RPSBLAST alignment of GI: 254780629 and protein with PDBid: 2car

>2car_A Inosine triphosphate pyrophosphatase; hydrolase, inosine triphosphate pyrophosphohydrolase, inosine triphosphatase deficiency, ITP, IMP; 1.09A {Homo sapiens} SCOP: c.51.4.1 PDB: 2j4e_A* 2i5d_A Length = 196
 Score =  106 bits (264), Expect = 5e-24
 Identities = 52/215 (24%), Positives = 84/215 (39%), Gaps = 30/215 (13%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
             L+   IV  + N  K+ E+  ++      T  A +++L    E     +E ++ K   
Sbjct: 5   ASLVGKKIVFVTGNAKKLEEVVQILGDKFPCTLVAQKIDL---PEYQGEPDEISIQKCQE 61

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           A +    P L +D+ L  + L G PG +   + E    E    +     + +  +     
Sbjct: 62  AVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTF- 120

Query: 122 PAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEM 181
                      LS   P   V  F G+     +  PRG   FG+DP FQP+GY++T+ EM
Sbjct: 121 ----------ALSTGDPSQPVRLFRGRT-SGRIVAPRGCQDFGWDPCFQPDGYEQTYAEM 169

Query: 182 TEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
            + EKN                +SHR RA     +
Sbjct: 170 PKAEKN---------------AVSHRFRALLELQE 189