RPSBLAST alignment of GI: 254780629 and MMDB domain: 1k7k_A_

>1k7k_A (A:) Hypothetical protein YGGV; MAD, His-TAG, large groove, disordered Se-Met, structural genomics, putative ribosomal protein, PSI; HET: MSE; 1.50A {Escherichia coli}Length = 221
 Score =  177 bits (449), Expect = 1e-45
 Identities = 72/217 (33%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            +     +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  
Sbjct: 19  FQGHXQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARH 78

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK   +PA++DDSGL +DVL G PGI+SAR++     +      +QK+    +      
Sbjct: 79  AAKVTALPAIADDSGLAVDVLGGAPGIYSARYSGE---DATDQKNLQKLLETXKDVPDDQ 135

Query: 122 PAFRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
              R A F  VL       D       G   G+I   P G  GFGYDPIF      +T  
Sbjct: 136 ---RQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAA 192

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           E+T EEK+                +SHR +A K  +D
Sbjct: 193 ELTREEKS---------------AISHRGQALKLLLD 214