HHsearch alignment for GI: 254780633 and conserved domain: PRK04554

>PRK04554 consensus.
Probab=91.07  E-value=1.3  Score=24.21  Aligned_cols=69  Identities=12%  Similarity=0.172  Sum_probs=50.8

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCC-CCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             6789999999999983566773999140232678011368-87333099999999999999999749988999739878
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~f-pGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
T Consensus        67 nd~lmELll~idA~rra~A~~It~ViP--Y~~YaRQDr~~~~gr~pIsak~v-------A~lL~~~G~d~vitvDlH~~  136 (327)
T PRK04554         67 NDNLMEILTMADALKRASAGRITTAIP--YFGYARQDRRPRSVRVPISAKLV-------ANMLYSAGIDRVLTVDLHAD  136 (327)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEEC--CCCCCCCCCCCCCCCCCCCHHHH-------HHHHHHCCCCCCEEECCCHH
T ss_conf             477999999999998728872799944--65643367665788675129999-------85576259885047626848