RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780631|ref|YP_003065044.1| hypothetical protein
CLIBASIA_02590 [Candidatus Liberibacter asiaticus str. psy62]
         (62 letters)



>4sbv_A Southern bean mosaic virus coat protein; coat protein (viral),
          icosahedral virus; 2.80A {Southern bean mosaic virus}
          SCOP: b.121.4.7
          Length = 260

 Score = 24.6 bits (53), Expect = 5.6
 Identities = 8/33 (24%), Positives = 12/33 (36%)

Query: 20 KNAITTKDNEKKRNPFQGRSSRNPCQGGDIKAP 52
          +N +      K+R   +      P Q G   AP
Sbjct: 14 QNTLPNPPRRKRRAKRRAAQVPKPTQAGVSMAP 46


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.308    0.129    0.366 

Gapped
Lambda     K      H
   0.267   0.0557    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 486,158
Number of extensions: 15213
Number of successful extensions: 16
Number of sequences better than 10.0: 1
Number of HSP's gapped: 16
Number of HSP's successfully gapped: 2
Length of query: 62
Length of database: 5,693,230
Length adjustment: 33
Effective length of query: 29
Effective length of database: 4,893,178
Effective search space: 141902162
Effective search space used: 141902162
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 50 (23.4 bits)