RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780631|ref|YP_003065044.1| hypothetical protein
CLIBASIA_02590 [Candidatus Liberibacter asiaticus str. psy62]
         (62 letters)



>gnl|CDD|181048 PRK07581, PRK07581, hypothetical protein; Validated.
          Length = 339

 Score = 26.1 bits (58), Expect = 1.9
 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 7/30 (23%)

Query: 40  SRNPCQGGD-------IKAPETVVEIKTDL 62
           SRNP  GGD       I A   V+ I TDL
Sbjct: 258 SRNPAYGGDLAAALGSITAKTFVMPISTDL 287


>gnl|CDD|178792 PRK00011, glyA, serine hydroxymethyltransferase; Reviewed.
          Length = 416

 Score = 24.7 bits (55), Expect = 5.9
 Identities = 10/32 (31%), Positives = 12/32 (37%), Gaps = 10/32 (31%)

Query: 12  HKAGIEVEKNAITTKDNEKKRNPFQGRSSRNP 43
            +A I V KNA+          PF  RS    
Sbjct: 335 EEANITVNKNAV----------PFDPRSPFVT 356


>gnl|CDD|180841 PRK07106, PRK07106, 5-aminoimidazole-4-carboxamide ribonucleotide
           transformylase; Provisional.
          Length = 390

 Score = 24.2 bits (53), Expect = 8.5
 Identities = 6/12 (50%), Positives = 10/12 (83%)

Query: 6   DNIDREHKAGIE 17
           DNI+R  K+G++
Sbjct: 344 DNIERAAKSGVK 355


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.308    0.129    0.366 

Gapped
Lambda     K      H
   0.267   0.0764    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 919,278
Number of extensions: 38549
Number of successful extensions: 48
Number of sequences better than 10.0: 1
Number of HSP's gapped: 48
Number of HSP's successfully gapped: 5
Length of query: 62
Length of database: 5,994,473
Length adjustment: 34
Effective length of query: 28
Effective length of database: 5,259,801
Effective search space: 147274428
Effective search space used: 147274428
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 50 (23.0 bits)