RPSBLAST alignment of GI: 254780629 and MMDB domain: 2car_A_

>2car_A (A:) Inosine triphosphate pyrophosphatase; hydrolase, inosine triphosphate pyrophosphohydrolase, inosine triphosphatase deficiency, ITP, IMP; 1.09A {Homo sapiens}Length = 196
 Score =  166 bits (422), Expect = 2e-42
 Identities = 57/215 (26%), Positives = 86/215 (40%), Gaps = 30/215 (13%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
             L+   IV  + N  K+ E+  ++      T  A +++L    E     +E ++ K   
Sbjct: 5   ASLVGKKIVFVTGNAKKLEEVVQILGDKFPCTLVAQKIDL---PEYQGEPDEISIQKCQE 61

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A +    P L +D+ L  + L G PG +   + E           +   E+         
Sbjct: 62  AVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEK-LKPEGLHQLLAGFED--------- 111

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
                A     LS   P   V  F G+ SG IV  PRG   FG+DP FQP+GY++T+ EM
Sbjct: 112 -KSAYALCTFALSTGDPSQPVRLFRGRTSGRIVA-PRGCQDFGWDPCFQPDGYEQTYAEM 169

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
            + EKN                +SHR RA     +
Sbjct: 170 PKAEKNA---------------VSHRFRALLELQE 189