RPSBLAST alignment of GI: 254780629 and MMDB domain: 1v7r_A_

>1v7r_A (A:) Hypothetical protein PH1917; ntpase, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; HET: CIT; 1.40A {Pyrococcus horikoshii OT3}Length = 186
 Score =  172 bits (437), Expect = 4e-44
 Identities = 62/208 (29%), Positives = 82/208 (39%), Gaps = 32/208 (15%)

Query: 9   IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGM 68
           I   + N  K+ E+ + +   GI       L    PE      E+               
Sbjct: 3   IFFITSNPGKVREVANFLGTFGIEIVQ---LKHEYPEIQAEKLEDVVDFGISWLKGKVPE 59

Query: 69  PALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAH 128
           P + +DSGL I+ L G PG++S+    +  G       M+  E             R A+
Sbjct: 60  PFMIEDSGLFIESLKGFPGVYSSYVYRTI-GLEGILKLMEGAE------------DRRAY 106

Query: 129 FISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNG 188
           F SV+           FSG   G I    RG  GFGYDPIF P G ++TF EMT EEKN 
Sbjct: 107 FKSVIGFYIDGKAY-KFSGVTWGRISNEKRGTHGFGYDPIFIPEGSEKTFAEMTIEEKN- 164

Query: 189 GIDSATLFSILSTDLLSHRARAFKCFVD 216
                          LSHR +A K F +
Sbjct: 165 --------------ALSHRGKALKAFFE 178