HHsearch alignment for GI: 254780633 and conserved domain: PRK00553

>PRK00553 ribose-phosphate pyrophosphokinase; Provisional.
Probab=90.81  E-value=1.4  Score=24.06  Aligned_cols=72  Identities=18%  Similarity=0.319  Sum_probs=52.1

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             52267899999999999835667739991402326780113688733309999999999999999974998899973987
Q gi|254780633|r   39 PMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        39 PlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
T Consensus        76 pvn-d~lmELll~idA~rrasA~~It~ViP--Y~~YaRQDrk~~~repIsak~v-------A~lL~~~G~drvitvDlH~  145 (340)
T PRK00553         76 PVN-DSLMELLIAIDALKRGSAKSITAILP--YYGYARQDRKTAGREPITSKLV-------ADLLTKAGVTRVTLTDIHS  145 (340)
T ss_pred             CCC-HHHHHHHHHHHHHHHCCCCCEEEEEC--CCCCCCCCCCCCCCCCCCHHHH-------HHHHHHCCCCEEEEECCCH
T ss_conf             952-68999999999998707882699966--6665547876789998439999-------8567635885699843565


Q ss_pred             CC
Q ss_conf             86
Q gi|254780633|r  119 GN  120 (267)
Q Consensus       119 GN  120 (267)
T Consensus       146 ~q  147 (340)
T PRK00553        146 DQ  147 (340)
T ss_pred             HH
T ss_conf             88