RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780632|ref|YP_003065045.1| hypothetical protein CLIBASIA_02595 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >gnl|CDD|183406 PRK12288, PRK12288, GTPase RsgA; Reviewed. Length = 347 Score = 25.6 bits (57), Expect = 2.6 Identities = 10/32 (31%), Positives = 15/32 (46%) Query: 7 TLESLMVSFRVDMSPAVQLQCGLGSSIVAVKP 38 T+ SL+ RV P + G+ + AV P Sbjct: 69 TIRSLVTGDRVVWRPGKEALEGVSGVVEAVHP 100 >gnl|CDD|180905 PRK07246, PRK07246, bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated. Length = 820 Score = 25.0 bits (55), Expect = 4.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 5 PETLESLMVSFRVDMSPAVQLQCGLG 30 PET ++ VS + +SP V L LG Sbjct: 571 PETCKTYFVSATLQISPRVSLADLLG 596 >gnl|CDD|179920 PRK05054, PRK05054, exoribonuclease II; Provisional. Length = 644 Score = 24.8 bits (55), Expect = 4.8 Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 43 ITDVARGQINVRLGDN 58 I D++RG + VRL +N Sbjct: 569 IIDISRGGMRVRLLEN 584 >gnl|CDD|182987 PRK11132, cysE, serine acetyltransferase; Provisional. Length = 273 Score = 23.9 bits (52), Expect = 9.4 Identities = 7/17 (41%), Positives = 13/17 (76%) Query: 13 VSFRVDMSPAVQLQCGL 29 V+F+VD+ PA ++ G+ Sbjct: 138 VAFQVDIHPAAKIGRGI 154 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.137 0.389 Gapped Lambda K H 0.267 0.0737 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,083,479 Number of extensions: 52297 Number of successful extensions: 74 Number of sequences better than 10.0: 1 Number of HSP's gapped: 74 Number of HSP's successfully gapped: 6 Length of query: 71 Length of database: 5,994,473 Length adjustment: 42 Effective length of query: 29 Effective length of database: 5,086,937 Effective search space: 147521173 Effective search space used: 147521173 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.0 bits)