIHVEESGFTFLENAYIKAKAYYEHF 58

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
            MPAL+DDSGLV+D L G PG++S+R+   + G R+     +   N  +     +     
Sbjct: 59  SMPALADDSGLVVDALGGYPGVYSSRFYSIDFGGREELKGSKDDANLRKLLRLMEGKENR 118

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           +       + +  G      G+  G+I   P+G+ GFGYDPIF P G+ RT  E++ EEK
Sbjct: 119 SASFVAFVVLYMGGKGFFSRGECKGVIAEQPKGEGGFGYDPIFIPEGFSRTMAELSPEEK 178

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
                          D +SHR +A +   +   +
Sbjct: 179 ---------------DGISHRGKALRALSELLKK 197


>gi|91787236|ref|YP_548188.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Polaromonas sp. JS666]
 gi|91696461|gb|ABE43290.1| Ham1-like protein [Polaromonas sp. JS666]
          Length = 201

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 61/215 (28%), Positives = 101/215 (46%), Gaps = 18/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              IV+AS+N  K+ E+ +++ PLG+      +LN+   EE   +F ENA+ K+  A++ 
Sbjct: 1   MMKIVLASNNAGKLAELQAMLAPLGVELLRQADLNIPESEEPFRTFVENALAKARHASRL 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G+PAL+DD+GL +D   G PG+ +A +A      +  D  ++ +   + +      A  
Sbjct: 61  SGLPALADDAGLCVDAFGGLPGVDTAFYATQFGYAKGDDNNVRALLEQMANITNRRAALV 120

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           S     V   +  D       G+V G+I   P G  GFG+DP+     + +TF ++  E 
Sbjct: 121 S---TLVAVRSEMDPEPLIACGRVVGLIAREPVGSNGFGFDPVMFIPEFGQTFAQLPVEV 177

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           KN                 SHR RA +  +D    
Sbjct: 178 KNAN---------------SHRGRATRQMMDLMRE 197


>gi|253569098|ref|ZP_04846508.1| nucleoside-triphosphatase [Bacteroides sp. 1_1_6]
 gi|251841117|gb|EES69198.1| nucleoside-triphosphatase [Bacteroides sp. 1_1_6]
          Length = 193

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 108/218 (49%), Gaps = 27/218 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTA 62
           ++  +V A++N  K+ E+ +++    +   S  +++    IPE T  + E NA++KS   
Sbjct: 1   MKRKLVFATNNAHKLEEVAAILGDK-VELLSLNDIDCHTDIPE-TAETLEGNALLKSSFI 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            +N  +   +DD+GL ++ L+G PG++SAR+AE    +      M+K+ + L        
Sbjct: 59  YRNYQLDCFADDTGLEVEALNGAPGVYSARYAEGEGHDAQ--ANMRKLLHELEG-----K 111

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F + +SL         F G + G I+   RG  GFGYDPIF+P GY++TF E+ 
Sbjct: 112 ENRKAQFRTAISLILDGKEYL-FEGVIKGEIIKEKRGDSGFGYDPIFKPEGYEQTFAELG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            E KN                +SHRA A +   +   R
Sbjct: 171 NETKNK---------------ISHRALAVQKLCEFLQR 193


>gi|256420646|ref|YP_003121299.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Chitinophaga pinensis DSM 2588]
 gi|256035554|gb|ACU59098.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Chitinophaga pinensis DSM 2588]
          Length = 198

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 72/219 (32%), Positives = 104/219 (47%), Gaps = 26/219 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMP-LGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
             +V A++N +K+ E+ S++     I+T     +++ IPE   ++ EENA  KS      
Sbjct: 1   MTLVFATNNENKVKEIRSVLGDSFSIITLQEAGIDIDIPE-PHDTLEENAREKSTVIFDM 59

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G    S+D+GL ID LDG PG+ SAR+A     ++  +  + K+   +  +       R
Sbjct: 60  TGKDCFSEDTGLEIDALDGAPGVLSARYAGE---QKLSEDNIAKVLKEMNGQE-----NR 111

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
            AHF +V+SL         F+G   G I+   RG  GFGYDPIF P+G D TF EM    
Sbjct: 112 KAHFRTVISLILGGQE-FQFTGVCPGSILTESRGGKGFGYDPIFVPDGSDLTFAEMDMAG 170

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           KN                 SHRA+AF+  V        K
Sbjct: 171 KNK---------------FSHRAKAFQQLVTFLKAEGSK 194


>gi|187925062|ref|YP_001896704.1| deoxyribonucleotide triphosphate pyrophosphatase [Burkholderia
           phytofirmans PsJN]
 gi|187716256|gb|ACD17480.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Burkholderia phytofirmans PsJN]
          Length = 215

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 98/214 (45%), Gaps = 18/214 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E  +L+   GI      EL++   EE   +F ENA+ K+  A+K  
Sbjct: 18  KKVVLASNNAGKLREFAALLGAAGIELIPQGELSVPEAEEPHPTFVENALTKARHASKLT 77

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DDSGL +  L G PG++SAR+A+   GE+       ++ +AL+ +      +  
Sbjct: 78  GLPALADDSGLCVRALRGAPGVYSARYAQLAGGEKSDAANNARLVSALQGETDRRAYYF- 136

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
              +  L     D       G+  G ++  PRG  GFGYDP F     + +  E+    K
Sbjct: 137 --CVLALVRHADDPEPLIAEGRWHGEMLDAPRGANGFGYDPYFFLPPLNASAAELEPAVK 194

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           N                 SHRA A +  +     
Sbjct: 195 NAS---------------SHRAIALRQLLARLTE 213


>gi|293115853|ref|ZP_05793275.2| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Butyrivibrio crossotus DSM 2876]
 gi|292808145|gb|EFF67350.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Butyrivibrio crossotus DSM 2876]
          Length = 199

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 68/216 (31%), Positives = 98/216 (45%), Gaps = 22/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAK 64
              ++ A+ N  KI E+  ++  +     S  E  +     E G +FEENA+IK+ T  +
Sbjct: 1   MIKMIFATTNQGKIKEIKEILGDINEDIVSLKEAGIDVDIVENGKTFEENAIIKAKTIME 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G   L+DDSGL +D +D +PGI+SAR+   +T     + A+      L          
Sbjct: 61  MTGQMVLADDSGLEVDAMDKQPGIYSARFMGKDTSYEVKNRAIIDNLKGLEGD------K 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           RSA F+  ++   PDG V    G + GII   P+G+ GFGYDPI     Y  T GEM+ E
Sbjct: 115 RSARFVCAIAAVLPDGEVITTRGTIEGIIADEPKGENGFGYDPIVYVPEYGMTTGEMSPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            KN                +SHR +A          
Sbjct: 175 LKNS---------------ISHRGKALMAMKKILKE 195


>gi|327402746|ref|YP_004343584.1| dITPase [Fluviicola taffensis DSM 16823]
 gi|327318254|gb|AEA42746.1| dITPase [Fluviicola taffensis DSM 16823]
          Length = 200

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 69/221 (31%), Positives = 111/221 (50%), Gaps = 28/221 (12%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSL 60
           +K +   ++ AS N  K+ E+++++ P G    S  E++      ET ++ E NA+ K+ 
Sbjct: 6   KKRM--KLLFASSNEHKLTEINAIL-PHGFQLISLKEIHFHDEIPETADTIEGNAIQKAT 62

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
             A    +P  +DDSGL++  L+G+PG++SAR+A       D    + +  +        
Sbjct: 63  FLADKMNIPCFADDSGLIVPSLNGEPGVYSARYAGPQRDANDNMDLVMEKLD-------- 114

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             + RSA+F ++++L         F G++ G I+   RG  GFGYDPIF PNG D+TF E
Sbjct: 115 QQSDRSAYFTTIIALYIHHKVHL-FEGRIDGTIIHEKRGNNGFGYDPIFVPNGSDKTFAE 173

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           MT EEK+                +SHR +A     +   RI
Sbjct: 174 MTTEEKSA---------------MSHRGKALAKMTEYLKRI 199


>gi|212692478|ref|ZP_03300606.1| hypothetical protein BACDOR_01974 [Bacteroides dorei DSM 17855]
 gi|237711309|ref|ZP_04541790.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237724322|ref|ZP_04554803.1| nucleoside-triphosphatase [Bacteroides sp. D4]
 gi|265752729|ref|ZP_06088298.1| Ham1 family protein [Bacteroides sp. 3_1_33FAA]
 gi|212664953|gb|EEB25525.1| hypothetical protein BACDOR_01974 [Bacteroides dorei DSM 17855]
 gi|229437191|gb|EEO47268.1| nucleoside-triphosphatase [Bacteroides dorei 5_1_36/D4]
 gi|229454004|gb|EEO59725.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263235915|gb|EEZ21410.1| Ham1 family protein [Bacteroides sp. 3_1_33FAA]
          Length = 193

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 107/217 (49%), Gaps = 27/217 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTA 62
           ++  +V A++N  K+ E+ +++    +   S  ++N    IPE T ++ E NAM+K+   
Sbjct: 1   MKRKLVFATNNAHKLEEISAILGEK-VELLSLKDINCHADIPE-TADTLEGNAMLKAEYI 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            +N G+   +DD+GL ++ L+G PG++SAR+A       + +  MQK+   ++       
Sbjct: 59  FENYGLDCFADDTGLEVEALNGAPGVYSARYAGGEG--HNAEANMQKLLQNMQGAPNRKA 116

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
            FR+A  + +      DG    F G V G I+   RG  GFGYDPIF P GY +TF E+ 
Sbjct: 117 QFRTAICLIL------DGKKHLFEGIVKGEIIKEKRGSSGFGYDPIFVPEGYTKTFAELG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            E KN                +SHRA A +       
Sbjct: 171 NETKNK---------------ISHRALAVEKLCRFLK 192


>gi|144897367|emb|CAM74231.1| Ham1-like protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 198

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 97/219 (44%), Positives = 120/219 (54%), Gaps = 23/219 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
           RK     ++IASHN  K+ E+  L+        SA  L L  PEETG +F  NA +K+L 
Sbjct: 3   RKFTAGPLIIASHNAGKVREIGELLGRFDAQVVSAGTLGLDEPEETGATFAANAELKALA 62

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK A +PAL+DDSGL ++ L G PGI+SARWA      +DF  AM+ + + +       
Sbjct: 63  AAKAANLPALADDSGLAVNALGGDPGIYSARWAGPT---KDFGAAMKLVHDKMGDTPD-- 117

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
              R A F+  L+LAWPDGHVE F G V G IVWPPRG  GFGYDP F P G   TFGEM
Sbjct: 118 ---RGARFVCALALAWPDGHVETFEGVVEGDIVWPPRGANGFGYDPFFLPTGGSLTFGEM 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
               K+                +SHRA AF   V  C +
Sbjct: 175 EAAAKHA---------------ISHRADAFAKLVAACFQ 198


>gi|319789114|ref|YP_004150747.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermovibrio ammonificans HB-1]
 gi|317113616|gb|ADU96106.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermovibrio ammonificans HB-1]
          Length = 200

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 110/218 (50%), Gaps = 24/218 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE---ETGNSFEENAMIKSLTAA 63
             I+ A+ N  K+ E+   +   GI   S  EL   +P    ETG++F ENA IK+   A
Sbjct: 1   MRILFATGNQGKVKEVKEKLSEFGIEVISLKELPHPLPPPPAETGSTFCENAHIKATYYA 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +   +P +++DSGL ++ L G+PG+ S+R+A  N  + + +  + +  +AL    +    
Sbjct: 61  QKLNLPVMAEDSGLEVEALGGRPGVFSSRFASENATDEENNRKLIEELSALGLTESP--- 117

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
              A ++S +  A+P        G+V G +V  PRG+ GFGYDP+F P G+++T  E+  
Sbjct: 118 ---ARYVSFIFFAFPFQGGLWSEGEVRGKVVTTPRGEGGFGYDPLFIPEGFNKTMAELPL 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           + KN                +SHRA+A +  V     I
Sbjct: 175 QVKNS---------------ISHRAKALERLVKAIKEI 197


>gi|23099560|ref|NP_693026.1| hypothetical protein OB2105 [Oceanobacillus iheyensis HTE831]
 gi|62900299|sp|Q8EPJ6|NTPA_OCEIH RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|22777790|dbj|BAC14061.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 197

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 71/215 (33%), Positives = 98/215 (45%), Gaps = 23/215 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN--LIIPEETGNSFEENAMIKSLTAA 63
              I++A+ N  K  E         I   S L+L   +   EETG +FEENA +K+   +
Sbjct: 1   MKKIIVATKNKGKAKEFKEFFASFDIEAISLLDLPESIPDIEETGTTFEENAALKAEQIS 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +      ++DDSGL+ID LDG+PG++SAR+A   T ++        IE  L+        
Sbjct: 61  ERFNTAVIADDSGLLIDALDGRPGLYSARYAGEPTNDQ------ANIEKVLKEMQDVPDN 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            RSA FI VL++A P       +G   G I    +G  GFGYDPIF P  YD T  E+  
Sbjct: 115 DRSARFICVLAIAQPGKETNFCTGYCEGHIHSKQKGDHGFGYDPIFIPKKYDVTMAELDP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +KN                +SHR  A        
Sbjct: 175 AKKNQ---------------ISHRKNAIDQLEKWL 194


>gi|229141222|ref|ZP_04269761.1| Nucleoside-triphosphatase [Bacillus cereus BDRD-ST26]
 gi|228642263|gb|EEK98555.1| Nucleoside-triphosphatase [Bacillus cereus BDRD-ST26]
          Length = 205

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 107/221 (48%), Gaps = 26/221 (11%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKS 59
           M K     +V+A+ N+ K+ E   L     +   S  +   +   EETG +FEENA++K+
Sbjct: 1   MEK--MKQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKA 58

Query: 60  LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFA 119
            + ++      ++DDSGL++D L+GKPG++SAR+A     ++        I+  L+    
Sbjct: 59  DSLSRQLNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQ------ANIDKVLQELNE 112

Query: 120 HDPAFRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRT 177
                R A F   L++A+P  D      +G   G I+   RG+ GFGYDPIF    Y ++
Sbjct: 113 IPFDKRKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKS 172

Query: 178 FGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
             E++ +EKN                +SHR RA +   +  
Sbjct: 173 MAELSSDEKNA---------------ISHRGRALRKLEEKI 198


>gi|229013695|ref|ZP_04170824.1| Nucleoside-triphosphatase [Bacillus mycoides DSM 2048]
 gi|229169221|ref|ZP_04296935.1| Nucleoside-triphosphatase [Bacillus cereus AH621]
 gi|228614287|gb|EEK71398.1| Nucleoside-triphosphatase [Bacillus cereus AH621]
 gi|228747617|gb|EEL97491.1| Nucleoside-triphosphatase [Bacillus mycoides DSM 2048]
          Length = 205

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 65/216 (30%), Positives = 107/216 (49%), Gaps = 24/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              +V+A+ N+ K+ E   L     +   S  +   +   EETG +FEENA++K+ + ++
Sbjct: 4   MKQVVVATKNLGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSR 63

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D L+GKPG++SAR+A     ++        I+  L+     D   
Sbjct: 64  QLNSIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQ------ANIDKVLQELTDIDLEK 117

Query: 125 RSAHFISVLSLAWPDGHVENF--SGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R+A F   L++A+P+   E    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RTARFYCALAVAFPEADKEPVIVNGTCEGKILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +EKN                +SHR RA +   +  
Sbjct: 178 SDEKNA---------------ISHRGRALRKLEEKI 198


>gi|325510075|gb|ADZ21711.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Clostridium acetobutylicum EA 2018]
          Length = 201

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 102/219 (46%), Gaps = 23/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLII-PEETGNSFEENAMIKSLTAAK 64
              I+IAS+N +KI E+  ++        S  E N+ I  EE G +F ENA  K+    K
Sbjct: 1   MKKIIIASNNQNKIREIKQILKEFDFNIVSLKEENIDIDVEEDGKTFIENAYKKAYEIYK 60

Query: 65  N-AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
                  ++DDSGL +D L+G PGI+SAR+   +  ++  +      E  L         
Sbjct: 61  MRKDCMVIADDSGLTVDELEGAPGIYSARFTGIHGDDKKNN------EKLLSLLEGVPFE 114

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+  + L   + +     G++SG I     G  GFGYDP+F    + +TF E+TE
Sbjct: 115 KRNAQFVCSIVLIIDEANSIKVEGEISGFITDKEIGTKGFGYDPLFYVPEFKKTFAELTE 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           +EKN                +SHRA A +       +++
Sbjct: 175 DEKNS---------------ISHRAIALEKLCSEMKKLN 198


>gi|298386937|ref|ZP_06996491.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides sp. 1_1_14]
 gi|298260087|gb|EFI02957.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides sp. 1_1_14]
          Length = 193

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 108/218 (49%), Gaps = 27/218 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTA 62
           ++  +V A++N  K+ E+ +++    +   S  +++    IPE T  + E NA++KS   
Sbjct: 1   MKRKLVFATNNAHKLEEVAAILGDK-VELLSLNDIDCHTDIPE-TAETLEGNALLKSSFI 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            +N  +   +DD+GL ++ L+G PG++SAR+AE    +      M+K+ + L        
Sbjct: 59  YRNYQLDCFADDTGLEVEALNGAPGVYSARYAEGEGHDAQ--ANMRKLLHELEG-----K 111

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F + +SL         F G + G I+   RG  GFGYDPIF+P GY++TF E+ 
Sbjct: 112 ENRKAQFRTAISLILDGKEYL-FEGVIKGEIIKEKRGDSGFGYDPIFKPEGYEQTFAELG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            E KN                +SHRA A +   +   R
Sbjct: 171 NEIKNK---------------ISHRALAVQKLCEFLQR 193


>gi|169831660|ref|YP_001717642.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Candidatus Desulforudis audaxviator MP104C]
 gi|169638504|gb|ACA60010.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Candidatus Desulforudis audaxviator MP104C]
          Length = 213

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 74/219 (33%), Positives = 99/219 (45%), Gaps = 22/219 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETG-NSFEENAMIKSLTAAK 64
              +V+A+ N  K+ EM +L+ PLG+   S      I       ++FE NA+ K+   A 
Sbjct: 1   MARLVLATRNEGKVREMAALLAPLGVEVVSLSSYPEIEEIPEEGDTFEANALTKARMVAA 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G  AL+DDSGL +DVLDG PG+HSAR+A     +       +  E  LR         
Sbjct: 61  RTGQLALADDSGLEVDVLDGAPGVHSARFAGEPRDD------GRNNEKLLRLLEGVPWDK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F  V++L   +G      G   G I + PRG  GFGYDP+F    YD TFGE+   
Sbjct: 115 RRARFRCVIALVTAEGTERLTEGTCEGFIGYEPRGTKGFGYDPLFYVPEYDMTFGELDLA 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
            KN                +SHR RA          + E
Sbjct: 175 TKN---------------RISHRGRALAKAFGAVTELLE 198


>gi|319638390|ref|ZP_07993152.1| nucleoside-triphosphatase [Neisseria mucosa C102]
 gi|317400139|gb|EFV80798.1| nucleoside-triphosphatase [Neisseria mucosa C102]
          Length = 197

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 60/217 (27%), Positives = 86/217 (39%), Gaps = 20/217 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   IV+AS N  K+ E   L   L I      + N     E  ++F ENA+ K+  AAK
Sbjct: 1   MFEKIVLASGNAGKLKEFSRLFTDLNIEVLPQSQFNTPECPEPYHTFVENALAKARHAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            + +PAL+DDSG+  + L+G PGI SAR+A  N      D A     ++  +       +
Sbjct: 61  YSALPALADDSGICTNALNGAPGIFSARYAGENP---KSDAANNAKLSSDLADKDDKSCY 117

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                + V              G   G       G  GFGYDP F    +  T  E+  E
Sbjct: 118 YVCVLVLVRHEND--PQPIIAEGIWRGQWQAEAAGTNGFGYDPHFYLAEHGCTAAELAPE 175

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            KN                 SHRA+A +  +     +
Sbjct: 176 IKNAE---------------SHRAQALRELLRKIESL 197


>gi|229158098|ref|ZP_04286168.1| Nucleoside-triphosphatase [Bacillus cereus ATCC 4342]
 gi|228625417|gb|EEK82174.1| Nucleoside-triphosphatase [Bacillus cereus ATCC 4342]
          Length = 205

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 105/216 (48%), Gaps = 24/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              +V+A+ N+ K+ E   L     +   S  +   +   EETG +FEENA++K+ + ++
Sbjct: 4   MKQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSR 63

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D L+GKPG++SAR+A     ++        I+  L+         
Sbjct: 64  QLNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQ------ANIDKVLQELNDVAFEK 117

Query: 125 RSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P  D      +G   G I+   RG+ GFGYDPIF    Y ++  E++
Sbjct: 118 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKSMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +EKN                +SHR RA +   +  
Sbjct: 178 SDEKNA---------------ISHRGRALRKLEEKI 198


>gi|323485746|ref|ZP_08091082.1| nucleoside-triphosphatase [Clostridium symbiosum WAL-14163]
 gi|323693086|ref|ZP_08107305.1| hypothetical protein HMPREF9475_02168 [Clostridium symbiosum
           WAL-14673]
 gi|323400926|gb|EGA93288.1| nucleoside-triphosphatase [Clostridium symbiosum WAL-14163]
 gi|323502840|gb|EGB18683.1| hypothetical protein HMPREF9475_02168 [Clostridium symbiosum
           WAL-14673]
          Length = 207

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 69/220 (31%), Positives = 107/220 (48%), Gaps = 23/220 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAA 63
           +++ ++ A+ N  K+ E+  ++  LG    S  E       EE G +F ENA IK+    
Sbjct: 1   MKDKVIFATGNAGKMKEVRLILADLGKEILSMDEAGFKGDIEENGTTFAENAEIKARAVW 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G   L+DDSGLVID L+G+PG++SAR+ E+        + ++++E         D A
Sbjct: 61  EQTGGTVLADDSGLVIDYLNGEPGVYSARYLENEPYSVKNRVLIRRME-------GADGA 113

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            RSA F+  ++   PDG V +    + G+I   P G  GFGYDPI     Y +T  E+T 
Sbjct: 114 KRSARFVCNIAAVLPDGKVLHTQAVMEGLIAREPAGDGGFGYDPILYLPEYGKTSAELTI 173

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           +EKN                +SHR +A +   +      E
Sbjct: 174 DEKNK---------------ISHRGKALERMKEALKAALE 198


>gi|261868179|ref|YP_003256101.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413511|gb|ACX82882.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 226

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 101/214 (47%), Gaps = 19/214 (8%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  IV+A+ N  K+ EM  ++   G    +  +L +  PEETG +F ENA++K+  AA+
Sbjct: 30  MKQKIVLATANQGKVREMADVLADFGFDVIAQTDLGIDSPEETGLTFVENAILKARYAAE 89

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV+D L+G PG++SAR+     GE   D   +    A  +    +   
Sbjct: 90  KSGLPAIADDSGLVVDALNGAPGLYSARY----AGEEGNDAKNRAKLLAELAHVPAEQRK 145

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                  VL     D       G+  G+I +  +G+ GFGYD +F       TF E+   
Sbjct: 146 AKFVSTIVLLQHPTDPSPIIAQGECHGVIAFEEKGENGFGYDALFFSPQQGCTFAELDTV 205

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EK                 +SHRARA        
Sbjct: 206 EKKK---------------ISHRARALAVLKTKL 224


>gi|196039297|ref|ZP_03106603.1| HAM1 protein [Bacillus cereus NVH0597-99]
 gi|206969488|ref|ZP_03230442.1| HAM1 protein [Bacillus cereus AH1134]
 gi|196029924|gb|EDX68525.1| HAM1 protein [Bacillus cereus NVH0597-99]
 gi|206735176|gb|EDZ52344.1| HAM1 protein [Bacillus cereus AH1134]
          Length = 202

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 105/216 (48%), Gaps = 24/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              +V+A+ N+ K+ E   L     +   S  +   +   EETG +FEENA++K+ + ++
Sbjct: 1   MKQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D L+GKPG++SAR+A     ++        I+  L+         
Sbjct: 61  QLNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQ------ANIDKVLQELNEVAFEK 114

Query: 125 RSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P  D      +G   G I+   RG+ GFGYDPIF    Y ++  E++
Sbjct: 115 RKARFYCALAVAFPEGDKKPVIVNGTCEGFILEQRRGENGFGYDPIFYVEEYKKSMAELS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +EKN                +SHR RA +   +  
Sbjct: 175 SDEKNA---------------ISHRGRALRKLEEKI 195


>gi|90580280|ref|ZP_01236087.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           angustum S14]
 gi|90438582|gb|EAS63766.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Vibrio
           angustum S14]
          Length = 197

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 63/216 (29%), Positives = 94/216 (43%), Gaps = 23/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + +V+A+ N  K+ EM  L+   G    +  + N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MSKLVLATGNQGKVKEMADLLADFGFDVVAQSDYNVSSVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A     +         I+  L          R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARFAGEGASDA------DNIDKLLAEMKDVPAEQR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL +   +         G   G I+    G+ GFGYDP+F          ++  
Sbjct: 115 TARFHCVLVMMRHENDPTPLVCHGSWEGSILTERHGENGFGYDPVFWVPEDQCASAQLPP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             K                 LSHR +A +       
Sbjct: 175 ARK---------------KQLSHRGKALQQLFSALK 195


>gi|302671825|ref|YP_003831785.1| non-canonical purine NTP pyrophosphatase rdgB/HAM1 family
           [Butyrivibrio proteoclasticus B316]
 gi|302396298|gb|ADL35203.1| non-canonical purine NTP pyrophosphatase rdgB/HAM1 family
           [Butyrivibrio proteoclasticus B316]
          Length = 205

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 71/221 (32%), Positives = 102/221 (46%), Gaps = 29/221 (13%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKS------ 59
             IV A+ N  K+ E+  ++  LG+   S  E  +    EETG +FEEN+MIK+      
Sbjct: 1   MRIVFATGNKGKLKEIHRILGDLGMDILSMAEAGVQDDIEETGTTFEENSMIKAESVSKS 60

Query: 60  -LTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKF 118
                       L+DDSGL +D L G+PGI+SAR+   +T     + A+      +    
Sbjct: 61  LKKLDPADESIVLADDSGLEVDYLGGEPGIYSARYMGKDTSYDIKNKAI------IDKLE 114

Query: 119 AHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
                 R+A F+  +S  +PDG    F GK+ G I     G  GFGYDPIF    Y +T 
Sbjct: 115 GVPEDERTARFVCAISAVFPDGRKFAFLGKMEGHIAHEIAGSNGFGYDPIFFLPEYGKTS 174

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            E+TE+EKN                +SHR +A +   +   
Sbjct: 175 AELTEDEKNA---------------ISHRGKALREMEEVLR 200


>gi|88811939|ref|ZP_01127192.1| Ham1-like protein [Nitrococcus mobilis Nb-231]
 gi|88790823|gb|EAR21937.1| Ham1-like protein [Nitrococcus mobilis Nb-231]
          Length = 198

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 61/215 (28%), Positives = 96/215 (44%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + IV+AS+N  K  EM +L+  + I         +    ETG +F ENA+IK+  A ++
Sbjct: 1   MHRIVLASNNPGKALEMQALLRGMSIELVPQPLYCVPSVVETGLTFVENALIKARHACEH 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G  A++DDSGL ++ L G+PGI+SAR+A  +  +       +++ + L           
Sbjct: 61  TGRAAIADDSGLEVEALAGEPGIYSARYAGEDADD---TANNRRLLDELIDTP-VSERKA 116

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
               I        D       G   G I+  PRG  GFGYDP+F     + T  E+  + 
Sbjct: 117 RFICIIAYLRHSRDPDPLICRGTWEGQIIEHPRGTNGFGYDPLFYLPELECTAAELEAQT 176

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           KN                +SHR +A +  ++   R
Sbjct: 177 KN---------------RISHRGQALQALLEALQR 196


>gi|296134057|ref|YP_003641304.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermincola sp. JR]
 gi|296032635|gb|ADG83403.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Thermincola potens JR]
          Length = 208

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 68/220 (30%), Positives = 107/220 (48%), Gaps = 23/220 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPL-GIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
             +V+A+ N  K+ E+++++  + GI   S  +   +    E G +FEENA+ K+   A+
Sbjct: 1   MKVVLATRNQGKVRELEAMLAGIEGIKVLSFQDFPEMPDVAENGQTFEENAVKKAREVAE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
              + A++DDSGL +D L+G PG++SAR+A  N  +       +     LR         
Sbjct: 61  YTNLVAVADDSGLEVDYLNGAPGVYSARFAGENKND------TENNHKLLRLLHGLPMEQ 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F  V+++A P G +    G   G I +   G  GFGYDP+F    YD+TF ++  E
Sbjct: 115 RKARFRCVIAIATPWGDIYTTEGNCEGFIGYEMAGDKGFGYDPLFYLPEYDKTFAQLDLE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
            KN                +SHRARA +      L + E+
Sbjct: 175 VKN---------------RISHRARALEKAKSILLDLKER 199


>gi|305680779|ref|ZP_07403586.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Corynebacterium matruchotii ATCC 14266]
 gi|305658984|gb|EFM48484.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Corynebacterium matruchotii ATCC 14266]
          Length = 207

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 65/224 (29%), Positives = 111/224 (49%), Gaps = 28/224 (12%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAKN 65
             I++AS+N  K HE+ +++   GI   +  ++     P E G +F +NA+IK+   A++
Sbjct: 1   MKILLASNNPKKAHELRTILANSGIEILTLADVPHYAEPIEDGRTFADNALIKARAGAQH 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+  ++DDSG  ++ L+G PG+ SARW+  +  ++  ++ +      L+         R
Sbjct: 61  TGLVTIADDSGFTVEELNGCPGVLSARWSGQHGDDQANNLLL------LKQMAHVPEERR 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGY---DRTFGEMT 182
            A F+SV +L  P+G     +G+  G ++  PRG  GFGYDP+F PN      R+  +++
Sbjct: 115 QAAFVSVCALVVPNGEEHVVTGQWDGWMLTEPRGDNGFGYDPLFLPNEEFPNGRSSAQLS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD---NCLRIDE 223
             EKN                LSHR +A    V       ++ E
Sbjct: 175 PAEKNA---------------LSHRGKALAQLVPIVTQLSQLSE 203


>gi|240949369|ref|ZP_04753711.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Actinobacillus minor NM305]
 gi|240296219|gb|EER46872.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Actinobacillus minor NM305]
          Length = 197

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 98/218 (44%), Gaps = 23/218 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           + +  IV+A+ N  K+ EM  ++   G    +  E  +  PEETG +F ENA+IK+  A+
Sbjct: 1   MQKTKIVLATGNQGKVKEMADVLAEFGFEVIAQSEFGIESPEETGLTFVENALIKARYAS 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           +  G+PA++DDSGL +D L G PG++SAR+A  +  ++            L         
Sbjct: 61  QMTGLPAIADDSGLAVDALGGAPGLYSARYAGEDGNDQANRK------KLLEEMANVADQ 114

Query: 124 FRSAHF--ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            R+A F    V+     D   +   G+  G I+   RGQ GFGYD +F        F E+
Sbjct: 115 ARAAKFVSSIVMLQHPTDPTPKIAIGECFGEILKEERGQNGFGYDALFFYPPKQCAFAEL 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
              EK                 +SHRA A +       
Sbjct: 175 ETAEKKK---------------ISHRAIALQSLKQQLK 197


>gi|262374990|ref|ZP_06068224.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Acinetobacter lwoffii SH145]
 gi|262310003|gb|EEY91132.1| rdgB/HAM1 family non-canonical purine NTP pyrophosphatase
           [Acinetobacter lwoffii SH145]
          Length = 208

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 68/215 (31%), Positives = 101/215 (46%), Gaps = 19/215 (8%)

Query: 8   NIVIASHNVDKIHEMDSLIMPL--GIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            +V+AS+N  KI E + L   L   +   +  +LN+    E G SF ENA+IK+  A+K 
Sbjct: 11  TLVLASNNKGKIAEFEKLFAELQLPVEVVAQGKLNIEDAIEDGLSFVENAIIKARHASKI 70

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
           +G PA++DDSG+ + VL G PGI+SAR+A  +  +   +  +      LR          
Sbjct: 71  SGKPAIADDSGICVPVLGGAPGIYSARYAGEHGNDTANNEKLLADLKPLRQDGEAIEGMF 130

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
                 V     P   V  F G   G I+   RG+ GFGYDP+F       +  EM++EE
Sbjct: 131 VCVLALVQHAEDPLPQV--FQGIWHGEILEAARGKNGFGYDPLFWLPELGISSAEMSKEE 188

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           KN                +SHR +A + F  +  +
Sbjct: 189 KNK---------------ISHRGQAMQLFKKSLAK 208


>gi|53715867|ref|YP_101859.1| putative deoxyribonucleoside-triphosphatase [Bacteroides fragilis
           YCH46]
 gi|62900189|sp|Q64MG2|NTPA_BACFR RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|52218732|dbj|BAD51325.1| putative xanthosine triphosphate pyrophosphatase [Bacteroides
           fragilis YCH46]
          Length = 194

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 68/219 (31%), Positives = 105/219 (47%), Gaps = 27/219 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTA 62
           ++  +V A++N  K+ E+ +++    +   S  ++N    IPE T  + E NA +KS   
Sbjct: 1   MKRKLVFATNNAHKLEEVSAILGDK-VELLSLNDINCHTDIPE-TAETLEGNAYLKSSFI 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            +N G+   +DD+GL ++ L G PG++SAR+A       + +  M K+ + L        
Sbjct: 59  YRNYGLNCFADDTGLEVESLGGAPGVYSARYAGGEG--HNAEANMLKLLHELEG-----K 111

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F + +SL   +     F G + G I+   RG  GFGYDP+F P GYDRTF E+ 
Sbjct: 112 DNRRAQFRTAISLILDEKEYL-FEGIIKGEIIKEKRGDSGFGYDPVFVPEGYDRTFAELG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            E KN                +SHRA A     +    I
Sbjct: 171 NEIKNQ---------------ISHRALAVNKLCEFLRSI 194


>gi|254784469|ref|YP_003071897.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Teredinibacter turnerae T7901]
 gi|237686674|gb|ACR13938.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Teredinibacter turnerae T7901]
          Length = 203

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 91/203 (44%), Gaps = 15/203 (7%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   +V+AS N  K+ E   ++   G+         +   EETG +F ENA++K+  A +
Sbjct: 1   MNKTVVLASGNPGKLREFQQMLQTCGLDVVPQGNFAVPDIEETGLTFVENAILKARNACE 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           + G PA++DDSG+ +D L+G PGI+SAR++    GE   D           +        
Sbjct: 61  HTGHPAIADDSGIEVDALNGAPGIYSARFSNGWQGENASDDRNNAYLLERLAGVPDAQRT 120

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                + V      D           G I+  P+G+ GFGYDP+F  +  + T  ++ ++
Sbjct: 121 ARYQCVLVYMRHAADPTPLICQASWEGRILTAPQGENGFGYDPLFWLDELNCTSAQLPKD 180

Query: 185 EKNGGIDSATLFSILSTDLLSHR 207
           EKN                +SHR
Sbjct: 181 EKN---------------RISHR 188


>gi|15676539|ref|NP_273682.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria meningitidis MC58]
 gi|161869572|ref|YP_001598739.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria meningitidis 053442]
 gi|22653776|sp|Q9K0G6|NTPA_NEIMB RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|7225868|gb|AAF41062.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|161595125|gb|ABX72785.1| HAM1 -like protein [Neisseria meningitidis 053442]
 gi|308388826|gb|ADO31146.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Neisseria meningitidis alpha710]
 gi|316984684|gb|EFV63647.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis H44/76]
 gi|325133847|gb|EGC56503.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis M13399]
 gi|325139911|gb|EGC62442.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis CU385]
 gi|325143976|gb|EGC66286.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis M01-240013]
 gi|325200675|gb|ADY96130.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis H44/76]
 gi|325206515|gb|ADZ01968.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis M04-240196]
          Length = 199

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 62/211 (29%), Positives = 81/211 (38%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P  I         +    E   +F ENA+ K+  AAK +G
Sbjct: 7   KIVLASGNAGKLEEFGNLFKPYSITVLPQSAFGIPECPEPYPTFVENALAKARHAAKYSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A  N                              
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGDN-----PKSDTANNLKLAAELVGKADKSCCY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V      D       G   G     P GQ GFGYDP F    + +T  E+  E KN
Sbjct: 122 VCVLVFVRHKDDPRPIIAEGVWHGQWNDTPLGQNGFGYDPYFYLPEHGKTAAELDTEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALAELLRKL 197


>gi|260587537|ref|ZP_05853450.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Blautia
           hansenii DSM 20583]
 gi|331084192|ref|ZP_08333298.1| Ham1 family protein [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260541802|gb|EEX22371.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Blautia
           hansenii DSM 20583]
 gi|330402047|gb|EGG81620.1| Ham1 family protein [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 199

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 66/211 (31%), Positives = 99/211 (46%), Gaps = 22/211 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAK 64
              ++ A+ N  K+ E+  ++  L +   S  ++ +     E GN+FEENA+IK+    K
Sbjct: 1   MRRLIFATGNEHKMVEIREILGELPVEILSMKDVGIKADIVENGNTFEENALIKAKEVCK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            AG   L+DDSGL ID L+G+PGI+SAR+   +T     +  +                 
Sbjct: 61  LAGEMVLADDSGLEIDYLNGEPGIYSARYMGEDTSYHIKNQNLIDRLE------GVPDEK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+  ++ A+PDG      G + GII +  RG  GFGYDPIF       +  E+  E
Sbjct: 115 RTARFVCAIAAAFPDGRSFVVRGTIEGIIGYEERGTNGFGYDPIFYLPERGVSTAEIPPE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFV 215
           EKN                +SHR  A +   
Sbjct: 175 EKNS---------------ISHRGNALRKMK 190


>gi|317057723|ref|YP_004106190.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ruminococcus albus 7]
 gi|315449992|gb|ADU23556.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Ruminococcus albus 7]
          Length = 201

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 72/214 (33%), Positives = 102/214 (47%), Gaps = 25/214 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAAK 64
              +VIAS+N  KI E   ++   G    S  E  L    EETG +F EN+ +K+  A K
Sbjct: 9   IMKLVIASNNKGKIREYKQILEKHGYEVMSQSEAGLDLEVEETGTTFAENSALKARAAYK 68

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G   L+DDSGL +D L+G+PG++SAR+   +   +     ++K+E+            
Sbjct: 69  ALGCAVLADDSGLSVDALNGEPGVYSARYGGIDNDMKRSLYLLKKMEDVPDD-------K 121

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R AHF+  +     DG      G+V G I   P G+ GFGYDPIF   G  R+F ++  E
Sbjct: 122 RGAHFVCTIHFIDTDGSEICVEGRVYGTINRAPVGENGFGYDPIFMYEG--RSFAQIPAE 179

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           EKN                +SHRA A K   +  
Sbjct: 180 EKNA---------------VSHRANALKQLEEKL 198


>gi|311693172|gb|ADP96045.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [marine
           bacterium HP15]
          Length = 199

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 72/217 (33%), Positives = 108/217 (49%), Gaps = 23/217 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           + N +VIAS+N  KI E+  L+ PLG+   +  +L +   EE   +F ENA++K+  AA+
Sbjct: 1   MTNRLVIASNNRGKIAELTELLAPLGMTPIAQGDLGVGEAEEPAVTFVENAILKARHAAR 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+PAL+DDSGL +D L+G+PG+ SAR+A  +  ++D   A+      L +        
Sbjct: 61  ETGLPALADDSGLAVDALEGRPGVRSARFAGDDATDQDNVDAL------LDAMAGVPDGQ 114

Query: 125 RSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F  VL       D       G+  G I+  P+G  GFGYDP+F    +  +  E++
Sbjct: 115 RGAQFHCVLVYLRHAEDPTPIICHGRWPGSILRSPQGDGGFGYDPVFLAPEHGCSAAELS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             EK                 +SHR RA K  +D   
Sbjct: 175 RAEK---------------GSISHRGRALKILLDQLK 196


>gi|229163444|ref|ZP_04291395.1| Nucleoside-triphosphatase [Bacillus cereus R309803]
 gi|228620013|gb|EEK76888.1| Nucleoside-triphosphatase [Bacillus cereus R309803]
          Length = 205

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 65/216 (30%), Positives = 106/216 (49%), Gaps = 24/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              +V+A+ N+ K+ E   L     +   S  +   +   EETG +FEENA++K+ + ++
Sbjct: 4   MKQVVVATKNLGKVREFAELFGRFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSR 63

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D L+GKPG++SAR+A     ++        I+  L+     D   
Sbjct: 64  QLNAIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQ------ANIDKVLQELNDVDFEK 117

Query: 125 RSAHFISVLSLAWPDGHVENF--SGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+   E    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEADKEPVIVNGTCEGYILEQRRGENGFGYDPIFYVKEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +EKN                +SHR RA +   +  
Sbjct: 178 SDEKNA---------------ISHRGRALRKLEEKI 198


>gi|228993219|ref|ZP_04153140.1| Nucleoside-triphosphatase [Bacillus pseudomycoides DSM 12442]
 gi|228766545|gb|EEM15187.1| Nucleoside-triphosphatase [Bacillus pseudomycoides DSM 12442]
          Length = 206

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 67/216 (31%), Positives = 105/216 (48%), Gaps = 24/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
             ++V+A+ N+ K+ E   L     +   S  +  N+   EETG +FEENA++K+ +  K
Sbjct: 4   MKHVVVATKNIGKVREFAELFERFDLEVKSLHDFPNIEEVEETGETFEENALLKADSLCK 63

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D L+G PG+ SAR+A     ++        I+  L          
Sbjct: 64  QLNSIVIADDSGLIVDALNGNPGVRSARYAGEQKDDQ------ANIDKVLTGLDGVSMEK 117

Query: 125 RSAHFISVLSLAWPDGHVE--NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R+A F   L++A+P+ + E    +G   G I+   RG+ GFGYDPIF    Y R   E+T
Sbjct: 118 RTARFYCALAVAFPEENKESVIVNGTCEGKILEQRRGENGFGYDPIFYVEEYKRAMAELT 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +EKN                +SHR RA +   +  
Sbjct: 178 SDEKNE---------------ISHRGRALRKLEEKI 198


>gi|89074112|ref|ZP_01160611.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Photobacterium sp. SKA34]
 gi|89050048|gb|EAR55574.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Photobacterium sp. SKA34]
          Length = 197

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 63/216 (29%), Positives = 95/216 (43%), Gaps = 23/216 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            + +V+A+ N  K+ EM  L+   G    +  + N+    ETG +F ENA+IK+  AAK 
Sbjct: 1   MSKLVLATGNQGKVKEMADLLADFGFDVVAQSDYNVSSVAETGTTFIENAIIKARHAAKE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+PA++DDSGL +D L+G PGI+SAR+A  +  +         I+  L          R
Sbjct: 61  TGLPAIADDSGLEVDYLNGAPGIYSARFAGKDASDA------DNIDKLLVEMKDVPVEQR 114

Query: 126 SAHFISVLSLAWPDGH--VENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
           +A F  VL +   +         G   G I+    G+ GFGYDP+F          ++  
Sbjct: 115 TARFHCVLVMMRHENDPTPLVCHGSWEGSILNERHGENGFGYDPVFWVPEDQCASAQLPP 174

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
             K                 LSHR +A +       
Sbjct: 175 ARK---------------KQLSHRGKALQQLFSALK 195


>gi|289422671|ref|ZP_06424511.1| tRNA nucleotidyltransferase [Peptostreptococcus anaerobius 653-L]
 gi|289156850|gb|EFD05475.1| tRNA nucleotidyltransferase [Peptostreptococcus anaerobius 653-L]
          Length = 475

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 75/221 (33%), Positives = 109/221 (49%), Gaps = 23/221 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI--IPEETGNSFEENAMIKSLTAA 63
           +   VIA+ N+ K+ E+ +++  L     S  +++L      E G +FE NA+IK+ T A
Sbjct: 273 KREAVIATGNMHKLEEIKTMLSDLDFKILSMKDVDLEGLEIIENGRTFEHNALIKARTIA 332

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  GM A+ DDSG+ +D LD +PGI+SAR+A  N  +                       
Sbjct: 333 KKTGMIAIGDDSGIEVDALDKRPGIYSARYAGENATDE------DNRNKMFEELEGVPMD 386

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            R+A F+ V++L +PDG      GKV G I     G  GFGYD +F P GYD TFG ++ 
Sbjct: 387 KRTARFVCVIALVFPDGKEILARGKVEGKIAIKTSGDNGFGYDSMFIPEGYDETFGVLSP 446

Query: 184 EEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           E KN                 SHR+RA +   D  ++I  +
Sbjct: 447 EIKNS---------------FSHRSRALEIMKDKLIKILAE 472


>gi|229098952|ref|ZP_04229887.1| Nucleoside-triphosphatase [Bacillus cereus Rock3-29]
 gi|229117981|ref|ZP_04247341.1| Nucleoside-triphosphatase [Bacillus cereus Rock1-3]
 gi|228665430|gb|EEL20912.1| Nucleoside-triphosphatase [Bacillus cereus Rock1-3]
 gi|228684450|gb|EEL38393.1| Nucleoside-triphosphatase [Bacillus cereus Rock3-29]
          Length = 205

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 106/216 (49%), Gaps = 24/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              +V+A+ N+ K+ E   L     +   S  +   +   EETG +FEENA++K+ + ++
Sbjct: 4   MKQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSR 63

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D L+GKPG++SAR+A     ++        ++  L+     D   
Sbjct: 64  QLDSIVIADDSGLIVDALNGKPGVYSARFAGEPKDDQ------ANMDKVLQELNGIDFEK 117

Query: 125 RSAHFISVLSLAWPDGHVENF--SGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+   E    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEADKEPVIVNGTCEGYILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +EKN                +SHR RA +   +  
Sbjct: 178 SDEKNA---------------ISHRGRALRKLEEKI 198


>gi|240102226|ref|YP_002958534.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Thermococcus gammatolerans EJ3]
 gi|239909779|gb|ACS32670.1| Nucleoside triphosphate phosphohydrolase [Thermococcus
           gammatolerans EJ3]
          Length = 184

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 93/217 (42%), Gaps = 33/217 (15%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +   + N  K+ E      PLG+      +L++  PE   ++ EE A   +   A   
Sbjct: 1   MRLAFITSNPGKVEEAKRYFEPLGVEVY---QLHMSYPEIQADTLEEVAEYGARWLAGRI 57

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
             P   DDSGL ++ L G PG++SA   ++             I   L  +       R 
Sbjct: 58  DGPFFLDDSGLFVEALKGFPGVYSAYVYKTLG--------YWGILKLLEGES-----NRK 104

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A+F SV++    +     F GKV G I   PRG  GFG+DP+F P G+DRTF EMT EEK
Sbjct: 105 AYFKSVIAYWDGEL--HIFRGKVDGKITEEPRGSGGFGFDPVFIPEGFDRTFAEMTTEEK 162

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDE 223
           N                +SHR RA K F        +
Sbjct: 163 NA---------------ISHRGRALKAFATWLKENLK 184


>gi|60683785|ref|YP_213929.1| putative deoxyribonucleoside-triphosphatase [Bacteroides fragilis
           NCTC 9343]
 gi|60495219|emb|CAH10040.1| putative Ham1-like protein [Bacteroides fragilis NCTC 9343]
          Length = 194

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 105/219 (47%), Gaps = 27/219 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTA 62
           ++  +V A++N  K+ E+ +++    +   S  ++N    IPE T  + E NA +KS   
Sbjct: 1   MKRKLVFATNNAHKLEEVSAILGDK-VELLSLNDINCHTDIPE-TAETLEGNAYLKSSFI 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            +N G+   +DD+GL ++ L G PGI+SAR+A       + +  M K+ + L        
Sbjct: 59  YRNYGLNCFADDTGLEVESLGGAPGIYSARYAGGEG--HNAEANMLKLLHELEG-----K 111

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F + +SL   +     F G + G I+   RG  GFGYDP+F P GYDRTF E+ 
Sbjct: 112 DNRRAQFRTAISLILDEKEYL-FEGIIKGEIIKEKRGDSGFGYDPVFVPEGYDRTFAELG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            E KN                +SHRA A     +    I
Sbjct: 171 NEIKNQ---------------ISHRALAVNKLCEFLRSI 194


>gi|296328289|ref|ZP_06870818.1| ribonuclease PH/Ham1 protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296154593|gb|EFG95381.1| ribonuclease PH/Ham1 protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 434

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 66/217 (30%), Positives = 107/217 (49%), Gaps = 27/217 (12%)

Query: 8   NIVIASHNVDKIHEMDSLIMPL-GIMTTSALE-LNLIIPEETGNSFEENAMIKSLTAAKN 65
            I +A+ N  KI E+  +   +  I   S  + + +    E G++FE N+  K++  +K 
Sbjct: 243 KIFLATANKHKIEEISDIFSGIENIEILSIKDGIEIPEVIEDGDTFEANSKKKAVEISKF 302

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             M  ++DDSGL +D L+G+PG++SAR++ +    ++ +  +                 R
Sbjct: 303 LNMITIADDSGLCVDALNGEPGVYSARYSGTGDDLKNNEKLIN---------NLQGIENR 353

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
           +A F+SV++LA P+G V +F G++ G IV  PRG  GFGYDP F    Y +T  E+  E 
Sbjct: 354 NAKFVSVITLAKPNGEVYSFRGEIQGKIVDTPRGNTGFGYDPHFYVEEYQKTLAEL-PEL 412

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
           KN                +SHRA+A +        I 
Sbjct: 413 KNK---------------ISHRAKALEKLKKELKNIL 434


>gi|254804521|ref|YP_003082742.1| HAM1-like protein [Neisseria meningitidis alpha14]
 gi|254668063|emb|CBA04527.1| HAM1-like protein [Neisseria meningitidis alpha14]
 gi|325135768|gb|EGC58380.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Neisseria meningitidis M0579]
          Length = 199

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 85/211 (40%), Gaps = 20/211 (9%)

Query: 8   NIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAG 67
            IV+AS N  K+ E  +L  P  I         +    E  ++F ENA+ K+  AAK +G
Sbjct: 7   KIVLASGNAGKLEEFGNLFKPYSITVLPQSTFGIPECPEPYSTFVENALAKARHAAKYSG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
           +PAL+DDSG+    L+G PGIHSAR+A SN                              
Sbjct: 67  LPALADDSGICAAALNGAPGIHSARYAGSN-----PKSDTANNLKLAAELAGKADKSCCY 121

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
             + V  L   D       G   G     P G+ GFGYDP F   G+ +T  E+  E KN
Sbjct: 122 VCVLVFVLHKDDPRPIIAEGVWHGQWNGVPAGENGFGYDPYFYLPGHGKTAAELDSEVKN 181

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
                            SHRA+A    +   
Sbjct: 182 RE---------------SHRAQALAELLRKL 197


>gi|288942594|ref|YP_003444834.1| non-canonical purine NTP pyrophosphatase [Allochromatium vinosum
           DSM 180]
 gi|288897966|gb|ADC63802.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Allochromatium vinosum DSM 180]
          Length = 202

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 70/212 (33%), Positives = 100/212 (47%), Gaps = 23/212 (10%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           IV+AS+N  K+ E++ L+    +      E  +   EETG +F ENA++K+  AA+++G+
Sbjct: 10  IVLASNNAGKVREIERLLAECHVHIRPQGEYGIPEAEETGLTFVENAILKARNAARHSGL 69

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
           PA++DDSGL +D L G PGI+SAR+A     +             L        A R+A 
Sbjct: 70  PAIADDSGLEVDALCGAPGIYSARYAGPGATDEANLR------KLLADLKDVPEAERTAR 123

Query: 129 FISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           F  VL       D       G   G I+  PRG  GFGYDPIF     DR+  E+  + K
Sbjct: 124 FQCVLVYLRHAEDPTPLICQGTWEGSILSEPRGTSGFGYDPIFLVPSLDRSSAELDPDTK 183

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           N                LSHR +A +   +  
Sbjct: 184 N---------------RLSHRGQALRRLQEQL 200


>gi|298368353|ref|ZP_06979671.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282356|gb|EFI23843.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Neisseria sp. oral taxon 014 str. F0314]
          Length = 197

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 59/217 (27%), Positives = 90/217 (41%), Gaps = 20/217 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           +   IV+AS N  K+ E   L   L I      + +     E  ++F ENA+ K+L AAK
Sbjct: 1   MFEKIVLASGNTGKLKEFSRLFADLNIEVLPQSQFDTPECPEPYHTFVENALAKALHAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           ++G+PAL+DDSG+    L+G PG+ SAR+A      +      +++ + L  K      +
Sbjct: 61  HSGLPALADDSGICTAALNGAPGVLSARYAG--ANPKSDTANNKRLSDDLADKADKSCYY 118

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                + V      D       G   G       G  GFGYDP F    ++ T  E+  E
Sbjct: 119 ---VCVLVFVRHENDPQPIIAEGIWRGQWQTEAAGTHGFGYDPHFYLPEHNCTAAELAPE 175

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
            KN                 SHR +A +  +     +
Sbjct: 176 IKNAE---------------SHRGQALRELLRKIEAL 197


>gi|255308380|ref|ZP_05352551.1| ribonuclease PH [Clostridium difficile ATCC 43255]
          Length = 449

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 70/216 (32%), Positives = 111/216 (51%), Gaps = 23/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAK 64
           N +VIA++N  K+ E+  ++        S  +++L   E  E G +FE NA+IK+ T AK
Sbjct: 251 NEVVIATNNAHKLEEIGEILKDFEYKVYSLKDVDLAGIEIVEDGKTFEHNALIKARTIAK 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
              + A+SDDSGL +D L  KPG++SAR+A  +  + +           L++      + 
Sbjct: 311 KTKLIAISDDSGLEVDALGKKPGVYSARYAGEHATDEENRK------KLLKAMQNVPMSK 364

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+S +++ +PDG      G   G+I +  +G+ GFGYD +F   GYD+TFGE+   
Sbjct: 365 RNARFVSAIAVVFPDGKEFVVRGICEGMIGFEEKGKNGFGYDSLFIVKGYDKTFGEIPSV 424

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            KN                +SHRA A K      ++
Sbjct: 425 IKNS---------------ISHRANALKLMKQEFIK 445


>gi|329896510|ref|ZP_08271568.1| Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [gamma proteobacterium IMCC3088]
 gi|328921727|gb|EGG29100.1| Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific)
           [gamma proteobacterium IMCC3088]
          Length = 196

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 71/213 (33%), Positives = 100/213 (46%), Gaps = 21/213 (9%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
            N +V+AS N  K+ E+  ++ PLG       E NL   +ETG SF ENA++K+  AA+ 
Sbjct: 1   MNKLVLASGNAGKLKELSEILNPLGFELIPQGEFNLDSADETGLSFVENALLKARYAAQE 60

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
            G+ AL+DDSGL +D L G PGI+SAR+     G+      ++ +   L       P   
Sbjct: 61  TGLGALADDSGLCVDCLGGAPGIYSARF-----GDGTDHGNLEALLATLAHHGDG-PWPA 114

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H   VL     D       G+  G I+  P+G  GFGYDPIF     + T  E+ +++
Sbjct: 115 HYHCTLVLVKHAEDPDPIIAQGRWQGEIIATPKGDGGFGYDPIFYCRKLEVTAAELPKDQ 174

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
           KN                +SHR  A K   D  
Sbjct: 175 KN---------------RISHRGIAAKALYDQL 192


>gi|190149810|ref|YP_001968335.1| HAM1-like protein [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|303250256|ref|ZP_07336456.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|303252134|ref|ZP_07338302.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307247470|ref|ZP_07529515.1| Nucleoside-triphosphatase [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307252021|ref|ZP_07533921.1| Nucleoside-triphosphatase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307256519|ref|ZP_07538300.1| Nucleoside-triphosphatase [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307260948|ref|ZP_07542631.1| Nucleoside-triphosphatase [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307263130|ref|ZP_07544751.1| Nucleoside-triphosphatase [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|189914941|gb|ACE61193.1| HAM1-like protein [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|302648917|gb|EFL79105.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|302650872|gb|EFL81028.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306855973|gb|EFM88131.1| Nucleoside-triphosphatase [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306860490|gb|EFM92503.1| Nucleoside-triphosphatase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306864929|gb|EFM96831.1| Nucleoside-triphosphatase [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306869360|gb|EFN01154.1| Nucleoside-triphosphatase [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306871492|gb|EFN03215.1| Nucleoside-triphosphatase [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 198

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 65/219 (29%), Positives = 97/219 (44%), Gaps = 23/219 (10%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           +    +V+A+ N  K+ EM  ++   G    +  E  +  PEETG +F ENA++K+  A+
Sbjct: 1   MERTKVVLATGNKGKVKEMADVLAQFGFDVVAQSEFGIESPEETGLTFVENALLKARYAS 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
           K  G+PA++DDSGL +D L G PG++SAR+A  +  +             L         
Sbjct: 61  KMTGLPAIADDSGLAVDALGGAPGLYSARYAGEDGNDEANRK------KLLAELQNVADE 114

Query: 124 FRSAHF--ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
            R A F    V      D   +   G+  G I+   RGQ GFGYD +F     + +F E+
Sbjct: 115 KRGAKFVSCIVFLQHETDPTPKIALGECFGEILREERGQNGFGYDSLFFYPPKNCSFAEL 174

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
              EK                 +SHRA A        L+
Sbjct: 175 ETSEK---------------KQISHRAIALDVLKQQLLK 198


>gi|255102475|ref|ZP_05331452.1| ribonuclease PH [Clostridium difficile QCD-63q42]
          Length = 449

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 70/216 (32%), Positives = 111/216 (51%), Gaps = 23/216 (10%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE--ETGNSFEENAMIKSLTAAK 64
           N +VIA++N  K+ E+  ++        S  +++L   E  E G +FE NA+IK+ T AK
Sbjct: 251 NEVVIATNNAHKLEEIGEILKDFEYKVYSLKDVDLAGIEIVEDGKTFEHNALIKARTIAK 310

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
              + A+SDDSGL +D L  KPG++SAR+A  +  + +           L++      + 
Sbjct: 311 KTKLIAISDDSGLEVDALGKKPGVYSARYAGEHATDEENRK------KLLKAMQNVPMSK 364

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+S +++ +PDG      G   G+I +  +G+ GFGYD +F   GYD+TFGE+   
Sbjct: 365 RNARFVSAIAVVFPDGKEFVVRGICEGMIGFEEKGKNGFGYDSLFIVKGYDKTFGEIPSV 424

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
            KN                +SHRA A K      ++
Sbjct: 425 IKNS---------------ISHRANALKLMKQEFIK 445


>gi|152976901|ref|YP_001376418.1| RdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Bacillus
           cereus subsp. cytotoxis NVH 391-98]
 gi|152025653|gb|ABS23423.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Bacillus cytotoxicus NVH 391-98]
          Length = 202

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 66/216 (30%), Positives = 100/216 (46%), Gaps = 24/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              +VIA+ N+ K+ E   L     +   S  +   +   EETG +FEENA++K+ +  K
Sbjct: 1   MKQVVIATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLCK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D L GKPG+ SAR+A     ++        I+  L          
Sbjct: 61  QLNSIVIADDSGLIVDALHGKPGVRSARYAGEPKDDQ------ANIDKVLSELEGVSLEK 114

Query: 125 RSAHFISVLSLAWPDGHVENF--SGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R+A F   L++A+P+   E    +G   G I+   RG  GFGYDPIF    Y +   E+ 
Sbjct: 115 RTARFYCALAVAFPEDDKEPVIVNGTCEGKILEQRRGHNGFGYDPIFYVEEYKKAMAELN 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +EKN                +SHR RA +   +  
Sbjct: 175 SDEKN---------------TISHRGRALRKLEEKI 195


>gi|325266374|ref|ZP_08133052.1| non-canonical purine NTP pyrophosphatase RdgB [Kingella
           denitrificans ATCC 33394]
 gi|324982167|gb|EGC17801.1| non-canonical purine NTP pyrophosphatase RdgB [Kingella
           denitrificans ATCC 33394]
          Length = 201

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 90/210 (42%), Gaps = 20/210 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           + + IV+AS+N  K+ E ++L     I      +       E   +F ENA+ K+  AAK
Sbjct: 1   MTDTIVLASNNAGKLKEFNALFAERHIRILPQSQFVQEECAEPYQTFVENALAKARFAAK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
           ++G+PAL+DDSG+ +  L G PG+ SAR+A  +   +       K+   L         +
Sbjct: 61  HSGLPALADDSGICVRALGGAPGVLSARFAGDH--PKSDAANNAKVSELLAQHDDRYCYY 118

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
                + VL     D       G   G     P G  GFGYDP F    +  T  E+  E
Sbjct: 119 ---VCVLVLVRHESDPQPVIAEGIWPGQWQMQPAGGHGFGYDPHFYLPEHGCTAAELPPE 175

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCF 214
           +KN                +SHRA+A +  
Sbjct: 176 QKNQ---------------ISHRAQALQAL 190


>gi|313619284|gb|EFR91025.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Listeria innocua FSL S4-378]
          Length = 203

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 68/220 (30%), Positives = 105/220 (47%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D L+G PG++SAR+A     +   +      E  L++    +PA 
Sbjct: 61  LLNQTVIADDSGLIVDALNGAPGVYSARYAGVAHDDAKNN------EKLLKNLEGVEPAK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V GII     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTSFYTGEVEGIIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNE---------------ISHRANAIKQLEKDLAEVVEK 199


>gi|242281023|ref|YP_002993152.1| deoxyribonucleotide triphosphate pyrophosphatase [Desulfovibrio
           salexigens DSM 2638]
 gi|242123917|gb|ACS81613.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Desulfovibrio salexigens DSM 2638]
          Length = 202

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 64/220 (29%), Positives = 98/220 (44%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              +V+A+ N  KI E + L+  LG+      +   +    E G +F ENA+IK+ T A 
Sbjct: 1   MKTVVLATSNKGKIAEFNELLKDLGLEVKGLDQFPEIGEIPEPGETFLENAIIKAQTVAN 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+ A++DDSGL +D L G+PG++SAR++  +      +         L          
Sbjct: 61  LTGLVAVADDSGLEVDALGGRPGVYSARYSGEDATPEKNNA------KLLEELDGVAEEE 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F+ V+  A PD       G+  G I +   G+ GFGYDP+F          EMT E
Sbjct: 115 RTARFVCVMVAATPDNIRIQSRGEWEGRIAFELTGKQGFGYDPLFFDPELGCVAAEMTRE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
            KN                 SHR +A +  ++      E+
Sbjct: 175 TKNAR---------------SHRGKALRALMEQWADFQER 199


>gi|157273476|gb|ABV27375.1| non-canonical purine NTP pyrophosphatase RdgB/HAM1 family protein
           [Candidatus Chloracidobacterium thermophilum]
          Length = 203

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 73/217 (33%), Positives = 102/217 (47%), Gaps = 23/217 (10%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIP-EETGNSFEENAMIKSLTAAKNAG 67
           +++A+ N  K+ E   L+  L +          ++P  ET  +FE NA +K+ T     G
Sbjct: 7   LILATRNAGKLVEFRHLLADLNLEVIGLDAFPTVLPVRETETTFEANARLKARTVQAQTG 66

Query: 68  MPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSA 127
              ++DDSGL++D LDG PG+ SAR+A     +       + I   L +     P  R+A
Sbjct: 67  GWVIADDSGLLVDALDGAPGVFSARYAGEQASDA------ENIAKLLAALRNVPPDQRTA 120

Query: 128 HFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKN 187
            F+ VL+L         F+G  +G +   PRGQ GFGYDP+F P G  RTF EMT EEK 
Sbjct: 121 QFVCVLALVTETDE-ACFTGICTGRLTDAPRGQYGFGYDPLFIPAGDTRTFAEMTLEEKA 179

Query: 188 GGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
                            SHRARA +  V        K
Sbjct: 180 A---------------YSHRARAARALVTALQARLAK 201


>gi|94499858|ref|ZP_01306394.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanobacter sp. RED65]
 gi|94428059|gb|EAT13033.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Oceanobacter sp. RED65]
          Length = 205

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 102/219 (46%), Gaps = 18/219 (8%)

Query: 4   LIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAA 63
           + +  IV+AS N  K+ E+ + +    +      E ++   +ETG SF ENA++K+  A+
Sbjct: 1   MSKQTIVLASGNKGKLAELQNALDGFDVELVPQKEFDVTDVDETGLSFIENAILKARHAS 60

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNT-GERDFDMAMQKIENALRSKFAHDP 122
              G+PAL+DDSGL +D LDG+PGI+SAR+++ +       D         L+      P
Sbjct: 61  LATGLPALADDSGLEVDALDGEPGIYSARYSQLDPVFSESDDKDENNNLKLLKQLKHVQP 120

Query: 123 AFRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
             RSA F  VL+      D +     G   G I     G  GFGYDP+F     + T  +
Sbjct: 121 ENRSARFHCVLAFVRHAKDPNPLICQGSWEGQIEIEISGDGGFGYDPLFFVKEENCTAAQ 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
           +++E+KN                +SHR +A         
Sbjct: 181 LSKEKKNE---------------ISHRGKAIAQLKQVFR 204


>gi|254993150|ref|ZP_05275340.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family protein
           [Listeria monocytogenes FSL J2-064]
          Length = 203

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 66/220 (30%), Positives = 103/220 (46%), Gaps = 22/220 (10%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
            + I+IA+ N  K  E + +     I   +  +   +   EETG +F ENA +K+ T A 
Sbjct: 1   MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D LDG PG++SAR+A     +   +      E  L++    +   
Sbjct: 61  LLNQTVIADDSGLIVDALDGAPGVYSARYAGVAHDDAKNN------EKLLKNLEGVESDK 114

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R+A F   L++A P      ++G+V G+I     G  GFGYDP+F    +  T  E+  E
Sbjct: 115 RTARFHCTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAE 174

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           +KN                +SHRA A K    +   + EK
Sbjct: 175 KKNE---------------ISHRANAIKQLEKDLAEVVEK 199


>gi|296118695|ref|ZP_06837271.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Corynebacterium ammoniagenes DSM 20306]
 gi|295968184|gb|EFG81433.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Corynebacterium ammoniagenes DSM 20306]
          Length = 202

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 65/220 (29%), Positives = 107/220 (48%), Gaps = 25/220 (11%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL----NLIIPEETGNSFEENAMIKSLTA 62
             +++AS+N  K+ E++ ++   GI +   + L        P E G +F +NA+IK+   
Sbjct: 1   MKLLVASNNSKKLQELEKILADAGIDSVQLVPLRDVDPYEEPVEDGRTFADNALIKAHAG 60

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
           A+  G+  ++DDSG+ ++ L+G PG+ SARW+  +  +   +  +      L        
Sbjct: 61  ARETGLACIADDSGIAVEELNGMPGVLSARWSGEHGNDEANNQLL------LAQMAHVPE 114

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F+SV ++  P G      G+  G ++  PRG+ GFGYDP+FQP G  R+  E++
Sbjct: 115 ERRQAAFVSVCAVVTPAGQEHVAEGRWPGRLLTSPRGEAGFGYDPLFQPEGDSRSAAELS 174

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID 222
            EEKN                 SHR RA    V    ++ 
Sbjct: 175 PEEKNAA---------------SHRGRALAQLVPVIEKLA 199


>gi|227538447|ref|ZP_03968496.1| nucleoside-triphosphatase [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227241729|gb|EEI91744.1| nucleoside-triphosphatase [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 191

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 112/217 (51%), Gaps = 27/217 (12%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMP-LGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
              ++ A++N  K+ E+ +++     I +   +     IPE TG++FEENA  K+     
Sbjct: 1   MIELIFATNNAHKLDEVRAIVGDAFMIKSLDDINCQDDIPE-TGDTFEENAKQKTDYLVN 59

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+    DDSGL I+ ++ +PG++SAR++ S   ER+ D+ ++K+ +            
Sbjct: 60  KYGLYCFGDDSGLEIEAINNEPGVYSARYSGSRDMERNIDLVLEKLAD---------SEN 110

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F +V+SL   +     F G ++G I+   RG  GFGYDPIF P+GYD+TF EM+ +
Sbjct: 111 RKARFRTVISLFLNEQQ-HFFEGAITGTIISERRGAEGFGYDPIFIPDGYDKTFAEMSAD 169

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI 221
           EKNG               +SHR+ A K        +
Sbjct: 170 EKNG---------------ISHRSIAVKALTGFLKSL 191


>gi|121593342|ref|YP_985238.1| putative deoxyribonucleotide triphosphate pyrophosphatase
           [Acidovorax sp. JS42]
 gi|222110071|ref|YP_002552335.1| deoxyribonucleotide triphosphate pyrophosphatase [Acidovorax ebreus
           TPSY]
 gi|167016354|sp|A1W4I7|NTPA_ACISJ RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|254768049|sp|B9MEJ9|NTPA_DIAST RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|120605422|gb|ABM41162.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Acidovorax sp. JS42]
 gi|221729515|gb|ACM32335.1| non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
           [Acidovorax ebreus TPSY]
          Length = 205

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 58/214 (27%), Positives = 101/214 (47%), Gaps = 18/214 (8%)

Query: 7   NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66
             +V+AS+N  K+ E+ +++ PLG+      EL +   EE  ++F ENA+ K+  A+ + 
Sbjct: 1   MKLVLASNNRGKLAELQAMLAPLGVQLIPQAELGVGEAEEPFHTFVENALAKARFASAHT 60

Query: 67  GMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRS 126
           G+PAL+DD+GL +    G+PG+ +A +A     ++     ++ +   ++       A  S
Sbjct: 61  GLPALADDAGLCVQAFGGQPGVQTAYYATQFGYDKGDANNVRALLEQMQGIDDRRAAMVS 120

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
                V   +  D       G+V+G I   PRG  GFG+DP+     + +TF E+  E K
Sbjct: 121 ---TLVAVRSPQDPEPLIAVGRVAGEIARAPRGTGGFGFDPVMVLPAFGKTFAELPPEVK 177

Query: 187 NGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           N                 SHR R+ +  ++    
Sbjct: 178 NAH---------------SHRGRSSRQMLELMRE 196


>gi|229105116|ref|ZP_04235767.1| Nucleoside-triphosphatase [Bacillus cereus Rock3-28]
 gi|228678297|gb|EEL32523.1| Nucleoside-triphosphatase [Bacillus cereus Rock3-28]
          Length = 205

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 65/216 (30%), Positives = 106/216 (49%), Gaps = 24/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELN-LIIPEETGNSFEENAMIKSLTAAK 64
              +V+A+ N+ K+ E   L     +   S  +   +   EETG +FEENA++K+ + ++
Sbjct: 4   MKQVVVATKNMGKVREFAELFERFDLEVKSLHDFPHIEEVEETGETFEENAILKADSLSR 63

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL+ID L+GKPG++SAR+A     ++        ++  L+     D   
Sbjct: 64  QLDSIVIADDSGLIIDALNGKPGVYSARFAGEPKDDQ------ANMDKVLQELNGIDFEK 117

Query: 125 RSAHFISVLSLAWPDGHVENF--SGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F   L++A+P+   E    +G   G I+   RG+ GFGYDPIF    Y +   E++
Sbjct: 118 RKARFYCALAVAFPEADKEPVIVNGTCEGYILEQRRGENGFGYDPIFYVEEYKKAMAELS 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +EKN                +SHR RA +   +  
Sbjct: 178 SDEKNA---------------ISHRGRALRKLEEKI 198


>gi|228999268|ref|ZP_04158848.1| Nucleoside-triphosphatase [Bacillus mycoides Rock3-17]
 gi|229006823|ref|ZP_04164456.1| Nucleoside-triphosphatase [Bacillus mycoides Rock1-4]
 gi|228754445|gb|EEM03857.1| Nucleoside-triphosphatase [Bacillus mycoides Rock1-4]
 gi|228760465|gb|EEM09431.1| Nucleoside-triphosphatase [Bacillus mycoides Rock3-17]
          Length = 206

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 67/216 (31%), Positives = 105/216 (48%), Gaps = 24/216 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALEL-NLIIPEETGNSFEENAMIKSLTAAK 64
             ++V+A+ N+ K+ E   L     +   S  +  N+   EETG +FEENA++K+ +  K
Sbjct: 4   MKHVVVATKNMGKVREFAELFERFDLEVKSLHDFPNIEEVEETGETFEENALLKADSLCK 63

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
                 ++DDSGL++D L+G PG+ SAR+A     ++        I+  L          
Sbjct: 64  QLNSIVIADDSGLIVDALNGNPGVRSARYAGEQKDDQ------ANIDKVLTGLDGVSMEK 117

Query: 125 RSAHFISVLSLAWPDGHVE--NFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R+A F   L++A+P+ + E    +G   G I+   RG+ GFGYDPIF    Y R   E+T
Sbjct: 118 RTARFYCALAVAFPEENKEAVIVNGTCEGKILEQRRGENGFGYDPIFYVEEYKRAMAELT 177

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            +EKN                +SHR RA +   +  
Sbjct: 178 SDEKNE---------------ISHRGRALRKLEEKI 198


>gi|299145101|ref|ZP_07038169.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides sp. 3_1_23]
 gi|298515592|gb|EFI39473.1| non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
           [Bacteroides sp. 3_1_23]
          Length = 193

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 102/216 (47%), Gaps = 27/216 (12%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL--IIPEETGNSFEENAMIKSLTA 62
           ++  +V A++N  K+ E+ +++    +   S  +++    IPE T  + E NA++KS   
Sbjct: 1   MKRKLVFATNNAHKLEEVAAILGDQ-VELLSLNDISCQTDIPE-TAETLEGNALLKSSYI 58

Query: 63  AKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDP 122
            KN  +   +DD+GL ++ L+G PG++SAR+A     +   +M     E           
Sbjct: 59  YKNYHLDCFADDTGLEVEALNGAPGVYSARYAGGEGHDAQANMIKLLHE-------LDGK 111

Query: 123 AFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
             R A F + +SL         F G + G I+   RG  GFGYDP+F P GYDRTF E+ 
Sbjct: 112 ENRKAQFRTAISLILDGKEYL-FEGVIKGEIIKEKRGDSGFGYDPVFMPEGYDRTFAELG 170

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
            + KN                +SHRA A +   +  
Sbjct: 171 NDIKNQ---------------ISHRALAVQKLCEFL 191


>gi|260913233|ref|ZP_05919715.1| non-canonical purine NTP pyrophosphatase RdgB [Pasteurella dagmatis
           ATCC 43325]
 gi|260632820|gb|EEX50989.1| non-canonical purine NTP pyrophosphatase RdgB [Pasteurella dagmatis
           ATCC 43325]
          Length = 202

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 69/216 (31%), Positives = 104/216 (48%), Gaps = 21/216 (9%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAK 64
           ++  +V+A+ N  K+ EM  ++  LG    +  +LN+  PEETG +F ENA++K+  A+K
Sbjct: 1   MKQKVVLATGNQGKVKEMSDVLSDLGFEVIAQTDLNIESPEETGLTFVENALLKARYASK 60

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
            +G+PA++DDSGLV++ L G PG++SAR+A  +          +  E  L        A 
Sbjct: 61  MSGLPAIADDSGLVVNALGGAPGLYSARYAGVD----GAAADAKNREKLLIELKDIPQAA 116

Query: 125 RSAHF--ISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMT 182
           R A F    V+     D       G+  G I +  +GQ GFGYD +F     + TF E+ 
Sbjct: 117 RQAKFVSCIVMLQHETDPSPIIAEGECFGEIAFAEKGQNGFGYDSLFFSPEVNCTFAELE 176

Query: 183 EEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNC 218
             EK                 +SHRARA        
Sbjct: 177 TVEKKK---------------ISHRARALSVLKSKL 197


>gi|34541254|ref|NP_905733.1| putative deoxyribonucleoside-triphosphatase [Porphyromonas
           gingivalis W83]
 gi|62900254|sp|Q7MUC6|NTPA_PORGI RecName: Full=Nucleoside-triphosphatase; AltName: Full=Nucleoside
           triphosphate phosphohydrolase; Short=NTPase
 gi|34397570|gb|AAQ66632.1| HAM1 protein [Porphyromonas gingivalis W83]
          Length = 194

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 65/215 (30%), Positives = 98/215 (45%), Gaps = 25/215 (11%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNL-IIPEETGNSFEENAMIKSLTAAK 64
              ++ A++N  K++E+  ++    +      E+       ET ++ + NA++K+    K
Sbjct: 1   MEKLIFATNNPHKLNEIRHILEGK-VEIVGLDEIGCREDIPETADTLQGNALLKAEFVHK 59

Query: 65  NAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAF 124
             G+P  +DD+GL ++ LD  PG+HSAR+A   T               L    +  P  
Sbjct: 60  RYGLPCFADDTGLEVEALDRAPGVHSARYAGEPT-------NADANVRKLLEALSSVPHP 112

Query: 125 RSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEE 184
           R A F +V++L    G    F GK+ G I    RG  GFGYDP+F P G+  +F EM EE
Sbjct: 113 RKACFRTVIALIDDHGK-HFFEGKIEGTIASECRGSGGFGYDPVFIPEGHTLSFAEMGEE 171

Query: 185 EKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCL 219
            KN                +SHRA A     D  L
Sbjct: 172 TKNQ---------------ISHRALAVAQLRDFLL 191


>gi|331004481|ref|ZP_08327952.1| Ham1 family protein [Lachnospiraceae oral taxon 107 str. F0167]
 gi|330411048|gb|EGG90469.1| Ham1 family protein [Lachnospiraceae oral taxon 107 str. F0167]
          Length = 201

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 64/220 (29%), Positives = 97/220 (44%), Gaps = 24/220 (10%)

Query: 5   IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLI-IPEETGNSFEENAMIKSLTAA 63
           +   I+ A+ N +K+ E+ +++    I   SA +  +    EETG SF +NA IK+    
Sbjct: 1   MRRKIIFATGNQNKLKEIRAILPTFDI--ISAKDAGISLDIEETGTSFRDNAYIKAKAIW 58

Query: 64  KNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPA 123
              G   LSDDSGL +D + G+PG++S+R+   NT     +  +       +        
Sbjct: 59  DITGGIVLSDDSGLEVDYIGGEPGVYSSRYMGENTSYTIKNQNIISRLKDAKGNE----- 113

Query: 124 FRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTE 183
            RSA F + +     DG      G + G+I     G+ GFGYDPI     YD+T  E+  
Sbjct: 114 -RSARFRACICAVLEDGSAIFTEGSMEGLISQTI