RPSBLAST alignment for GI: 254780629 and conserved domain: PRK14824

>gnl|CDD|184837 PRK14824, PRK14824, putative deoxyribonucleotide triphosphate pyrophosphatase; Provisional. Length = 201
 Score =  119 bits (301), Expect = 4e-28
 Identities = 68/206 (33%), Positives = 108/206 (52%), Gaps = 21/206 (10%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           I++A+ N  K+ E+  L+  LGI   S  +   I  EE G +F ENA +K+   A+   +
Sbjct: 3   ILLATTNEGKVREIKRLLSDLGIEVLSPDKK--IEVEEDGETFLENAYLKARAYAEFYKI 60

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRS--KFAHDPAFRS 126
           P L+DDSGL +  L+G PG++S+R+ +   G ++ ++   K E  +R   +       R 
Sbjct: 61  PVLADDSGLEVPALEGYPGVYSSRFYQIEFGGKE-EVVESKDEANIRKLLRLLEGKQNRK 119

Query: 127 AHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEK 186
           A F++ + L + D  +    G+  G I   PRG  GFGYDP+F P GY++T  E++ EEK
Sbjct: 120 ARFVAFVVLYFGDWGIWT-EGECRGKIAEEPRGSGGFGYDPVFIPEGYNKTMAELSPEEK 178

Query: 187 NGGIDSATLFSILSTDLLSHRARAFK 212
           N                +SHR +A +
Sbjct: 179 NK---------------ISHRGKAVR 189