BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780632|ref|YP_003065045.1| hypothetical protein CLIBASIA_02595 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780632|ref|YP_003065045.1| hypothetical protein CLIBASIA_02595 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Score = 144 bits (363), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MINGPETLESLMVSFRVDMSPAVQLQCGLGSSIVAVKPVVPYITDVARGQINVRLGDNYG 60 MINGPETLESLMVSFRVDMSPAVQLQCGLGSSIVAVKPVVPYITDVARGQINVRLGDNYG Sbjct: 1 MINGPETLESLMVSFRVDMSPAVQLQCGLGSSIVAVKPVVPYITDVARGQINVRLGDNYG 60 Query: 61 VLHSVDLVTMT 71 VLHSVDLVTMT Sbjct: 61 VLHSVDLVTMT 71 >gi|254780916|ref|YP_003065329.1| putative sigma-54-dependent transcription regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 482 Score = 23.5 bits (49), Expect = 0.64, Method: Composition-based stats. Identities = 12/49 (24%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Query: 1 MINGPETLESLMVSFRVDMSPAVQLQ-CGLGSSIVAVKPVVPYITDVAR 48 +++ + +S++ + R + P+ + + C L S++AV P + + D+AR Sbjct: 110 LVSRKQLCDSIICALREGVVPSQENEHCAL-DSLIAVSPAMIQVVDLAR 157 >gi|254780673|ref|YP_003065086.1| pyruvate dehydrogenase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 467 Score = 22.3 bits (46), Expect = 1.5, Method: Composition-based stats. Identities = 7/17 (41%), Positives = 13/17 (76%) Query: 28 GLGSSIVAVKPVVPYIT 44 G+G+S +KP+V ++T Sbjct: 203 GIGASFAGLKPIVEFMT 219 >gi|254780503|ref|YP_003064916.1| putative glutamine synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 21.6 bits (44), Expect = 2.6, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 22 AVQLQCGLGSSIVAVKPVVPYITDVARGQINVRLGDNYGVLHSVDLVTMT 71 A L CGL + ++P P + + IN+ G+L +V L+ T Sbjct: 374 AASLACGLLGILQKIEPTPPTMKSANQEAINL----PRGLLEAVTLLENT 419 >gi|254780662|ref|YP_003065075.1| NAD-glutamate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 1576 Score = 20.0 bits (40), Expect = 6.7, Method: Composition-based stats. Identities = 7/14 (50%), Positives = 12/14 (85%) Query: 9 ESLMVSFRVDMSPA 22 E L+V +++D+SPA Sbjct: 583 EHLVVLYQMDLSPA 596 >gi|254780197|ref|YP_003064610.1| triosephosphate isomerase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Score = 19.6 bits (39), Expect = 9.8, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 10/19 (52%) Query: 24 QLQCGLGSSIVAVKPVVPY 42 QL C L S + PV+ Y Sbjct: 149 QLDCSLPSEFKSSVPVIAY 167 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.137 0.389 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,693 Number of Sequences: 1233 Number of extensions: 1112 Number of successful extensions: 9 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 71 length of database: 328,796 effective HSP length: 42 effective length of query: 29 effective length of database: 277,010 effective search space: 8033290 effective search space used: 8033290 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.9 bits) S2: 31 (16.5 bits)