Query         gi|254780633|ref|YP_003065046.1| creatinine amidohydrolase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 267
No_of_seqs    115 out of 722
Neff          7.4 
Searched_HMMs 39220
Date          Sun May 29 22:19:44 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780633.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 pfam02633 Creatininase Creatin 100.0       0       0  474.6  24.1  233    7-251     1-235 (235)
  2 COG1402 Uncharacterized protei 100.0       0       0  423.6  21.2  242    6-258     2-249 (250)
  3 pfam10673 DUF2487 Protein of u  95.7   0.055 1.4E-06   33.1   6.8   85   22-119    12-96  (143)
  4 PRK01259 ribose-phosphate pyro  91.8     1.1 2.8E-05   24.7   9.8   85   39-133    59-154 (309)
  5 PRK02039 consensus              91.7    0.95 2.4E-05   25.2   6.9   72   39-120    64-136 (316)
  6 PRK04923 ribose-phosphate pyro  91.6    0.95 2.4E-05   25.1   6.8   70   42-120    67-137 (319)
  7 PRK04554 consensus              91.1     1.3 3.4E-05   24.2   8.5   69   42-119    67-136 (327)
  8 PRK00553 ribose-phosphate pyro  90.8     1.4 3.6E-05   24.1   7.2   72   39-120    76-147 (340)
  9 PRK02269 ribose-phosphate pyro  88.7     2.1 5.3E-05   23.0   7.3   71   39-119    64-134 (321)
 10 PRK02270 consensus              88.6     2.1 5.3E-05   23.0   7.0   72   39-120    64-135 (327)
 11 PRK04117 consensus              88.4     2.1 5.5E-05   22.9   8.7   71   39-119    62-132 (309)
 12 PRK01506 consensus              88.1     2.2 5.7E-05   22.8   6.8   72   39-120    68-139 (317)
 13 PRK01999 consensus              87.8     2.3 5.9E-05   22.7   6.5   69   42-119    65-133 (311)
 14 PRK02812 ribose-phosphate pyro  87.5     2.4 6.2E-05   22.6   7.2   72   39-120    80-151 (331)
 15 PRK05259 consensus              87.4     2.5 6.3E-05   22.5   6.7   71   42-121    61-131 (310)
 16 PRK02458 ribose-phosphate pyro  86.9     2.6 6.7E-05   22.3   7.6   71   39-119    68-138 (323)
 17 PTZ00145 phosphoribosylpyropho  86.8     2.7 6.8E-05   22.3   7.5   74   38-121   181-254 (443)
 18 COG0462 PrsA Phosphoribosylpyr  83.4     3.8 9.8E-05   21.3   7.3   96   22-134    53-159 (314)
 19 PRK03204 haloalkane dehalogena  82.7     4.1  0.0001   21.1   6.8   75   41-129    44-121 (286)
 20 PRK03092 ribose-phosphate pyro  81.8     4.4 0.00011   20.9   7.5   69   42-119    50-118 (304)
 21 PRK05038 consensus              80.1       5 0.00013   20.6   7.6   71   39-119    62-133 (315)
 22 cd06425 M1P_guanylylT_B_like_N  70.7     7.7  0.0002   19.3   4.2   45   95-141    33-77  (233)
 23 TIGR01829 AcAcCoA_reduct aceto  68.6     9.6 0.00024   18.8   4.3   28   98-127    15-42  (244)
 24 PRK03675 consensus              66.3      11 0.00028   18.4   7.0   68   42-119    56-123 (279)
 25 PRK06827 phosphoribosylpyropho  66.3      11 0.00028   18.4   8.9   88   23-121    81-174 (381)
 26 cd02541 UGPase_prokaryotic Pro  62.8     9.4 0.00024   18.8   3.3   26   95-120    33-58  (267)
 27 pfam01888 CbiD CbiD. CbiD is e  60.8      14 0.00035   17.8   4.3  119   27-149    98-235 (261)
 28 PRK06765 homoserine O-acetyltr  60.0     9.3 0.00024   18.8   2.9  113    3-129    35-177 (387)
 29 PRK07199 phosphoribosylpyropho  59.4      14 0.00037   17.6   8.5   66   42-117    62-127 (301)
 30 cd02523 PC_cytidylyltransferas  57.2     9.4 0.00024   18.8   2.6   26   95-120    31-56  (229)
 31 TIGR01500 sepiapter_red sepiap  56.7     8.3 0.00021   19.2   2.2   35   85-119    66-101 (267)
 32 cd07984 LPLAT_LABLAT-like Lyso  53.5      18 0.00046   17.0   4.1   31   98-129    10-40  (192)
 33 cd02524 G1P_cytidylyltransfera  52.7      18 0.00047   16.9   3.6   26   95-120    31-56  (253)
 34 PRK00934 ribose-phosphate pyro  52.1      19 0.00048   16.9   7.3   68   42-119    59-126 (286)
 35 cd06422 NTP_transferase_like_1  50.7      19 0.00049   16.8   3.3   26   95-120    32-57  (221)
 36 cd06426 NTP_transferase_like_2  48.9      21 0.00054   16.5   3.6   28   94-121    30-57  (220)
 37 PRK06456 acetolactate synthase  48.0      22 0.00056   16.5   5.0   45   96-142   197-241 (572)
 38 cd06915 NTP_transferase_WcbM_l  47.8      22 0.00056   16.4   3.3   26   95-120    31-56  (223)
 39 cd04197 eIF-2B_epsilon_N The N  47.8      21 0.00054   16.5   3.1   26   95-120    33-58  (217)
 40 cd04189 G1P_TT_long G1P_TT_lon  45.1      24 0.00062   16.2   3.4   26   94-119    32-57  (236)
 41 KOG1349 consensus               44.3      20 0.00051   16.7   2.5   55   89-143   112-188 (309)
 42 pfam07819 PGAP1 PGAP1-like pro  42.5      27 0.00068   15.9   3.7   76   44-119    17-96  (225)
 43 pfam05706 CDKN3 Cyclin-depende  42.1      27 0.00069   15.9   5.7   48   72-121    99-147 (207)
 44 pfam00561 Abhydrolase_1 alpha/  41.8      27 0.00069   15.9   3.9   56   65-129     4-61  (225)
 45 COG1938 Archaeal enzymes of AT  41.6      27  0.0007   15.8   3.9   38   81-118    81-118 (244)
 46 PRK07581 hypothetical protein;  41.5      28  0.0007   15.8   4.7  101    3-129    24-144 (340)
 47 cd02538 G1P_TT_short G1P_TT_sh  41.2      20 0.00052   16.7   2.2   24   95-118    33-56  (240)
 48 PRK10122 UTP--glucose-1-phosph  38.5      31 0.00078   15.5   3.8   27   93-119    34-60  (297)
 49 cd01837 SGNH_plant_lipase_like  38.1      31 0.00079   15.5   4.2   49   69-117   133-187 (315)
 50 pfam04748 Polysacc_deac_2 Dive  37.4      32 0.00081   15.4   9.7   72   55-135    41-119 (213)
 51 TIGR02853 spore_dpaA dipicolin  37.2      15 0.00039   17.4   1.1   22   20-41     55-76  (288)
 52 pfam02574 S-methyl_trans Homoc  36.9      32 0.00083   15.4  11.3   91   46-138    83-175 (303)
 53 pfam00483 NTP_transferase Nucl  36.0      30 0.00076   15.6   2.4   24   94-117    32-55  (247)
 54 KOG1014 consensus               35.8      34 0.00086   15.3   5.9   46   95-144    61-108 (312)
 55 pfam11187 DUF2974 Protein of u  33.7      36 0.00093   15.0   2.8   32   88-124    67-100 (224)
 56 TIGR00725 TIGR00725 conserved   33.6      28  0.0007   15.8   1.9   94   82-177     7-122 (176)
 57 PRK01132 consensus              32.3      38 0.00098   14.9   7.2   68   43-120    60-127 (286)
 58 cd02507 eIF-2B_gamma_N_like Th  31.2      40   0.001   14.8   3.7   25   95-119    33-57  (216)
 59 TIGR01840 esterase_phb esteras  30.3      28 0.00071   15.8   1.5   80   52-180    46-135 (231)
 60 cd04181 NTP_transferase NTP_tr  29.2      43  0.0011   14.6   3.5   33   86-121    25-57  (217)
 61 pfam07338 DUF1471 Protein of u  28.9      44  0.0011   14.5   3.6   36   83-118    15-52  (66)
 62 KOG3349 consensus               28.9      44  0.0011   14.5   4.9   76   97-177    25-100 (170)
 63 PRK11281 potassium efflux prot  28.8      44  0.0011   14.5   5.5   25  224-248   999-1023(1107)
 64 PRK10172 phosphoanhydride phos  28.1      45  0.0012   14.4   4.3   85   36-129   229-337 (432)
 65 cd02540 GT2_GlmU_N_bac N-termi  27.9      45  0.0012   14.4   3.5   25   95-119    28-52  (229)
 66 PRK00075 cbiD cobalt-precorrin  27.8      46  0.0012   14.4   4.4  119   27-149   106-243 (366)
 67 COG0062 Uncharacterized conser  27.4      47  0.0012   14.4   5.8   44   99-142    39-84  (203)
 68 cd07037 TPP_PYR_MenD Pyrimidin  27.3      47  0.0012   14.4   3.9   29   98-127     2-30  (162)
 69 TIGR01383 not_thiJ DJ-1 family  26.4      48  0.0012   14.3   2.6   35   60-107    65-99  (186)
 70 cd06407 PB1_NLP A PB1 domain i  26.3      22 0.00057   16.4   0.4   17  250-266    35-51  (82)
 71 PRK08419 lipid A biosynthesis   25.7      50  0.0013   14.2   4.5   30   98-128   105-134 (301)
 72 PRK04946 hypothetical protein;  25.6      50  0.0013   14.2   7.3   53   83-137    96-151 (181)
 73 PRK13389 UTP--glucose-1-phosph  25.3      51  0.0013   14.1   3.8   26   94-119    40-65  (302)
 74 TIGR02320 PEP_mutase phosphoen  25.2      51  0.0013   14.1   3.2   19  119-137    83-101 (272)
 75 cd03409 Chelatase_Class_II Cla  24.3      53  0.0013   14.0   3.1   24   94-117    45-68  (101)
 76 KOG1515 consensus               23.9      54  0.0014   14.0   7.3  100   24-133    78-189 (336)
 77 COG0533 QRI7 Metal-dependent p  23.5      55  0.0014   13.9   5.8   21  101-121   255-275 (342)
 78 COG3395 Uncharacterized protei  23.2      56  0.0014   13.9   5.2   10   63-72    108-117 (413)
 79 TIGR01512 ATPase-IB2_Cd cadmiu  23.2      56  0.0014   13.9   3.0   97   28-135   264-367 (494)
 80 PRK08905 lipid A biosynthesis   23.1      56  0.0014   13.9   5.4   40   98-141    94-133 (278)
 81 cd01846 fatty_acyltransferase_  23.0      56  0.0014   13.8   4.1   49   69-117   104-154 (270)
 82 PRK09240 thiH thiamine biosynt  22.8      57  0.0014   13.8   5.5   92   46-141    52-157 (371)
 83 KOG3655 consensus               22.5      57  0.0015   13.8   2.0   25  103-127    72-96  (484)
 84 pfam00456 Transketolase_N Tran  22.2      58  0.0015   13.7   4.0   91   71-168   157-263 (333)
 85 cd07038 TPP_PYR_PDC_IPDC_like   22.2      58  0.0015   13.7   3.6   29   99-128     3-31  (162)
 86 TIGR02313 HpaI-NOT-DapA 2,4-di  22.2      58  0.0015   13.7   2.3   48   88-139   110-159 (294)
 87 cd06291 PBP1_Qymf_like Ligand   22.1      58  0.0015   13.7   7.2   37   80-120    88-124 (265)
 88 COG0743 Dxr 1-deoxy-D-xylulose  22.0      59  0.0015   13.7   3.4   16  104-120   160-175 (385)
 89 PRK10259 hypothetical protein;  21.9      59  0.0015   13.7   3.4   44   78-121    33-77  (86)
 90 cd02508 ADP_Glucose_PP ADP-glu  21.7      59  0.0015   13.7   3.1   25   95-119    32-56  (200)
 91 pfam01713 Smr Smr domain. This  21.6      60  0.0015   13.7   6.3   46   87-132     6-53  (82)
 92 pfam10070 DUF2309 Uncharacteri  21.4      60  0.0015   13.6   3.3   37   83-119   468-505 (783)
 93 COG1182 AcpD Acyl carrier prot  21.3      25 0.00065   16.0  -0.1   58   59-119    87-144 (202)
 94 cd04261 AAK_AKii-LysC-BS AAK_A  21.2      61  0.0016   13.6   6.2   33  100-132    80-120 (239)
 95 cd01525 RHOD_Kc Member of the   20.8      62  0.0016   13.6   4.0   51   81-134    33-88  (105)
 96 PRK06425 histidinol-phosphate   20.7      39 0.00099   14.9   0.7   15  103-117   118-132 (332)
 97 PRK06553 lipid A biosynthesis   20.6      63  0.0016   13.5   4.2   31   98-129   123-153 (308)
 98 COG3309 VapD Uncharacterized v  20.4      63  0.0016   13.5   4.8   45   91-135    20-67  (96)
 99 COG1634 Uncharacterized Rossma  20.0      64  0.0016   13.5   2.6   28  100-129   107-134 (232)

No 1  
>pfam02633 Creatininase Creatinine amidohydrolase. Creatinine amidohydrolase (EC:3.5.2.10), or creatininase, catalyses the hydrolysis of creatinine to creatine.
Probab=100.00  E-value=0  Score=474.57  Aligned_cols=233  Identities=39%  Similarity=0.629  Sum_probs=206.9

Q ss_pred             HHHCCHHHHHH-CCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCE
Q ss_conf             46669798973-10498899932001247974652267899999999999835667739991402326780113688733
Q gi|254780633|r    7 FTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTK   85 (267)
Q Consensus         7 ~~~lT~~e~~~-~~~~~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTi   85 (267)
                      |++|||+|+++ .++++++|||+|||||||||||+|||+++++++|+++|++++   +++|+|++|||+|++|++|||||
T Consensus         1 l~~lT~~ev~~~~~~~~~vilPvGs~EqHGpHLPlgtD~~ia~~ia~~va~~~~---~~lv~P~i~yG~s~~h~~fpGTi   77 (235)
T pfam02633         1 LAELTWPEVEALLKRGDTAILPVGSTEQHGPHLPLGTDTLIAEAIAERVAERLG---DVLVLPTIPYGYSPEHMGFPGTI   77 (235)
T ss_pred             CCCCCHHHHHHHHCCCCEEEEEEECEECCCCCCCCHHHHHHHHHHHHHHHHHCC---CEEEECCCCCCCCHHHCCCCCEE
T ss_conf             974688999988458998999665730458866612489999999999998679---96996887567786772889736


Q ss_pred             ECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHC-CEEEEEECCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             30999999999999999997499889997398786789999999986355-83999824765456564136655667886
Q gi|254780633|r   86 TLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF-SMLVVSTSWSRFTIPQGIISFPETEIGIH  164 (267)
Q Consensus        86 sl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~g~H  164 (267)
                      |++++||+++|.||++||++||||||+||||||||..+++.++++++.++ +..++..+||.+..............++|
T Consensus        78 sl~~~t~~~~l~di~~sl~~~Gf~~ivilNgHgGN~~~l~~~~~~l~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~H  157 (235)
T pfam02633        78 SLSPETLIALLRDIGRSLARHGFRRLVIVNGHGGNIALLQEAARELRAEYPDMAVVPCSWWRLGPPEGLAGAFEDAEGIH  157 (235)
T ss_pred             EECHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEECHHHCCCHHHCCCCCCCCCCCC
T ss_conf             50999999999999999997797589999168774899999999999777980899952353343222035556678886


Q ss_pred             CCHHHHHHHHHHCCCCCCHHHCCCCCCCCCCHHCCCCCCCCCCCCCCCCCHHHCCCCCCEECCCCCCHHHHHHHHHHHHH
Q ss_conf             87799999999781326833246676443200013400013776332022888098810414430799999999999999
Q gi|254780633|r  165 GGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN  244 (267)
Q Consensus       165 Age~ETS~~lal~PelV~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~Gv~GdP~~At~E~G~~~~~~~v~  244 (267)
                      ||+.|||+|||++||+|+++++.......         ....+...+.|.+++++++|++|||+.||+||||++++.+++
T Consensus       158 Age~ETS~~l~l~PelV~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~~G~~Gdp~~AtaE~G~~~~e~~v~  228 (235)
T pfam02633       158 AGEAETSLMLALHPELVRMDREGGEPDAL---------LSLGGGALLAWDARDLSPDGVIGDPTLASAEKGERLLEAAVD  228 (235)
T ss_pred             CCHHHHHHHHHHCHHHCCHHHCCCCCCCC---------CCCCCCCCCCCCHHHCCCCEEEECCCHHCHHHHHHHHHHHHH
T ss_conf             78899999999685322875525568888---------776777455541754497853508221059999999999999


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254780633|r  245 CFIQLLN  251 (267)
Q Consensus       245 ~l~~~i~  251 (267)
                      .++++|+
T Consensus       229 ~l~~~i~  235 (235)
T pfam02633       229 GLVELLR  235 (235)
T ss_pred             HHHHHHC
T ss_conf             9999869


No 2  
>COG1402 Uncharacterized protein, putative amidase [General function prediction only]
Probab=100.00  E-value=0  Score=423.62  Aligned_cols=242  Identities=35%  Similarity=0.566  Sum_probs=208.0

Q ss_pred             CHHHCCHHHHHH-C-CCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCC
Q ss_conf             046669798973-1-04988999320012479746522678999999999998356677399914023267801136887
Q gi|254780633|r    6 IFTDNSLPLCAD-A-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG   83 (267)
Q Consensus         6 ~~~~lT~~e~~~-~-~~~~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpG   83 (267)
                      .+.+.||++... . ++++++|||+||+||||||||+|||++|++++|++++++++++  ++|+|+++||+|.||++|||
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~ilPvGS~EQHGPhlPlgTD~~ia~~ia~~~~~~~~~~--a~vlP~i~yG~s~eH~~fpG   79 (250)
T COG1402           2 MLLDLTWSELIRQLDKETTIIILPVGSTEQHGPHLPLGTDALIAEAIAEKVAERLGAE--ALVLPTIYYGVSLEHMGFPG   79 (250)
T ss_pred             CCCCCCCHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC--EEEECCCCCCCCHHHCCCCC
T ss_conf             3100114355531035684399843652355777775422899999999999971897--28817660202564447995


Q ss_pred             CEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEE--ECCCCCCCHHHHCCCCCCCC
Q ss_conf             3330999999999999999997499889997398786789999999986355839998--24765456564136655667
Q gi|254780633|r   84 TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEI  161 (267)
Q Consensus        84 Tisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~  161 (267)
                      ||+++++||+.++.++.+||+++||||+++|||||||..+++.++++++.+++...+.  ..|..+....+....   ..
T Consensus        80 Titl~~~t~~~~~~~~~~Sl~~~Gfrk~v~vNgHGGN~~~l~~v~~el~~~~~~~~V~~~~~~~~~~~~~~~~~~---~~  156 (250)
T COG1402          80 TITLSPETLIALLVELVESLARHGFRKFVIVNGHGGNSAALEIVARELRAELGDLAVAVFFPWQRPEGIWGLLSG---IY  156 (250)
T ss_pred             EEECCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCEECCCHHHHHCC---CC
T ss_conf             287268889999999999999638637999945887488999999999976140343212540221430433156---54


Q ss_pred             CCCCCHHHHHHHHHHCCCCCCHHHCCCCCCCCC-CHHCCCCCCCCCCCCCCCCCHHHCCCCCCEE-CCCCCCHHHHHHHH
Q ss_conf             886877999999997813268332466764432-0001340001377633202288809881041-44307999999999
Q gi|254780633|r  162 GIHGGEIETSMMLALAPHLVKMDLAENFSSRQS-EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLL  239 (267)
Q Consensus       162 g~HAge~ETS~~lal~PelV~~d~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~s~~Gv~G-dP~~At~E~G~~~~  239 (267)
                      ++|||..|||+|+|+.|++|+++++.+..+... ......      +...++|..++++++|++| ||+.||+|+|++++
T Consensus       157 ~~Hag~~EtS~~l~l~p~~v~~~~~~~~~~~~~~~~~~~~------g~~~~~~~~~~~~~~Gv~G~d~~~ataE~G~~~~  230 (250)
T COG1402         157 GIHAGDIETSLMLHLGPELVDMERAVDPFPIEQAPESPLV------GLHPFAWDARAFSKDGVVGSDPTLATAEKGEKIL  230 (250)
T ss_pred             CCCCCCHHHHHHHHHCHHHHHHHHHCCCCCCCCCCCCCCC------CCCCCHHHHHHCCCCCEEECCCCCCCHHHHHHHH
T ss_conf             6656713456788719776627751056765666654222------5442023565418986551686747888899999


Q ss_pred             HHHHHHHHHHHHHHHHCCC
Q ss_conf             9999999999999995853
Q gi|254780633|r  240 SYFANCFIQLLNDINSFDV  258 (267)
Q Consensus       240 ~~~v~~l~~~i~e~~~~~~  258 (267)
                      +.+++.+++.|+++.+++.
T Consensus       231 ~~avd~lv~~i~~~~~~~~  249 (250)
T COG1402         231 EAAVDGLVELIREFMAFDP  249 (250)
T ss_pred             HHHHHHHHHHHHHHHHHCC
T ss_conf             9999999999999986515


No 3  
>pfam10673 DUF2487 Protein of unknown function (DUF2487). This is a bacterial family of uncharacterized proteins.
Probab=95.66  E-value=0.055  Score=33.08  Aligned_cols=85  Identities=21%  Similarity=0.184  Sum_probs=54.6

Q ss_pred             CEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             88999320012479746522678999999999998356677399914023267801136887333099999999999999
Q gi|254780633|r   22 WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIID  101 (267)
Q Consensus        22 ~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~  101 (267)
                      +++|||+=++--+.----...-.-....++.++.+.+..|  ++++|+..|-.+.           ..+....-|.+...
T Consensus        12 DTaiIPLipi~~~~~~k~~as~gEf~~lla~ElERQlkGR--v~L~P~ftY~~~~-----------~~~~~~~rL~~w~~   78 (143)
T pfam10673        12 DTAVIPLLPVSFAEDMKQLASQGEFTQLLAEELERQLKGR--VLLLPAFTYLASE-----------QKDEAGERLKEWTN   78 (143)
T ss_pred             HHHEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--EEECCCEEEECCC-----------CHHHHHHHHHHHHH
T ss_conf             4400223324455679999866379999999999986674--7842780310456-----------66789999999999


Q ss_pred             HHHHCCCCEEEEECCCCC
Q ss_conf             999749988999739878
Q gi|254780633|r  102 AIRKMGIRKIVILNAHGG  119 (267)
Q Consensus       102 sl~~~Gf~~iviiNgHgG  119 (267)
                      .|...||++++++..-.+
T Consensus        79 ~l~~~Gf~HV~~vTsD~~   96 (143)
T pfam10673        79 ALKEEGFRHVFFLTSDSS   96 (143)
T ss_pred             HHHHCCCCEEEEEECCHH
T ss_conf             999759846999955713


No 4  
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional
Probab=91.85  E-value=1.1  Score=24.71  Aligned_cols=85  Identities=11%  Similarity=0.172  Sum_probs=55.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             52267899999999999835667739991402326780113688733309999999999999999974998899973987
Q gi|254780633|r   39 PMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        39 PlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      |. .|.++---+.-.++++.+.+.-.+|+|  +|||+-....|-.--+++...       +++-|...|+.+++.++=|-
T Consensus        59 p~-nd~lmElll~i~A~r~a~A~~It~ViP--Y~~Y~RQDr~~~~re~isak~-------va~ll~~~G~d~vit~DlH~  128 (309)
T PRK01259         59 PT-NDNLMELLIMIDALRRASAGRITAVIP--YFGYARQDRKASARVPITAKL-------VANLLSSAGADRVLTVDLHA  128 (309)
T ss_pred             CC-CHHHHHHHHHHHHHHHCCCCCEEEECC--CCCCCCCCCCCCCCCCEEHHH-------HHHHHHHCCCCEEEEEECCH
T ss_conf             95-177999999999998748871799724--665036877779998675999-------99998523787389981676


Q ss_pred             CC-----------HHHHHHHHHHHHH
Q ss_conf             86-----------7899999999863
Q gi|254780633|r  119 GN-----------SPLVSIVSTEARM  133 (267)
Q Consensus       119 GN-----------~~~l~~a~~~l~~  133 (267)
                      .+           ..+....++.++.
T Consensus       129 ~qi~gfF~ipvd~l~a~~~l~~~i~~  154 (309)
T PRK01259        129 DQIQGFFDIPVDNLYGSPILLEDIKK  154 (309)
T ss_pred             HHHHHHCCCCCEEEECCHHHHHHHHH
T ss_conf             77754248971167440899999986


No 5  
>PRK02039 consensus
Probab=91.74  E-value=0.95  Score=25.17  Aligned_cols=72  Identities=11%  Similarity=0.236  Sum_probs=52.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCC-CCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             5226789999999999983566773999140232678011368-873330999999999999999997499889997398
Q gi|254780633|r   39 PMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH  117 (267)
Q Consensus        39 PlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~f-pGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH  117 (267)
                      |. -|.++---+.-.++++.+.+.-.+|+|  +|||+-....| +|-.+++...+..       -|...|+.+++.++=|
T Consensus        64 p~-nd~lmELll~idA~r~a~A~~It~ViP--Y~~YaRQDr~~~~gr~pisak~vA~-------ll~~aG~d~vitvDlH  133 (316)
T PRK02039         64 PT-NDNLMELMIMVDALKRASAGRITAAIP--YFGYARQDRRPRSARVAISAKVVAN-------MLEIAGVERIITMDLH  133 (316)
T ss_pred             CC-CHHHHHHHHHHHHHHHCCCCEEEEEEC--CCCCCCCCCCCCCCCCCHHHHHHHH-------HHHHCCCCEEEEECCC
T ss_conf             82-078999999999998738874899842--5453347765568876530999998-------7623277704885278


Q ss_pred             CCC
Q ss_conf             786
Q gi|254780633|r  118 GGN  120 (267)
Q Consensus       118 gGN  120 (267)
                      -.+
T Consensus       134 ~~q  136 (316)
T PRK02039        134 ADQ  136 (316)
T ss_pred             HHH
T ss_conf             388


No 6  
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional
Probab=91.63  E-value=0.95  Score=25.15  Aligned_cols=70  Identities=13%  Similarity=0.196  Sum_probs=52.0

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCC-CCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             6789999999999983566773999140232678011368-873330999999999999999997499889997398786
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~f-pGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      .|.++---+.-.++++.+.+.-.+|+|  +|||+-....| +|-..++...       +++-|...|+.+++.++-|-.+
T Consensus        67 nd~lmELll~idAlr~a~A~rIt~ViP--Y~~YsRQDr~~~~g~~pIsak~-------vA~lL~~~gvdrvitvDlH~~q  137 (319)
T PRK04923         67 AENLMELLVLIDALKRASASSVTAVIP--YFGYSRQDRRMRSSRVPITAKV-------AAKMICAMGADRVLTVDLHADQ  137 (319)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEC--CCCHHHCCCCCCCCCCCEEHHH-------HHHHHCCCCCCEEEEECCCHHH
T ss_conf             789999999999998758872799832--5532000133466768702999-------9988612587627984488799


No 7  
>PRK04554 consensus
Probab=91.07  E-value=1.3  Score=24.21  Aligned_cols=69  Identities=12%  Similarity=0.172  Sum_probs=50.8

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCC-CCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             6789999999999983566773999140232678011368-87333099999999999999999749988999739878
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~f-pGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      .|.++---+.-.++++.+.+.-.+|+|  +|||+-....| +|-.+++...+       ++-|...|+.+++.++=|-.
T Consensus        67 nd~lmELll~idA~rra~A~~It~ViP--Y~~YaRQDr~~~~gr~pIsak~v-------A~lL~~~G~d~vitvDlH~~  136 (327)
T PRK04554         67 NDNLMEILTMADALKRASAGRITTAIP--YFGYARQDRRPRSVRVPISAKLV-------ANMLYSAGIDRVLTVDLHAD  136 (327)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEEC--CCCCCCCCCCCCCCCCCCCHHHH-------HHHHHHCCCCCCEEECCCHH
T ss_conf             477999999999998728872799944--65643367665788675129999-------85576259885047626848


No 8  
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional
Probab=90.81  E-value=1.4  Score=24.06  Aligned_cols=72  Identities=18%  Similarity=0.319  Sum_probs=52.1

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             52267899999999999835667739991402326780113688733309999999999999999974998899973987
Q gi|254780633|r   39 PMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        39 PlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      |.. |.++---+.-.++++.+++.-.+|+|  +|||+-....|..--+++...+       ++-|...|..+++.++=|-
T Consensus        76 pvn-d~lmELll~idA~rrasA~~It~ViP--Y~~YaRQDrk~~~repIsak~v-------A~lL~~~G~drvitvDlH~  145 (340)
T PRK00553         76 PVN-DSLMELLIAIDALKRGSAKSITAILP--YYGYARQDRKTAGREPITSKLV-------ADLLTKAGVTRVTLTDIHS  145 (340)
T ss_pred             CCC-HHHHHHHHHHHHHHHCCCCCEEEEEC--CCCCCCCCCCCCCCCCCCHHHH-------HHHHHHCCCCEEEEECCCH
T ss_conf             952-68999999999998707882699966--6665547876789998439999-------8567635885699843565


Q ss_pred             CC
Q ss_conf             86
Q gi|254780633|r  119 GN  120 (267)
Q Consensus       119 GN  120 (267)
                      ++
T Consensus       146 ~q  147 (340)
T PRK00553        146 DQ  147 (340)
T ss_pred             HH
T ss_conf             88


No 9  
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional
Probab=88.67  E-value=2.1  Score=23.00  Aligned_cols=71  Identities=14%  Similarity=0.277  Sum_probs=51.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             52267899999999999835667739991402326780113688733309999999999999999974998899973987
Q gi|254780633|r   39 PMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        39 PlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      |.. |.++---+.-.+++..+.+.-.+|+|  +|||+-....|-.--.++..+       +++-|...|+.+++.++=|-
T Consensus        64 pvn-d~lmELll~idAlr~a~A~~It~ViP--Y~~YaRQDr~~~~ge~isak~-------vA~lL~~~g~d~vitvDlH~  133 (321)
T PRK02269         64 PVN-DNLMEILIMVDALKRASAESISVVMP--YYGYARQDRKARSREPITSKL-------VANMLEVAGVDRLLTVDLHA  133 (321)
T ss_pred             CCC-HHHHHHHHHHHHHHHCCCCEEEEEEC--CCCCCCCCCCCCCCCCCHHHH-------HHHHHHHCCCCEEEEECCCC
T ss_conf             953-79999999999998748973999813--553130454457899726999-------99988744877799962674


Q ss_pred             C
Q ss_conf             8
Q gi|254780633|r  119 G  119 (267)
Q Consensus       119 G  119 (267)
                      .
T Consensus       134 ~  134 (321)
T PRK02269        134 A  134 (321)
T ss_pred             H
T ss_conf             7


No 10 
>PRK02270 consensus
Probab=88.58  E-value=2.1  Score=22.96  Aligned_cols=72  Identities=17%  Similarity=0.222  Sum_probs=51.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             52267899999999999835667739991402326780113688733309999999999999999974998899973987
Q gi|254780633|r   39 PMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        39 PlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      |.. |.++---+.-.++++.+.+.-.+|+|  +|||+-....+-+--.++...+.       +-|...|+.+++.+.=|-
T Consensus        64 pvn-d~lmELll~idA~rrasA~~It~ViP--Y~~YaRQDrk~~~repIsaklvA-------~lL~~~G~d~vitvDlH~  133 (327)
T PRK02270         64 PVN-ENIMELLIFIDSLKRASAKEINVILS--YYGYARQDRKSSGRQPIGAKLVA-------DLLEKAGATKIISVDLHN  133 (327)
T ss_pred             CCH-HHHHHHHHHHHHHHHCCCCCEEEEEC--CCCCCCCCCCCCCCCCCHHHHHH-------HHHHHCCCCEEEEECCCH
T ss_conf             931-78999999999998738872589712--54434477766899863399999-------988524786478843576


Q ss_pred             CC
Q ss_conf             86
Q gi|254780633|r  119 GN  120 (267)
Q Consensus       119 GN  120 (267)
                      .+
T Consensus       134 ~q  135 (327)
T PRK02270        134 PS  135 (327)
T ss_pred             HH
T ss_conf             88


No 11 
>PRK04117 consensus
Probab=88.41  E-value=2.1  Score=22.89  Aligned_cols=71  Identities=15%  Similarity=0.247  Sum_probs=47.3

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             52267899999999999835667739991402326780113688733309999999999999999974998899973987
Q gi|254780633|r   39 PMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        39 PlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      |.. |.++---+.-.+++..+.+.-.+|+|-++  |+-....|--.-.++..+       +++-|...|+.+++.++=|-
T Consensus        62 p~n-d~lmELll~~~a~r~agA~~It~ViPY~~--YsRQDr~~~~ge~isak~-------vA~lL~~~G~d~vitvDlH~  131 (309)
T PRK04117         62 PAN-DNLMELLIMTDALRRSSANSITAVVPYFG--YARQDRKAAPRVPITAKL-------VANLMQAAGIDRVVTMDLHA  131 (309)
T ss_pred             CCH-HHHHHHHHHHHHHHHCCCCEEEEEECCCC--CCCCCCCCCCCCCCCHHH-------HHHHHHHCCCCEEEEECCCH
T ss_conf             824-88999999999998748973889603550--021444569998701899-------99888642776589961786


Q ss_pred             C
Q ss_conf             8
Q gi|254780633|r  119 G  119 (267)
Q Consensus       119 G  119 (267)
                      .
T Consensus       132 ~  132 (309)
T PRK04117        132 G  132 (309)
T ss_pred             H
T ss_conf             8


No 12 
>PRK01506 consensus
Probab=88.14  E-value=2.2  Score=22.78  Aligned_cols=72  Identities=14%  Similarity=0.266  Sum_probs=49.9

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             52267899999999999835667739991402326780113688733309999999999999999974998899973987
Q gi|254780633|r   39 PMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        39 PlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      |.. |.++---+.-.++++.+++.-.+|+|-  |||+-....|-.--.++...       +++-|...|+.+++.++-|-
T Consensus        68 p~n-d~lmELll~i~a~r~~gA~~It~ViPY--~~YaRQDr~~~~ge~isak~-------vA~ll~~~G~d~vitvDlH~  137 (317)
T PRK01506         68 PVN-EHIMELLIMIDALKRASAKTINIVIPY--YGYARQDRKARSREPITAKL-------VANLLETAGATRVITLDLHA  137 (317)
T ss_pred             CCH-HHHHHHHHHHHHHHHCCCCEEEEECCC--CCCCCCCCCCCCCCCEEHHH-------HHHHHHCCCCCEEEEECCCC
T ss_conf             920-899999999999887389748996267--65243764335887613898-------88787415885379962784


Q ss_pred             CC
Q ss_conf             86
Q gi|254780633|r  119 GN  120 (267)
Q Consensus       119 GN  120 (267)
                      .+
T Consensus       138 ~~  139 (317)
T PRK01506        138 PQ  139 (317)
T ss_pred             HH
T ss_conf             87


No 13 
>PRK01999 consensus
Probab=87.84  E-value=2.3  Score=22.67  Aligned_cols=69  Identities=13%  Similarity=0.208  Sum_probs=48.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             678999999999998356677399914023267801136887333099999999999999999749988999739878
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      .|.++---+.-.++++.+.+.-.+|+|  +|||+-....|-..-+++...+       ++-|...|+.+++.++=|-.
T Consensus        65 ~d~lmELll~~dA~r~~~A~~It~ViP--Y~~YaRQDr~~~~~e~isak~v-------a~lL~~~G~d~vitvDlH~~  133 (311)
T PRK01999         65 SDNLMELLLMIDAAKRASARSITAVIP--YFGWARQDRKDKPRVSIGAKLV-------ADLLSVAGIDRLITMDLHAD  133 (311)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEECC--CCCCCCCCCCCCCCCCEEHHHH-------HHHHHCCCCCEEEEEECCCH
T ss_conf             168999999998898658863899625--5443337665689986767774-------43430157865899826838


No 14 
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional
Probab=87.55  E-value=2.4  Score=22.56  Aligned_cols=72  Identities=18%  Similarity=0.341  Sum_probs=52.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             52267899999999999835667739991402326780113688733309999999999999999974998899973987
Q gi|254780633|r   39 PMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        39 PlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      |.. |.++---+.-.++++.+.+.-.+|+|  +|||+-....|-.--+++...       +++-|...|+.+++.+.=|-
T Consensus        80 pvn-d~lmELll~idA~krasA~~It~ViP--Y~~YaRQDrk~~~re~Isakl-------vA~lL~~aG~d~vitvDlH~  149 (331)
T PRK02812         80 PVN-DHLMELLIMVDACRRASARQITAVIP--YYGYARADRKTAGRESITAKL-------VANLITKAGVDRVLAMDLHS  149 (331)
T ss_pred             CCC-HHHHHHHHHHHHHHHCCCCEEEEEEC--CCCCCCCCCCCCCCCCCCHHH-------HHHHHHHCCCCEEEEECCCH
T ss_conf             841-89999999999987757872799832--554355676668999834999-------99788734887588734662


Q ss_pred             CC
Q ss_conf             86
Q gi|254780633|r  119 GN  120 (267)
Q Consensus       119 GN  120 (267)
                      .+
T Consensus       150 ~q  151 (331)
T PRK02812        150 AQ  151 (331)
T ss_pred             HH
T ss_conf             88


No 15 
>PRK05259 consensus
Probab=87.39  E-value=2.5  Score=22.50  Aligned_cols=71  Identities=14%  Similarity=0.234  Sum_probs=49.8

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             67899999999999835667739991402326780113688733309999999999999999974998899973987867
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      .|.++---+.-.++++.+.+.-.+|+|  +|||+-....|...-+++...       +++-|...|+.+++.++=|-.+.
T Consensus        61 nd~lmELll~i~A~r~~~A~~It~ViP--Y~~YsRQDr~~~~~e~isak~-------vA~lL~~~G~d~vitvDlH~~~i  131 (310)
T PRK05259         61 NDHLMELLIMIDALRRSSARRITAVIP--YFGYARQDRKPGPRTPISAKL-------VANLITEAGADRVLTLDLHAGQI  131 (310)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCEEEEEC--CCCCCCCCCCCCCCCCEEHHH-------HHHHHHCCCCCEEEEECCCCHHH
T ss_conf             088999999999998738871799941--455111557789998665888-------75112104776689962785777


No 16 
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional
Probab=86.91  E-value=2.6  Score=22.33  Aligned_cols=71  Identities=15%  Similarity=0.252  Sum_probs=49.8

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             52267899999999999835667739991402326780113688733309999999999999999974998899973987
Q gi|254780633|r   39 PMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        39 PlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      |.. |.++---+.-.++++.+.+.-.+|+|  +|||+-....|-.--.++...       +++-|...|+.+++.++-|-
T Consensus        68 p~n-d~lmELll~idA~r~agA~~It~ViP--Y~~YaRQDr~~~~gepIsak~-------vA~lL~~~G~d~vitvDlH~  137 (323)
T PRK02458         68 PVN-DHLWELLIMIDACKRASANTVNVVLP--YFGYARQDRIAKPREPITAKL-------VANMLVKAGVDRVLTLDLHA  137 (323)
T ss_pred             CCH-HHHHHHHHHHHHHHHCCCCEEEEEEC--CCCCCCCCCCCCCCCCCCHHH-------HHHHHHHCCCCEEEEECCCC
T ss_conf             930-89999999999998738871899832--465454776658998741999-------99998753886578842781


Q ss_pred             C
Q ss_conf             8
Q gi|254780633|r  119 G  119 (267)
Q Consensus       119 G  119 (267)
                      .
T Consensus       138 ~  138 (323)
T PRK02458        138 V  138 (323)
T ss_pred             H
T ss_conf             8


No 17 
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional
Probab=86.79  E-value=2.7  Score=22.29  Aligned_cols=74  Identities=19%  Similarity=0.346  Sum_probs=53.3

Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             65226789999999999983566773999140232678011368873330999999999999999997499889997398
Q gi|254780633|r   38 LPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH  117 (267)
Q Consensus        38 lPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH  117 (267)
                      -|+. |.++=--+.-.++++.+++.-..|.|  +|||+-.-..+-.-..++...       ++.-|...|..|++-+.=|
T Consensus       181 ~PvN-dnLMELLImIDA~KRASA~rITAVIP--YfGYARQDRK~~~R~PISAKl-------VAnLL~~aGaDRVITmDLH  250 (443)
T PTZ00145        181 PPVN-ENLIELLLMISTCRRASAKKITAVIP--YYGYARQDRKLSSRVPISAAD-------VARMIEAMGVDRVVAIDLH  250 (443)
T ss_pred             CCCC-HHHHHHHHHHHHHHHCCCCCEEEECC--CCCCCCCCCCCCCCCCEEHHH-------HHHHHHHCCCCEEEEEECC
T ss_conf             9820-36999999999976615674699914--775246878789998705999-------9999986398849997068


Q ss_pred             CCCH
Q ss_conf             7867
Q gi|254780633|r  118 GGNS  121 (267)
Q Consensus       118 gGN~  121 (267)
                      -+++
T Consensus       251 a~QI  254 (443)
T PTZ00145        251 SGQI  254 (443)
T ss_pred             CHHH
T ss_conf             5676


No 18 
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism]
Probab=83.36  E-value=3.8  Score=21.29  Aligned_cols=96  Identities=9%  Similarity=0.185  Sum_probs=63.7

Q ss_pred             CEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             88999320012479746522678999999999998356677399914023267801136887333099999999999999
Q gi|254780633|r   22 WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIID  101 (267)
Q Consensus        22 ~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~  101 (267)
                      ++.|+-.++-       |.. |.++---+.-.+++..+.+.-.+|+|  +|||+-.+..|-+--.++..+..       .
T Consensus        53 dVfI~qs~~~-------pvn-d~lmELLi~idA~k~asA~~It~ViP--Y~gYARQDk~~~~repIsaklvA-------~  115 (314)
T COG0462          53 DVFIIQSTSP-------PVN-DNLMELLIMIDALKRASAKRITAVIP--YFGYARQDKAFKPREPISAKLVA-------N  115 (314)
T ss_pred             EEEEEECCCC-------CCC-HHHHHHHHHHHHHHHCCCCEEEEEEE--CCHHHCCCCCCCCCCCEEHHHHH-------H
T ss_conf             6999908999-------868-89999999999988658865899931--65132257656899977299999-------9


Q ss_pred             HHHHCCCCEEEEECCCCCCH-----------HHHHHHHHHHHHH
Q ss_conf             99974998899973987867-----------8999999998635
Q gi|254780633|r  102 AIRKMGIRKIVILNAHGGNS-----------PLVSIVSTEARMR  134 (267)
Q Consensus       102 sl~~~Gf~~iviiNgHgGN~-----------~~l~~a~~~l~~~  134 (267)
                      -|...|+.+++-++=|-.++           .+....++.++.+
T Consensus       116 lL~~aG~drv~TvDlH~~qiqgfFdipvdnl~a~p~l~~~~~~~  159 (314)
T COG0462         116 LLETAGADRVLTVDLHAPQIQGFFDIPVDNLYAAPLLAEYIREK  159 (314)
T ss_pred             HHHHCCCCEEEEEECCCHHHCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             99972998699970786565566788403640459999999973


No 19 
>PRK03204 haloalkane dehalogenase; Provisional
Probab=82.68  E-value=4.1  Score=21.12  Aligned_cols=75  Identities=13%  Similarity=0.205  Sum_probs=42.1

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEEC-CCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC--
Q ss_conf             2678999999999998356677399914-0232678011368873330999999999999999997499889997398--
Q gi|254780633|r   41 NTDTIIAAGLAERIKSILPPRLPVTCMP-VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH--  117 (267)
Q Consensus        41 gtD~~~a~~ia~~~a~~~~~~~~~~v~P-~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH--  117 (267)
                      ++....=+.+...+++    +.. +++| -..||.|.-    |.....+.+.+.+.+.++++.   -|+.++++| ||  
T Consensus        44 ~~~~~~w~~~~~~La~----~~r-VIa~Dl~G~G~S~~----P~~~~y~~~~~a~~l~~lld~---Lgl~~~~lv-Ghs~  110 (286)
T PRK03204         44 PTWSFLYRDIIVALRD----RFR-CVAPDYLGFGLSER----PSGFGYQIDEHARVIGEFVDH---LGLDRYLSM-GQDW  110 (286)
T ss_pred             CCCHHHHHHHHHHHHC----CCE-EEEECCCCCCCCCC----CCCCCCCHHHHHHHHHHHHHH---HCCCCEEEE-EECC
T ss_conf             9767799999999831----968-99970899898889----998886899999999999997---489974999-9737


Q ss_pred             CCCHHHHHHHHH
Q ss_conf             786789999999
Q gi|254780633|r  118 GGNSPLVSIVST  129 (267)
Q Consensus       118 gGN~~~l~~a~~  129 (267)
                      ||.. ++..+++
T Consensus       111 GG~v-a~~~A~~  121 (286)
T PRK03204        111 GGPI-SMAVAVE  121 (286)
T ss_pred             CHHH-HHHHHHH
T ss_conf             7899-9999996


No 20 
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional
Probab=81.83  E-value=4.4  Score=20.92  Aligned_cols=69  Identities=10%  Similarity=0.188  Sum_probs=46.5

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             678999999999998356677399914023267801136887333099999999999999999749988999739878
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      -|.++---+.-.++++.+.+.-.+|+|-  |||+-....|-.--.++...       +++-|...|+.+++.++-|-.
T Consensus        50 nd~lmELll~i~alk~~~A~~It~ViPY--~~YsRQDr~~~~ge~isa~~-------va~lL~~~G~d~vitvDlH~~  118 (304)
T PRK03092         50 NKWLMEQLIMIDALKRASAKRITVVLPF--YPYARQDKKHRGREPISARL-------VADLLKTAGADRIMTVDLHTD  118 (304)
T ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEECCC--CCCCCCCCCCCCCCCCCHHH-------HHHHHHHCCCCEEEEECCCHH
T ss_conf             1889999999999997589727998057--76005877778877522999-------999886148881799657759


No 21 
>PRK05038 consensus
Probab=80.14  E-value=5  Score=20.55  Aligned_cols=71  Identities=13%  Similarity=0.271  Sum_probs=50.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCC-CCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             5226789999999999983566773999140232678011368-873330999999999999999997499889997398
Q gi|254780633|r   39 PMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH  117 (267)
Q Consensus        39 PlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~f-pGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH  117 (267)
                      |. -|.++---+.-.++++.+.+.-.+|+|-  |||+-....| +|-..++...+..+       |...|+.+++.++=|
T Consensus        62 p~-nd~lmELll~idA~r~a~A~~It~ViPY--~~YaRQDr~~~~g~~pIsak~vA~l-------l~~~g~d~vitvDlH  131 (315)
T PRK05038         62 PT-NDNLMELVVMVDALRRASAGRITAVIPY--FGYARQDRRVRSARVPITAKVVADF-------LSSVGVDRVLTVDLH  131 (315)
T ss_pred             CC-CHHHHHHHHHHHHHHHCCCCCEEEEECC--CCCCCCCCCCCCCCCCEEHHHHHHH-------HHHCCCCEEEEECCC
T ss_conf             95-1789999999999987388726998325--4323477555688887019999999-------985388759996588


Q ss_pred             CC
Q ss_conf             78
Q gi|254780633|r  118 GG  119 (267)
Q Consensus       118 gG  119 (267)
                      -.
T Consensus       132 ~~  133 (315)
T PRK05038        132 AE  133 (315)
T ss_pred             HH
T ss_conf             58


No 22 
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins. GDP-mannose pyrophosphorylase  (GTP: alpha-d-mannose-1-phosphate guanyltransferase) catalyzes the formation of GDP-d-mannose from GTP and alpha-d-mannose-1-Phosphate. It contains an N-terminal catalytic domain and a C-terminal Lefthanded-beta-Helix fold domain. GDP-d-mannose is the activated form of mannose for formation of cell wall lipoarabinomannan and various mannose-containing glycolipids and polysaccharides. The function of GDP-mannose pyrophosphorylase is essential for cell wall integrity, morphogenesis and viability. Repression of GDP-mannose pyrophosphorylase in yeast leads to phenotypes, such as cell lysis, defective cell wall, and failure of polarized growth and cell separation.
Probab=70.69  E-value=7.7  Score=19.35  Aligned_cols=45  Identities=13%  Similarity=0.179  Sum_probs=29.1

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             99999999997499889997398786789999999986355839998
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS  141 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~  141 (267)
                      +|.-+++.|.+.||++|+|+.+|.++.  +.........+++..+..
T Consensus        33 li~~~i~~l~~~gi~~iii~~~y~~~~--i~~~~~~~~~~~~~~i~~   77 (233)
T cd06425          33 MIEHQIEALAKAGVKEIILAVNYRPED--MVPFLKEYEKKLGIKITF   77 (233)
T ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHH--HHHHHHHHHHHCCCEEEE
T ss_conf             999999999985997321011235779--999998777743960565


No 23 
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR011283   This entry represent acetoacetyl-CoA reductase, a member of the family short-chain-alcohol dehydrogenases. Note that, despite the precision implied by the enzyme name, the reaction of 1.1.1.36 from EC is defined more generally as (R)-3-hydroxyacyl-CoA + NADP+ = 3-oxoacyl-CoA + NADPH. Members of this family may act in the biosynthesis of poly-beta-hydroxybutyrate (e.g. Rhizobium meliloti) and related poly-beta-hydroxyalkanoates. Note that the member of this family from Azospirillum brasilense, designated NodG, appears to lack acetoacetyl-CoA reductase activity and to act instead in the production of nodulation factor. ; GO: 0018454 acetoacetyl-CoA reductase activity, 0042619 poly-hydroxybutyrate biosynthetic process, 0005737 cytoplasm.
Probab=68.61  E-value=9.6  Score=18.75  Aligned_cols=28  Identities=25%  Similarity=0.105  Sum_probs=11.0

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             999999974998899973987867899999
Q gi|254780633|r   98 AIIDAIRKMGIRKIVILNAHGGNSPLVSIV  127 (267)
Q Consensus        98 di~~sl~~~Gf~~iviiNgHgGN~~~l~~a  127 (267)
                      .||+.|+..||  -|+=|.|++|...-+..
T Consensus        15 AIC~rL~~dG~--~V~An~~p~N~~~a~~W   42 (244)
T TIGR01829        15 AICTRLAKDGY--RVAANYVPSNEERAEAW   42 (244)
T ss_pred             HHHHHHHHCCC--EEEECCCCCCHHHHHHH
T ss_conf             99999987598--89881789825899999


No 24 
>PRK03675 consensus
Probab=66.33  E-value=11  Score=18.41  Aligned_cols=68  Identities=10%  Similarity=0.107  Sum_probs=44.8

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             678999999999998356677399914023267801136887333099999999999999999749988999739878
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      -|.++---+.-.++++.+.+.-.+|+|  +|||+-....|-.--.++...+..++        ..|+.+++.++=|-.
T Consensus        56 nd~lmELll~~dAlr~a~A~~It~ViP--Y~~YaRQDr~~~~gepisak~va~ll--------~~~~d~vitvDlH~~  123 (279)
T PRK03675         56 DEKLIEALLLGDALREAGFEKLKLVVP--YLAYSRQDRVTKEGEPISVRAVMKML--------GLYYDELYVFDIHNP  123 (279)
T ss_pred             CHHHHHHHHHHHHHHHHCCCEEEEEEC--CCCCCCCCCCCCCCCCHHHHHHHHHH--------HHHCCEEEEEECCCH
T ss_conf             367999999999999827872799934--67523224224799861499999997--------521276999826857


No 25 
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional
Probab=66.27  E-value=11  Score=18.41  Aligned_cols=88  Identities=18%  Similarity=0.274  Sum_probs=61.0

Q ss_pred             EEEEEECCCC------CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHH
Q ss_conf             8999320012------4797465226789999999999983566773999140232678011368873330999999999
Q gi|254780633|r   23 IVVLPLGAYE------QHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHW   96 (267)
Q Consensus        23 vvilPvGs~E------qHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l   96 (267)
                      -++.+++...      -|--|++.. |.+.=--+.-.++++.+++.-.+|+|  +||||-.+.. -+-.+++...     
T Consensus        81 fi~~d~~n~s~ty~~~g~~~~~spN-D~lmELlimIdA~kraSA~rItaViP--y~gYaRQDrk-~~RepItAkL-----  151 (381)
T PRK06827         81 FILQDVGNYSVTYNMFGEKNHKGPD-DHFQDLKRTIDAIRQAKANRITVIMP--LLYYSRQHKR-KGRESLDCAL-----  151 (381)
T ss_pred             EEEEECCCCCEEEECCCCCCCCCCC-HHHHHHHHHHHHHHHCCCCEEEEECC--CCCHHCCCCC-CCCCCCCHHH-----
T ss_conf             9997347774034035754768977-28999999998743435874899856--8813125777-7888747999-----


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             9999999974998899973987867
Q gi|254780633|r   97 LAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        97 ~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                        ++.-|...|..|++-+--|-+++
T Consensus       152 --vA~lL~~aGvdrviT~DLHa~qI  174 (381)
T PRK06827        152 --ALQELEELGVDHILTFDIHDPNI  174 (381)
T ss_pred             --HHHHHHHCCCCEEEEEECCCCCC
T ss_conf             --99999971999699975787224


No 26 
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose. Prokaryotic UDP-Glucose Pyrophosphorylase (UGPase) catalyzes a reversible production of UDP-Glucose  and pyrophosphate (PPi) from glucose-1-phosphate and UTP.  UDP-glucose plays pivotal roles in galactose utilization, in glycogen synthesis, and in the synthesis of the carbohydrate moieties of glycolipids , glycoproteins , and proteoglycans. UGPase is found in both prokaryotes and eukaryotes, although prokaryotic and eukaryotic forms of UGPase catalyze the same reaction, they share low sequence similarity.
Probab=62.79  E-value=9.4  Score=18.80  Aligned_cols=26  Identities=23%  Similarity=0.387  Sum_probs=20.9

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             99999999997499889997398786
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      +|.-+++.|.++||++|+|+.+|.+.
T Consensus        33 ii~~~i~~l~~~Gi~~iii~~~~~~~   58 (267)
T cd02541          33 VIQYIVEEAVAAGIEDIIIVTGRGKR   58 (267)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEECCHH
T ss_conf             69999999998699889999124666


No 27 
>pfam01888 CbiD CbiD. CbiD is essential for cobalamin biosynthesis in both S. typhimurium and B. megaterium, no functional role has been ascribed to the protein. The CbiD protein has a putative S-AdoMet binding site. It is possible that CbiD might have the same role as CobF in undertaking the C-1 methylation and deacylation reactions required during the ring contraction process.
Probab=60.78  E-value=14  Score=17.77  Aligned_cols=119  Identities=13%  Similarity=0.159  Sum_probs=69.2

Q ss_pred             EECCCCCCCCCCCCHHHHHHH--HHH-HHHHHHHCCCCCEEEEECCCCCCCC------HHHCCCCCCEE----------C
Q ss_conf             320012479746522678999--999-9999983566773999140232678------01136887333----------0
Q gi|254780633|r   27 PLGAYEQHGPHLPMNTDTIIA--AGL-AERIKSILPPRLPVTCMPVEPIGYS------IEHMYVDGTKT----------L   87 (267)
Q Consensus        27 PvGs~EqHGpHlPlgtD~~~a--~~i-a~~~a~~~~~~~~~~v~P~i~yG~s------~~h~~fpGTis----------l   87 (267)
                      -||-+-.-|.-+|.|.-.+.+  +.+ .+.+.+.++...++.|.=.+|=|--      ....+--|-||          +
T Consensus        98 GVG~vTkpGL~~~vGe~AINpvPR~mI~~~v~~~~~~~~g~~V~IsvP~GeelAkkT~NprLGI~GGISILGTtGiV~P~  177 (261)
T pfam01888        98 GVGIVTKPGLQVPEGEAAINPVPRRMIRENLQKALREDEGVMVTISVPEGEELAKKTLNARLGIVGGISILGTTGIVRPM  177 (261)
T ss_pred             EEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEECCHHHHHHHCCCCCCCCCCCEEECCCCEEEEEC
T ss_conf             89999358866889975268789999999999984758987999991778888775256002734784423562489857


Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEEECCCCCCC
Q ss_conf             99999999999999999749988999739878678999999998635583999824765456
Q gi|254780633|r   88 TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTI  149 (267)
Q Consensus        88 ~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~~~~~~~~~  149 (267)
                      +.+.+.+-+..-++.....|+++++|..|.   .. .+.+.+.+.......+..-+|..+..
T Consensus       178 S~~a~~~si~~~l~v~~a~g~~~lvl~~G~---~g-~~~a~~~~~l~~~~~V~~gn~iG~~L  235 (261)
T pfam01888       178 STEAYKASLAQQIDVAAASGYQRLVFVPGN---IG-EKYARQQFGVPDDAFVQMANFVGFML  235 (261)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCEEEECCCH---HH-HHHHHHHCCCCHHHEEEEEHHHHHHH
T ss_conf             849999999999999998797969994480---89-99999862988488799527279999


No 28 
>PRK06765 homoserine O-acetyltransferase; Provisional
Probab=59.99  E-value=9.3  Score=18.82  Aligned_cols=113  Identities=11%  Similarity=0.069  Sum_probs=53.0

Q ss_pred             CCCCHHHCCHHHHHHCCCCCEEEEEECCC---CCCCCCCCCHH-----HHHHHHHHHHHHHHHCCCCCEEEEECCC---C
Q ss_conf             66404666979897310498899932001---24797465226-----7899999999999835667739991402---3
Q gi|254780633|r    3 PLIIFTDNSLPLCADARKDWIVVLPLGAY---EQHGPHLPMNT-----DTIIAAGLAERIKSILPPRLPVTCMPVE---P   71 (267)
Q Consensus         3 ~~~~~~~lT~~e~~~~~~~~vvilPvGs~---EqHGpHlPlgt-----D~~~a~~ia~~~a~~~~~~~~~~v~P~i---~   71 (267)
                      +.++++.-||.++.+. ++-+|++|-.-+   ...|.+.+-..     |.++...-      .+..+.=.+|++-+   .
T Consensus        35 ~~~~laY~t~G~Ln~~-~~NaILv~HaltG~~h~ag~~~~~d~~~gWW~~liG~gk------~iDt~kyfVIc~N~lG~~  107 (387)
T PRK06765         35 PDVQMGYETYGTLNRA-KSNVILITHYFSATSHAAGKYTAHDEEAGYWDGLIGPGK------AIDTNKYFVISTDTLCNV  107 (387)
T ss_pred             CCCEEEEEEECCCCCC-CCCEEEEECCCCCCHHHCCCCCCCCCCCCCHHHCCCCCC------CCCCCCEEEEEECCCCCC
T ss_conf             8956999850444899-997899948857763322677777888771876358998------657676699994577777


Q ss_pred             CCCCHH-----------------HCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC--CCCHHHHHHHHH
Q ss_conf             267801-----------------1368873330999999999999999997499889997398--786789999999
Q gi|254780633|r   72 IGYSIE-----------------HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH--GGNSPLVSIVST  129 (267)
Q Consensus        72 yG~s~~-----------------h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH--gGN~~~l~~a~~  129 (267)
                      ||.|+.                 -.+||      .=|+.+++.-..+-|-+-|++|+..|-|-  ||.. +++-++.
T Consensus       108 ~g~~p~~~stGP~S~~p~tg~pyg~~FP------~vTi~D~V~aq~~LLd~LGI~kl~aViGgSmGGmq-Alewa~~  177 (387)
T PRK06765        108 QVKDPNVITTGPASINPKTGKPYGMDFP------VVTILDFVRVQKELLEDLGIARLHAVMGPSMGGMQ-AQEWAVH  177 (387)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC------CEEHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHH-HHHHHHH
T ss_conf             7789887878999999899986658999------40328899999999998398857211465818899-9999997


No 29 
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional
Probab=59.41  E-value=14  Score=17.62  Aligned_cols=66  Identities=11%  Similarity=0.182  Sum_probs=44.6

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             6789999999999983566773999140232678011368873330999999999999999997499889997398
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH  117 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH  117 (267)
                      -|.++---+.-.++++.+.+.-.+|+|  +|||+-....|-.--.++...+..+|        ..|+.+++.++-|
T Consensus        62 nd~lmELll~idA~r~a~A~~It~ViP--Y~~YaRQDr~~~~ge~isak~vA~ll--------~~~~d~vitvDlH  127 (301)
T PRK07199         62 DEKLLPLLFAAEAARELGARRVVLVAP--YLAYMRQDIRFHPGEAISSRHFARLL--------SGSFDRLITVDPH  127 (301)
T ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEEEC--CCCHHCCCCCCCCCCCCCHHHHHHHH--------HHHCCEEEEECCC
T ss_conf             388999999999998748874899815--66210132234799851089999999--------8527768997045


No 30 
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline. This family contains proteins similar to prokaryotic phosphocholine (P-cho) cytidylyltransferases. Phosphocholine (PC) cytidylyltransferases catalyze the transfer of a cytidine monophosphate from CTP to phosphocholine to form CDP-choline. PC is the most abundant phospholipid in eukaryotic membranes and it is also important in prokaryotic membranes. For pathogenic prokaryotes, the cell surface PC facilitates the interaction with host surface and induces attachment and invasion. In addition cell wall PC serves as scaffold for a group of choline-binding proteins that are secreted from the cells. Phosphocholine (PC) cytidylyltransferase is a key enzyme in the prokaryotic choline metabolism pathway. It has been hypothesized to consist of a choline transport system, a choline kinase, CTP:phosphocholine cytidylyltransferase, and a choline phosphotransferase that transfers P-Cho from CDP
Probab=57.18  E-value=9.4  Score=18.79  Aligned_cols=26  Identities=23%  Similarity=0.346  Sum_probs=21.1

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             99999999997499889997398786
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      +|.-+++.|.+.|+++|+|+.||.++
T Consensus        31 li~~~i~~l~~~gi~~i~iv~gy~~e   56 (229)
T cd02523          31 LLERQIETLKEAGIDDIVIVTGYKKE   56 (229)
T ss_pred             HHHHHHHHHHHCCCCCCEEECCCCHH
T ss_conf             99999999998499853665554899


No 31 
>TIGR01500 sepiapter_red sepiapterin reductase; InterPro: IPR006393   These sequences represent sepiapterin reductase, a member of the short chain dehydrogenase/reductase family. The enzyme catalyzes the last step in the biosynthesis of tetrahydrobiopterin. A similar enzyme in Bacillus cereus was isolated for its ability to convert benzil to (S)-benzoin, a property sepiapterin reductase also shares. ; GO: 0004757 sepiapterin reductase activity, 0006729 tetrahydrobiopterin biosynthetic process.
Probab=56.67  E-value=8.3  Score=19.15  Aligned_cols=35  Identities=20%  Similarity=0.317  Sum_probs=25.2

Q ss_pred             EECCHHH-HHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             3309999-9999999999999749988999739878
Q gi|254780633|r   85 KTLTYAE-AIEHWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        85 isl~~~t-~~~~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      +.+.... ....+..+-++-...+|.|+++||.||.
T Consensus        66 ldl~~~~~~e~~~k~l~e~~~~~~~~r~~~inNaGt  101 (267)
T TIGR01500        66 LDLEAAKDVEDLLKALRESIKKEEYERLLLINNAGT  101 (267)
T ss_pred             CCCCCCCCHHHHHHHHHHCCCCCCCCEEEEEECCCC
T ss_conf             211220017999999984379455404888816864


No 32 
>cd07984 LPLAT_LABLAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LABLAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as lipid A biosynthesis lauroyl/myristoyl (LABLAT, HtrB) acyltransferases and similar proteins.
Probab=53.45  E-value=18  Score=17.00  Aligned_cols=31  Identities=26%  Similarity=0.413  Sum_probs=15.9

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             99999997499889997398786789999999
Q gi|254780633|r   98 AIIDAIRKMGIRKIVILNAHGGNSPLVSIVST  129 (267)
Q Consensus        98 di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~  129 (267)
                      |++..+...| |-+|++.+|-||...+..+..
T Consensus        10 e~l~~~~~~g-rgvIl~~~H~gnwE~~~~~~~   40 (192)
T cd07984          10 EHLEAALAKG-KGVILLTAHFGNWELAGLALA   40 (192)
T ss_pred             HHHHHHHHCC-CCEEEEECCCCHHHHHHHHHH
T ss_conf             9999999769-999999322408999999999


No 33 
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose. Alpha-D-Glucose-1-phosphate Cytidylyltransferase catalyzes the production of CDP-D-Glucose from alpha-D-Glucose-1-phosphate and MgCTP as substrate. CDP-D-Glucose is the precursor  for synthesizing four of the five naturally occurring 3,6-dideoxy sugars-abequose (3,6-dideoxy-D-Xylo-hexose), ascarylose (3,6-dideoxy-L-arabino-hexose), paratose (3,6-dideoxy-D-ribohexose), and tyvelose (3,6-dideoxy-D-arabino-hexose. Deoxysugars are ubiquitous in nature where they function in a variety of biological processes, including cell adhesion, immune response, determination of ABO blood groups, fertilization, antibiotic function, and microbial pathogenicity.
Probab=52.73  E-value=18  Score=16.92  Aligned_cols=26  Identities=12%  Similarity=0.180  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             99999999997499889997398786
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      +|.-+++.|.++||++|+|.-||.+.
T Consensus        31 ii~~ii~~l~~~gi~~iil~~gy~~~   56 (253)
T cd02524          31 ILWHIMKIYSHYGHNDFILCLGYKGH   56 (253)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCH
T ss_conf             99999999998699879995322511


No 34 
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional
Probab=52.08  E-value=19  Score=16.86  Aligned_cols=68  Identities=10%  Similarity=0.079  Sum_probs=43.5

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             678999999999998356677399914023267801136887333099999999999999999749988999739878
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      -|.++---+.-.++++.+.+.-.+|+|-  |||+-....|-.--.++...+..+|.        .++.+++.++-|-.
T Consensus        59 nd~lmELll~i~A~r~a~A~~It~ViPY--~~YsRQDr~~~~ge~isak~va~ll~--------~~~d~vitvDlH~~  126 (286)
T PRK00934         59 DENLIELILLLDALRDEGVKSITLVAPY--LAYARQDRRFKEGEPISIKALAKVYS--------SYYDEIITINIHEE  126 (286)
T ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEECCC--CCCCCCCCCCCCCCCCCHHHHHHHHH--------HHCCEEEEEECCHH
T ss_conf             4799999999999987589738998346--55334643468998650899999997--------53174699947887


No 35 
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family. This is a subfamily of nucleotidyl transferases. Nucleotidyl transferases transfer nucleotides onto phosphosugars. The activated sugars are precursors for synthesis of lipopolysaccharide, glycolipids and polysaccharides. Other subfamilies of nucleotidyl transferases include Alpha-D-Glucose-1-Phosphate Cytidylyltransferase, Mannose-1-phosphate guanyltransferase, and Glucose-1-phosphate thymidylyltransferase.
Probab=50.74  E-value=19  Score=16.84  Aligned_cols=26  Identities=27%  Similarity=0.363  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             99999999997499889997398786
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      +|.-++..|.+.||++|+|+.+|.++
T Consensus        32 ii~~~i~~l~~~gi~~iii~~~y~~~   57 (221)
T cd06422          32 LIDHALDRLAAAGIRRIVVNTHHLAD   57 (221)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHH
T ss_conf             99999999998299679983253278


No 36 
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family. This is a subfamily of nucleotidyl transferases. Nucleotidyl transferases transfer nucleotides onto phosphosugars. The activated sugars are precursors for synthesis of lipopolysaccharide, glycolipids and polysaccharides. Other subfamilies of nucleotidyl transferases include Alpha-D-Glucose-1-Phosphate Cytidylyltransferase, Mannose-1-phosphate guanyltransferase, and Glucose-1-phosphate thymidylyltransferase.
Probab=48.86  E-value=21  Score=16.54  Aligned_cols=28  Identities=21%  Similarity=0.115  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             9999999999974998899973987867
Q gi|254780633|r   94 EHWLAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        94 ~~l~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      .+|.-++..|.+.|+++|+|+.||.++.
T Consensus        30 pli~~~i~~l~~~gi~~i~i~~~y~~e~   57 (220)
T cd06426          30 PILETIIDRFIAQGFRNFYISVNYLAEM   57 (220)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCHH
T ss_conf             3999999999983996899950146113


No 37 
>PRK06456 acetolactate synthase catalytic subunit; Reviewed
Probab=48.01  E-value=22  Score=16.46  Aligned_cols=45  Identities=16%  Similarity=0.053  Sum_probs=26.8

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEEE
Q ss_conf             99999999974998899973987867899999999863558399982
Q gi|254780633|r   96 WLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST  142 (267)
Q Consensus        96 l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~~  142 (267)
                      +..+++-|.+.  ||-+|+-|+|....-....++++.++.+..++..
T Consensus       197 i~~a~~lL~~A--krPvIl~G~G~~~~~a~~~l~~lae~l~~Pv~tT  241 (572)
T PRK06456        197 IKKAAEILINA--ERPIILVGTGVVWSNATPEVLELAELLHIPIVST  241 (572)
T ss_pred             HHHHHHHHHHC--CCCEEEEECCCCCCCCHHHHHHHHHHHCCCCEEC
T ss_conf             99999999818--9988999558241436499999999839981220


No 38 
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases. WcbM protein of Burkholderia mallei is involved in the biosynthesis, export or translocation of capsule. It is a subfamily of nucleotidyl transferases that transfer nucleotides onto phosphosugars.
Probab=47.84  E-value=22  Score=16.44  Aligned_cols=26  Identities=15%  Similarity=0.239  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             99999999997499889997398786
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      ++.-++..|.+.|+++|+|+.||.++
T Consensus        31 li~~~l~~l~~~gi~~iii~~~~~~~   56 (223)
T cd06915          31 FLEYLLEYLARQGISRIVLSVGYLAE   56 (223)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECCHHH
T ss_conf             99999999997599778873010234


No 39 
>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2. N-terminal domain of epsilon subunit of the eukaryotic translation initiation factor 2B (eIF-2B): eIF-2B is a guanine nucleotide-exchange factor which mediates the exchange of GDP (bound to initiation factor eIF2) for GTP, generating active eIF2.GTP complex. EIF2B is a complex multimeric protein consisting of five subunits named alpha, beta, gamma, delta and epsilon. Subunit epsilon shares sequence similarity with gamma subunit, and with a family of bifunctional nucleotide-binding enzymes such as ADP-glucose pyrophosphorylase, suggesting that epsilon subunit may play roles in nucleotide binding activity. In yeast, eIF2B gamma enhances the activity of eIF2B-epsilon leading to the idea that these subunits form the catalytic subcomplex.
Probab=47.77  E-value=21  Score=16.52  Aligned_cols=26  Identities=4%  Similarity=0.129  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             99999999997499889997398786
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      ++.-++..|.++||+.|+++.+|.++
T Consensus        33 li~y~l~~L~~~G~~ei~v~~~~~~~   58 (217)
T cd04197          33 LIDYTLEFLALNGVEEVFVFCCSHSD   58 (217)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHH
T ss_conf             39999999998799779999468999


No 40 
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase. This family is the long form of Glucose-1-phosphate thymidylyltransferase.  Glucose-1-phosphate thymidylyltransferase catalyses the formation of dTDP-glucose, from dTTP and glucose 1-phosphate. It is the first enzyme in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme.There are two forms of   Glucose-1-phosphate thymidylyltransferase in bacteria and archeae; short form and long form.  The long form, which has an extra 50 amino acids c-terminal, is found in many species for which it serves as a sugar-activating enzyme for antibiotic biosynthesis and or other, unknown pathways, and in which dTDP-L-rhamnose is not necessarily produced.The long from enzymes also have a left-handed parallel helix domain at the c-terminus, whereas, th eshort form enzymes do not have this domain. The homotetrameric, feedback inhibited short form is found in 
Probab=45.07  E-value=24  Score=16.17  Aligned_cols=26  Identities=27%  Similarity=0.335  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             99999999999749988999739878
Q gi|254780633|r   94 EHWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        94 ~~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      .++.-++..|...|+++|+++.||.+
T Consensus        32 pli~~~i~~l~~~gi~~Iiiv~~~~~   57 (236)
T cd04189          32 PIIQYAIEDLREAGIEDIGIVVGPTG   57 (236)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEECCH
T ss_conf             09999999999869958999854141


No 41 
>KOG1349 consensus
Probab=44.27  E-value=20  Score=16.73  Aligned_cols=55  Identities=11%  Similarity=0.194  Sum_probs=30.1

Q ss_pred             HHHHHHHHHH--------HHHHHHHCCCCEEEEECCCCCCHH------------HHHHHHHHH--HHHCCEEEEEEC
Q ss_conf             9999999999--------999999749988999739878678------------999999998--635583999824
Q gi|254780633|r   89 YAEAIEHWLA--------IIDAIRKMGIRKIVILNAHGGNSP------------LVSIVSTEA--RMRFSMLVVSTS  143 (267)
Q Consensus        89 ~~t~~~~l~d--------i~~sl~~~Gf~~iviiNgHgGN~~------------~l~~a~~~l--~~~~~~~~~~~~  143 (267)
                      .|.|+.+|+.        --+-|...|=.-++.+|||||+.-            -|-.+.+++  +.++....+.++
T Consensus       112 vEnflr~LTgR~~~~tprSKrlltDe~SNIlIYmtGHGgd~FlKFqd~eelts~dLadai~qm~e~~Ryneil~miD  188 (309)
T KOG1349         112 VENFLRVLTGRHPNNTPRSKRLLTDEGSNILIYLTGHGGDGFLKFQDAEELTSDDLADAIQQMWEKKRYNEILFMID  188 (309)
T ss_pred             HHHHHHHHCCCCCCCCCHHHHHCCCCCCCEEEEECCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHCEEEEEEE
T ss_conf             99999997188889981344431367776799981678752033266887646788999999998632324899832


No 42 
>pfam07819 PGAP1 PGAP1-like protein. The sequences found in this family are similar to PGAP1. This is an endoplasmic reticulum membrane protein with a catalytic serine containing motif that is conserved in a number of lipases. PGAP1 functions as a GPI inositol-deacylase; this deacylation is important for the efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi body.
Probab=42.54  E-value=27  Score=15.92  Aligned_cols=76  Identities=18%  Similarity=0.113  Sum_probs=44.4

Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCC--EEEEECCC--CC
Q ss_conf             899999999999835667739991402326780113688733309999999999999999974998--89997398--78
Q gi|254780633|r   44 TIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIR--KIVILNAH--GG  119 (267)
Q Consensus        44 ~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~--~iviiNgH--gG  119 (267)
                      ..-++-+|..+.++...+....-+=....-+..++..|-|.+=.++..|.+.....+.++++....  +=|++-||  ||
T Consensus        17 ykQvRSlas~~~~~~~~~~~~~~ld~ftvDfnEelsA~~G~~l~~Qaeyv~~aI~~Il~lY~~~~~~p~sVilvGHSMGG   96 (225)
T pfam07819        17 YKQVRSIASVALRKAELNDNGFHLDFFSVDFNEELSAFHGRTLLDQAEYLNDAIRYILSLYNSGRPPPTSVILIGHSMGG   96 (225)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCH
T ss_conf             78898999999998751377754208987345355531618899999999999999999852478999716998632411


No 43 
>pfam05706 CDKN3 Cyclin-dependent kinase inhibitor 3 (CDKN3). This family consists of cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species. The cyclin-dependent kinase (Cdk)-associated protein phosphatase (KAP) is a human dual specificity protein phosphatase that dephosphorylates Cdk2 on threonine 160 in a cyclin-dependent manner.
Probab=42.07  E-value=27  Score=15.88  Aligned_cols=48  Identities=17%  Similarity=0.156  Sum_probs=32.4

Q ss_pred             CCCCHHHCCCC-CCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             26780113688-733309999999999999999974998899973987867
Q gi|254780633|r   72 IGYSIEHMYVD-GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        72 yG~s~~h~~fp-GTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      +|...||..|| |++. ..+....++.++...| ++|.+-+|=..|--|-.
T Consensus        99 ~G~~vhH~PipDg~~P-~~~~c~~ileEl~~~L-~~grk~lihc~gglgrs  147 (207)
T pfam05706        99 CGIITHHHPIADGGTP-DIASCCEIMEELATCL-KNNRKTLIHSVGGLGRS  147 (207)
T ss_pred             CCCEEEECCCCCCCCC-CHHHHHHHHHHHHHHH-HCCCEEEEEEECCCCCH
T ss_conf             6916885477899998-7899999999999999-83984899984465403


No 44 
>pfam00561 Abhydrolase_1 alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.
Probab=41.85  E-value=27  Score=15.85  Aligned_cols=56  Identities=16%  Similarity=0.331  Sum_probs=30.2

Q ss_pred             EEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC--CCCHHHHHHHHH
Q ss_conf             99140232678011368873330999999999999999997499889997398--786789999999
Q gi|254780633|r   65 TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH--GGNSPLVSIVST  129 (267)
Q Consensus        65 ~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH--gGN~~~l~~a~~  129 (267)
                      ++.=-..+|.|.....    -..+.+.+...+.+++   .+.|.+++++| ||  ||.. ++..+.+
T Consensus         4 i~~D~~G~G~S~~~~~----~~~~~~~~~~di~~l~---~~l~i~~~~li-GhS~Gg~v-a~~~a~~   61 (225)
T pfam00561         4 IAFDLRGFGRSSPPDL----ADYRFDDLAEDLEALL---QALGLDKVNLV-GHSMGGLI-ALAYAAK   61 (225)
T ss_pred             EEECCCCCCCCCCCCC----CCCCHHHHHHHHHHHH---HHCCCCCEEEE-EECCCCHH-HHHHHHH
T ss_conf             9975899999969898----9989999999999999---97699977999-97288399-9999996


No 45 
>COG1938 Archaeal enzymes of ATP-grasp superfamily [General function prediction only]
Probab=41.64  E-value=27  Score=15.83  Aligned_cols=38  Identities=13%  Similarity=0.139  Sum_probs=33.6

Q ss_pred             CCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             88733309999999999999999974998899973987
Q gi|254780633|r   81 VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        81 fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      +-.-+.+++....++...++.++.++|++.++.++|-+
T Consensus        81 ~~~dv~I~p~~i~e~s~~v~~w~~~~~v~~ii~~~g~~  118 (244)
T COG1938          81 LVSDVPIPPAVIYEISNAVVEWAEENGVEEVISLGGMP  118 (244)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             98247898788999999999999971974999966887


No 46 
>PRK07581 hypothetical protein; Validated
Probab=41.50  E-value=28  Score=15.82  Aligned_cols=101  Identities=12%  Similarity=0.147  Sum_probs=53.0

Q ss_pred             CCCCHHHCCHHHHHHCCCCCEEEEEECCCCCC-------CCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCC---C
Q ss_conf             66404666979897310498899932001247-------9746522678999999999998356677399914023---2
Q gi|254780633|r    3 PLIIFTDNSLPLCADARKDWIVVLPLGAYEQH-------GPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEP---I   72 (267)
Q Consensus         3 ~~~~~~~lT~~e~~~~~~~~vvilPvGs~EqH-------GpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~---y   72 (267)
                      +.++++.-||.++...+.+ +|++|-+-+-.|       ||-.|+.||-                  =.+|+|-+-   +
T Consensus        24 ~~~~laY~t~G~Ln~~~~N-ailv~h~~tg~~~~~~wliGpg~~iDt~k------------------yfVIc~N~lG~g~   84 (340)
T PRK07581         24 RDAKLAYATYGTLNAAKDN-AILYPTWYSGTHQDNEWLIGPGRALDPEK------------------YFIIVPNMFGNGL   84 (340)
T ss_pred             CCCEEEEEEECCCCCCCCC-EEEECCCCCCCCCCCCEEECCCCCCCCCC------------------EEEEEECCCCCCC
T ss_conf             8956999950243888986-79976876788877874432898647676------------------5999835878898


Q ss_pred             CCCHHH-------CCCCCCEECCHHHHHHHHHHHHHHHH-HCCCCEEEEECCC--CCCHHHHHHHHH
Q ss_conf             678011-------36887333099999999999999999-7499889997398--786789999999
Q gi|254780633|r   73 GYSIEH-------MYVDGTKTLTYAEAIEHWLAIIDAIR-KMGIRKIVILNAH--GGNSPLVSIVST  129 (267)
Q Consensus        73 G~s~~h-------~~fpGTisl~~~t~~~~l~di~~sl~-~~Gf~~iviiNgH--gGN~~~l~~a~~  129 (267)
                      +.++..       .+|| .++++     +.+...-+-|. .-|++|+..|-|-  ||.. +++-++.
T Consensus        85 ss~p~~~~~~~~~~~FP-~~ti~-----D~V~aq~~Ll~e~LgI~~l~~ViG~SmGGmq-aleWa~~  144 (340)
T PRK07581         85 SSSPSNTPAPYNAARFP-HVTIY-----DNVRAQHRLLTEHFGIERLALVTGWSMGAQQ-TYHWAVR  144 (340)
T ss_pred             CCCCCCCCCCCCCCCCC-EEEEH-----HHHHHHHHHHHHHCCCCEEEEEECCCHHHHH-HHHHHHH
T ss_conf             99998999977778898-53627-----9999999999975298868888566789999-9999986


No 47 
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase. This family is the short form of glucose-1-phosphate thymidylyltransferase.  Glucose-1-phosphate thymidylyltransferase catalyses the formation of dTDP-glucose, from dTTP and glucose 1-phosphate. It is the first enzyme in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme.There are two forms of   Glucose-1-phosphate thymidylyltransferase in bacteria and archeae; short form and long form. The homotetrameric, feedback inhibited short form is found in numerous bacterial species that produce dTDP-L-rhamnose. The long form, which has an extra 50 amino acids c-terminal, is found in many species for which it serves as a sugar-activating enzyme for antibiotic biosynthesis and or other, unknown pathways, and in which dTDP-L-rhamnose is not necessarily produced.
Probab=41.24  E-value=20  Score=16.66  Aligned_cols=24  Identities=21%  Similarity=0.321  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             999999999974998899973987
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      +|.-+++.|.+.|+++|+|+++|.
T Consensus        33 li~~~l~~l~~~Gi~~i~iv~~~~   56 (240)
T cd02538          33 MIYYPLSTLMLAGIREILIISTPE   56 (240)
T ss_pred             EHHHHHHHHHHCCCCCCEEECCHH
T ss_conf             189999999985996231002342


No 48 
>PRK10122 UTP--glucose-1-phosphate uridylyltransferase subunit GalF; Provisional
Probab=38.48  E-value=31  Score=15.52  Aligned_cols=27  Identities=26%  Similarity=0.346  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             999999999999749988999739878
Q gi|254780633|r   93 IEHWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        93 ~~~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      ..++.-+++.+...|++.|+||.+++.
T Consensus        34 kPii~~~vee~~~aGI~eiiiV~~~~k   60 (297)
T PRK10122         34 KPMIQYIVDEIVAAGIKEIVLVTHASK   60 (297)
T ss_pred             EEHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             536999999999879978999917971


No 49 
>cd01837 SGNH_plant_lipase_like SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=38.08  E-value=31  Score=15.48  Aligned_cols=49  Identities=16%  Similarity=0.173  Sum_probs=29.1

Q ss_pred             CCCCCCCHHHCCC--CCCEECCHHH----HHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             0232678011368--8733309999----99999999999997499889997398
Q gi|254780633|r   69 VEPIGYSIEHMYV--DGTKTLTYAE----AIEHWLAIIDAIRKMGIRKIVILNAH  117 (267)
Q Consensus        69 ~i~yG~s~~h~~f--pGTisl~~~t----~~~~l~di~~sl~~~Gf~~iviiNgH  117 (267)
                      .+++|.......+  ..+-.....+    .+.-+...++.|+..|.|||+|.|-.
T Consensus       133 ~v~~G~NDy~~~~~~~~~~~~~~~~~v~~vv~~i~~~l~~L~~~GAr~i~V~nlp  187 (315)
T cd01837         133 LISIGSNDYLNNYFANPTRQYEVEAYVPFLVSNISSAIKRLYDLGARKFVVPGLG  187 (315)
T ss_pred             EEEECCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             9996241788887448876368999999999999999999998699689982889


No 50 
>pfam04748 Polysacc_deac_2 Divergent polysaccharide deacetylase. This family is divergently related to pfam01522 (personal obs:Yeats C).
Probab=37.38  E-value=32  Score=15.41  Aligned_cols=72  Identities=22%  Similarity=0.278  Sum_probs=47.4

Q ss_pred             HHHCCCCCEEEEECCCCCCCCHHHCCCCC--CEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC-CC----CHHHHHHH
Q ss_conf             98356677399914023267801136887--3330999999999999999997499889997398-78----67899999
Q gi|254780633|r   55 KSILPPRLPVTCMPVEPIGYSIEHMYVDG--TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH-GG----NSPLVSIV  127 (267)
Q Consensus        55 a~~~~~~~~~~v~P~i~yG~s~~h~~fpG--Tisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH-gG----N~~~l~~a  127 (267)
                      |+..+.+ -.+-+|.-|.+++  ..+ |+  +.+.+.+.....|...+.+     +-..+=+|.| |+    |...++.+
T Consensus        41 a~~~g~E-vllhlPMe~~~~~--~~g-p~~L~~~~~~~~i~~~l~~~l~~-----~p~avGvnNhmGS~~t~~~~~m~~v  111 (213)
T pfam04748        41 ARAAGHE-VLLHLPMEPLGYK--DPG-PGTLTVGMSAEEIEKRLEAALSR-----VPYAVGVNNHMGSRFTADRAAMRWV  111 (213)
T ss_pred             HHHCCCE-EEEECCCCCCCCC--CCC-CCCCCCCCCHHHHHHHHHHHHHH-----CCCCEEEECCCCCCCCCCHHHHHHH
T ss_conf             9987994-9997456634689--999-77588899999999999999987-----8884899546675541699999999


Q ss_pred             HHHHHHHC
Q ss_conf             99986355
Q gi|254780633|r  128 STEARMRF  135 (267)
Q Consensus       128 ~~~l~~~~  135 (267)
                      .+.++.+.
T Consensus       112 l~~l~~~g  119 (213)
T pfam04748       112 MEELKKRG  119 (213)
T ss_pred             HHHHHHCC
T ss_conf             99998779


No 51 
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit; InterPro: IPR014215   This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium. The B subunit is represented by IPR014214 from INTERPRO. This protein is also known as SpoVFA..
Probab=37.18  E-value=15  Score=17.45  Aligned_cols=22  Identities=23%  Similarity=0.259  Sum_probs=15.2

Q ss_pred             CCCEEEEEECCCCCCCCCCCCH
Q ss_conf             4988999320012479746522
Q gi|254780633|r   20 KDWIVVLPLGAYEQHGPHLPMN   41 (267)
Q Consensus        20 ~~~vvilPvGs~EqHGpHlPlg   41 (267)
                      .-++|||||..+.+||-=-...
T Consensus        55 ~~DvviLPv~G~~~~G~v~t~f   76 (288)
T TIGR02853        55 TLDVVILPVQGVSQDGKVATVF   76 (288)
T ss_pred             CCCEEEECCCCCCCCCEEEEEC
T ss_conf             6667881678859988487411


No 52 
>pfam02574 S-methyl_trans Homocysteine S-methyltransferase. This is a family of related homocysteine S-methyltransferases enzymes: 5-methyltetrahydrofolate--homocysteine S-methyltransferases also known EC:2.1.1.13; Betaine--homocysteine S-methyltransferase (vitamin B12 dependent), EC:2.1.1.5; and Homocysteine S-methyltransferase, EC:2.1.1.10,.
Probab=36.85  E-value=32  Score=15.36  Aligned_cols=91  Identities=10%  Similarity=0.025  Sum_probs=58.4

Q ss_pred             HHHHHHHHHHHHCCC-CCEEEEECCC-CCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHH
Q ss_conf             999999999983566-7739991402-32678011368873330999999999999999997499889997398786789
Q gi|254780633|r   46 IAAGLAERIKSILPP-RLPVTCMPVE-PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL  123 (267)
Q Consensus        46 ~a~~ia~~~a~~~~~-~~~~~v~P~i-~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~  123 (267)
                      .+-.+|++++..... ..+++|+-.+ |||.+.....|+|.-.++.+.+..+..+.++.|...|..-|++=.-  .+..-
T Consensus        83 ~av~lA~~A~~~~~~~~~~~~VaGsigp~~~~~~~~ey~~~~~~~~~~~~~~~~~~~~~l~~~gvD~i~~ET~--~~~~E  160 (303)
T pfam02574        83 RAAEIARAAADEYGNTGDKRLVAGSIGPYGATADGSEYPGYYGVSFEELKKAHRPQLEGLLDGGVDLLLLETI--PDFLE  160 (303)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEC--CCHHH
T ss_conf             9999999999984045886279863377656677766777679999999999999999998579989998502--89999


Q ss_pred             HHHHHHHHHHHCCEE
Q ss_conf             999999986355839
Q gi|254780633|r  124 VSIVSTEARMRFSML  138 (267)
Q Consensus       124 l~~a~~~l~~~~~~~  138 (267)
                      +..+++.++..++..
T Consensus       161 ~~~al~~~~~~~~~p  175 (303)
T pfam02574       161 AKAAVRAVEEVFEAP  175 (303)
T ss_pred             HHHHHHHHHHHCCCC
T ss_conf             999999999754997


No 53 
>pfam00483 NTP_transferase Nucleotidyl transferase. This family includes a wide range of enzymes which transfer nucleotides onto phosphosugars.
Probab=36.03  E-value=30  Score=15.59  Aligned_cols=24  Identities=13%  Similarity=0.263  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             999999999997499889997398
Q gi|254780633|r   94 EHWLAIIDAIRKMGIRKIVILNAH  117 (267)
Q Consensus        94 ~~l~di~~sl~~~Gf~~iviiNgH  117 (267)
                      .+|.-++..|.+.|++++++|++|
T Consensus        32 pli~~~l~~l~~~g~~~~~~v~~~   55 (247)
T pfam00483        32 PMIQYTLSRLMNAGIREPIVICTQ   55 (247)
T ss_pred             CHHHHHHHHHHHCCCCHHEEECCH
T ss_conf             899999999986599520331336


No 54 
>KOG1014 consensus
Probab=35.84  E-value=34  Score=15.26  Aligned_cols=46  Identities=13%  Similarity=0.281  Sum_probs=30.4

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEE--EEEECC
Q ss_conf             99999999997499889997398786789999999986355839--998247
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML--VVSTSW  144 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~--~~~~~~  144 (267)
                      +=++.++.|++.||+ +++|.   =|..=|+.+++++-+++...  ++..++
T Consensus        61 IGKayA~eLAkrG~n-vvLIs---Rt~~KL~~v~kEI~~~~~vev~~i~~Df  108 (312)
T KOG1014          61 IGKAYARELAKRGFN-VVLIS---RTQEKLEAVAKEIEEKYKVEVRIIAIDF  108 (312)
T ss_pred             CHHHHHHHHHHCCCE-EEEEE---CCHHHHHHHHHHHHHHHCCEEEEEEEEC
T ss_conf             229999999975987-99996---8889999999999887580799999864


No 55 
>pfam11187 DUF2974 Protein of unknown function (DUF2974). This bacterial family of proteins has no known function.
Probab=33.70  E-value=36  Score=15.04  Aligned_cols=32  Identities=22%  Similarity=0.258  Sum_probs=21.1

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEEECCC--CCCHHHH
Q ss_conf             999999999999999997499889997398--7867899
Q gi|254780633|r   88 TYAEAIEHWLAIIDAIRKMGIRKIVILNAH--GGNSPLV  124 (267)
Q Consensus        88 ~~~t~~~~l~di~~sl~~~Gf~~iviiNgH--gGN~~~l  124 (267)
                      .+..-..||..++...-     .=++|.||  |||.+..
T Consensus        67 aQ~~A~~YL~~~~~~~~-----~~i~l~GHSKGGNLA~Y  100 (224)
T pfam11187        67 AQRSAAKYLNKILAHYP-----GPIYLGGHSKGGNLAVY  100 (224)
T ss_pred             HHHHHHHHHHHHHHHCC-----CCEEEEECCCHHHHHHH
T ss_conf             89999999999998779-----97899954816789999


No 56 
>TIGR00725 TIGR00725 conserved hypothetical protein TIGR00725; InterPro: IPR005268    This family of conserved hypothetical proteins has no known function. .
Probab=33.59  E-value=28  Score=15.81  Aligned_cols=94  Identities=21%  Similarity=0.216  Sum_probs=59.2

Q ss_pred             CCCEECC-HHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEEECCCCCCCHHHHCC-----
Q ss_conf             8733309-9999999999999999749988999739878678999999998635583999824765456564136-----
Q gi|254780633|r   82 DGTKTLT-YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIIS-----  155 (267)
Q Consensus        82 pGTisl~-~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~-----  155 (267)
                      -|+-..+ .+-..++-..+.+.|+..|-...|++||  |-...++++++.++++.++.+-..-...+.....+.+     
T Consensus         7 ~Gs~~~~Pvee~ye~Ayr~G~~~AK~gPsd~~l~~G--Gr~GvME~~s~G~~~~GGlVVGILP~~~~~~gN~y~~i~v~T   84 (176)
T TIGR00725         7 IGSSEIDPVEELYEIAYRLGKELAKKGPSDHILING--GRGGVMEAVSKGAREKGGLVVGILPSEDFDEGNPYLDIKVKT   84 (176)
T ss_pred             ECCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEC--CCCCEEEEEEECEECCCCEEEEECCCCCCHHCCCCCEEEEEC
T ss_conf             758777887246889999989998619997899947--998445424522010678799980882210038844389851


Q ss_pred             ---CCCC-------------CCCCCCCHHHHHHHHHHC
Q ss_conf             ---6556-------------678868779999999978
Q gi|254780633|r  156 ---FPET-------------EIGIHGGEIETSMMLALA  177 (267)
Q Consensus       156 ---~~~~-------------~~g~HAge~ETS~~lal~  177 (267)
                         +.+.             -.|.-+...|....+.+.
T Consensus        85 Gm~~~~Rn~i~~~S~d~~~~vGG~~GT~~Ei~~A~~l~  122 (176)
T TIGR00725        85 GMNFAERNVILVESADVVVSVGGGYGTLIEILIAYELG  122 (176)
T ss_pred             CCCCCCCCEEEEEECCEEEEEECCHHHHHHHHHHHHCC
T ss_conf             88931245468752658999628825899999997158


No 57 
>PRK01132 consensus
Probab=32.26  E-value=38  Score=14.89  Aligned_cols=68  Identities=15%  Similarity=0.079  Sum_probs=43.0

Q ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             789999999999983566773999140232678011368873330999999999999999997499889997398786
Q gi|254780633|r   43 DTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        43 D~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      |.++---+.-.+++..+.+.-.+|+|  +|||+-....|-..-.++..++..+|.        .+..+++.++-|-.+
T Consensus        60 ~~lmELll~idAlr~~~A~rIt~ViP--Y~~YsRQDr~~~~ge~isak~vA~ll~--------~~~d~vitvDlH~~~  127 (286)
T PRK01132         60 AELIEMILLLSAAYDYKPKSVNIIAP--YYGYARQHQRYNPGEPISSQIFTEIIE--------SYSDSIATVDIHDEE  127 (286)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEC--CCCCCCCCCCCCCCCCCCHHHHHHHHH--------HHCCEEEEEECCHHH
T ss_conf             76999999999998748872799824--654233232358989630999999987--------416669998246056


No 58 
>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity. N-terminal domain of eEIF-2B epsilon and gamma, subunits of eukaryotic translation initiators, is a subfamily of glycosyltranferase 2 and is predicted to have glycosyltranferase activity. eIF-2B is a guanine nucleotide-exchange factor which mediates the exchange of GDP (bound to initiation factor eIF2) for GTP, generating active eIF2.GTP complex. EIF2B is a complex multimeric protein consisting of five subunits named alpha, beta, gamma, delta and epsilon. Subunit epsilon shares sequence similarity with gamma subunit, and with a family of bifunctional nucleotide-binding enzymes such as ADP-glucose pyrophosphorylase, suggesting that epsilon subunit may play roles in nucleotide binding activity. In yeast, eIF2B gamma enhances the activity of eIF2B-epsilon leading to the idea that these subunits form the catalytic subcomplex.
Probab=31.25  E-value=40  Score=14.79  Aligned_cols=25  Identities=8%  Similarity=0.197  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             9999999999749988999739878
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      ++..++..|.++||+.|+|+-++..
T Consensus        33 ~i~y~l~~l~~~gi~~i~i~~~~~~   57 (216)
T cd02507          33 LIDYTLEWLEKAGVEEVFVVCCEHS   57 (216)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCH
T ss_conf             7999999999879988999958888


No 59 
>TIGR01840 esterase_phb esterase, PHB depolymerase family; InterPro: IPR010126   This entry describes a group of lipases of the ab-hydrolase family. They include bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, and feruloyl esterases from fungi.; GO: 0005576 extracellular region.
Probab=30.34  E-value=28  Score=15.79  Aligned_cols=80  Identities=16%  Similarity=0.119  Sum_probs=43.6

Q ss_pred             HHHHHHCCCCCEEEEECCCCCCCCHHHC-----CCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             9999835667739991402326780113-----68873330999999999999999997499889997398786789999
Q gi|254780633|r   52 ERIKSILPPRLPVTCMPVEPIGYSIEHM-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI  126 (267)
Q Consensus        52 ~~~a~~~~~~~~~~v~P~i~yG~s~~h~-----~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~  126 (267)
                      +++|++.+-   +||+|.+.-..+..+.     +|=.|-.....+                           |..-.|..
T Consensus        46 ~~~A~~YGf---~~vaP~~~~~~~~~~~~sGCw~wf~~~h~~R~~---------------------------Ge~~~l~~   95 (231)
T TIGR01840        46 KAAADKYGF---VVVAPEQTSSNSSNKQASGCWDWFETEHRARGT---------------------------GEVVSLKQ   95 (231)
T ss_pred             HHHHHHCCE---EEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---------------------------CCHHHHHH
T ss_conf             889855896---886142027666542345565777755567777---------------------------65278999


Q ss_pred             HHHHHHH--HCCE---EEEEECCCCCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCC
Q ss_conf             9999863--5583---9998247654565641366556678868779999999978132
Q gi|254780633|r  127 VSTEARM--RFSM---LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL  180 (267)
Q Consensus       127 a~~~l~~--~~~~---~~~~~~~~~~~~~~~~~~~~~~~~g~HAge~ETS~~lal~Pel  180 (267)
                      .+..++.  .|.+   .+++.                   |.=||-.||++|++.+||-
T Consensus        96 li~~~~~~~~~~IDP~rvyvT-------------------GLSaGGgmT~V~~~t~Pdv  135 (231)
T TIGR01840        96 LIDAVKADTNYSIDPNRVYVT-------------------GLSAGGGMTAVLGATYPDV  135 (231)
T ss_pred             HHHHHHCCCCCCCCCCEEEEE-------------------EECCHHHHHHHHHHCCCCH
T ss_conf             999973477886388545884-------------------2142389999887405635


No 60 
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars. Nucleotidyltransferases transfer nucleotides onto phosphosugars.  The enzyme family includes Alpha-D-Glucose-1-Phosphate Cytidylyltransferase, Mannose-1-phosphate guanyltransferase, and Glucose-1-phosphate thymidylyltransferase. The products are activated sugars that are precursors for synthesis of lipopolysaccharide, glycolipids and polysaccharides.
Probab=29.21  E-value=43  Score=14.57  Aligned_cols=33  Identities=18%  Similarity=0.294  Sum_probs=23.3

Q ss_pred             ECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             309999999999999999974998899973987867
Q gi|254780633|r   86 TLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        86 sl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      .+...++   +.-+++.|...|+++|+|+.+|.++.
T Consensus        25 ~v~gkpl---I~~~l~~l~~~g~~~iiiv~~~~~~~   57 (217)
T cd04181          25 PIAGKPI---LEYIIERLARAGIDEIILVVGYLGEQ   57 (217)
T ss_pred             EECCCHH---HHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             8999449---99999999974997799986123310


No 61 
>pfam07338 DUF1471 Protein of unknown function (DUF1471). This family consists of several hypothetical Enterobacterial proteins of around 90 residues in length. Some members of this family are annotated as ydgH precursors and contain two copies of this region, one at the N-terminus and the other at the C-terminus. The function of this family is unknown.
Probab=28.88  E-value=44  Score=14.53  Aligned_cols=36  Identities=17%  Similarity=0.174  Sum_probs=28.1

Q ss_pred             CCEECCH--HHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             7333099--99999999999999974998899973987
Q gi|254780633|r   83 GTKTLTY--AEAIEHWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        83 GTisl~~--~t~~~~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      ||||++.  .+..++-.+|.+.--..|-+.+.|+..++
T Consensus        15 G~ISvsg~~~s~~d~~~~la~kAd~~GA~~y~Ii~~~~   52 (66)
T pfam07338        15 GTISVSGAFGSPSDAEAALAKKADAKGAKYYRIISARE   52 (66)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             08999056599899999999999986998899998235


No 62 
>KOG3349 consensus
Probab=28.86  E-value=44  Score=14.53  Aligned_cols=76  Identities=18%  Similarity=0.209  Sum_probs=39.8

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEEECCCCCCCHHHHCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             99999999749988999739878678999999998635583999824765456564136655667886877999999997
Q gi|254780633|r   97 LAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL  176 (267)
Q Consensus        97 ~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~HAge~ETS~~lal  176 (267)
                      .+.+..|.++||+|++|=-|-| | .....-++..+...++.+-..++.... ...+.+ ... .-+|||..----.|.+
T Consensus        25 ~~~~~~L~k~G~~kLiiQ~Grg-~-~~~~d~~~~~~k~~gl~id~y~f~psl-~e~I~~-Adl-VIsHAGaGS~letL~l   99 (170)
T KOG3349          25 EEFLQELQKRGFTKLIIQIGRG-Q-PFFGDPIDLIRKNGGLTIDGYDFSPSL-TEDIRS-ADL-VISHAGAGSCLETLRL   99 (170)
T ss_pred             HHHHHHHHHCCCCEEEEEECCC-C-CCCCCHHHHHCCCCCEEEEEEECCCCH-HHHHHH-CCE-EEECCCCCHHHHHHHC
T ss_conf             9999999973963899873588-6-478987775012487589877338417-888753-458-8745874209999974


Q ss_pred             C
Q ss_conf             8
Q gi|254780633|r  177 A  177 (267)
Q Consensus       177 ~  177 (267)
                      .
T Consensus       100 ~  100 (170)
T KOG3349         100 G  100 (170)
T ss_pred             C
T ss_conf             9


No 63 
>PRK11281 potassium efflux protein KefA; Provisional
Probab=28.77  E-value=44  Score=14.52  Aligned_cols=25  Identities=28%  Similarity=0.149  Sum_probs=12.2

Q ss_pred             EECCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             4144307999999999999999999
Q gi|254780633|r  224 VGNAMDATVKKGEGLLSYFANCFIQ  248 (267)
Q Consensus       224 ~GdP~~At~E~G~~~~~~~v~~l~~  248 (267)
                      +|=+..++.++-++++-.++++--.
T Consensus       999 vgvaygsD~~~v~~ll~~~a~~~~~ 1023 (1107)
T PRK11281        999 VGVAYGSDLEKVRKLLLQAATENPR 1023 (1107)
T ss_pred             ECCCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             1566688889999999999873921


No 64 
>PRK10172 phosphoanhydride phosphorylase; Provisional
Probab=28.09  E-value=45  Score=14.44  Aligned_cols=85  Identities=12%  Similarity=0.022  Sum_probs=43.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCC--HH--------H-CCC---CCCEECCHHHHHHHHHHHHH
Q ss_conf             7465226789999999999983566773999140232678--01--------1-368---87333099999999999999
Q gi|254780633|r   36 PHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS--IE--------H-MYV---DGTKTLTYAEAIEHWLAIID  101 (267)
Q Consensus        36 pHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s--~~--------h-~~f---pGTisl~~~t~~~~l~di~~  101 (267)
                      -+.|+++-+-+++.+.-+-++-         +|-+.+|.-  ..        | ..|   -.+-.+-...-..+|..|..
T Consensus       229 l~G~l~las~l~e~flLqy~eG---------~P~vawG~i~t~~~~~~L~~L~n~~~d~l~r~P~vAr~~a~pLl~~I~~  299 (432)
T PRK10172        229 LSGAVSLASTLTEIFLLQQAQG---------MPEPGWGRITDSHQWNTLLSLHNAQFYLLQRTPEVARSRATPLLDLIDT  299 (432)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCC---------CCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
T ss_conf             3244888877999999985328---------8600137889899999999999999998706768887520799999999


Q ss_pred             HHHHCCC----------CEEEEECCCCCCHHHHHHHHH
Q ss_conf             9997499----------889997398786789999999
Q gi|254780633|r  102 AIRKMGI----------RKIVILNAHGGNSPLVSIVST  129 (267)
Q Consensus       102 sl~~~Gf----------~~iviiNgHgGN~~~l~~a~~  129 (267)
                      .|..++-          .|++++-||-.|++.+..+..
T Consensus       300 aL~~~~~~~~~~~~~~~~kll~lvGHDTNIA~L~~lLg  337 (432)
T PRK10172        300 ALTPHPAQKQAYGITLPTSVLFIAGHDTNLANLGGALE  337 (432)
T ss_pred             HHHCCCCCCCCCCCCCCCEEEEEEECCCCHHHHHHHHC
T ss_conf             87236654455677878428999604662999999858


No 65 
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU. The N-terminal domain of N-Acetylglucosamine-1-phosphate uridyltransferase (GlmU). GlmU is an essential bacterial enzyme with both an acetyltransferase and an uridyltransferase activity which have been mapped to the C-terminal and N-terminal domains, respectively. This family represents the N-terminal uridyltransferase. GlmU performs the last two steps in the synthesis of UDP-N-acetylglucosamine (UDP-GlcNAc), which is an essential precursor in both the peptidoglycan and the lipopolysaccharide metabolic pathways in Gram-positive and Gram-negative bacteria, respectively.
Probab=27.94  E-value=45  Score=14.43  Aligned_cols=25  Identities=32%  Similarity=0.585  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             9999999999749988999739878
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      ++.-+++.+.+.|+++|+|+.||..
T Consensus        28 ii~~ii~~l~~~gi~~i~iv~~~~~   52 (229)
T cd02540          28 MLEHVLDAARALGPDRIVVVVGHGA   52 (229)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCH
T ss_conf             9999999999769975996357689


No 66 
>PRK00075 cbiD cobalt-precorrin-6A synthase; Reviewed
Probab=27.78  E-value=46  Score=14.41  Aligned_cols=119  Identities=13%  Similarity=0.212  Sum_probs=70.4

Q ss_pred             EECCCCCCCCCCCCHHHHHHH--HHH-HHHHHHHCCCCCEEEEECCCCCCCC------HHHCCCCCCEE----------C
Q ss_conf             320012479746522678999--999-9999983566773999140232678------01136887333----------0
Q gi|254780633|r   27 PLGAYEQHGPHLPMNTDTIIA--AGL-AERIKSILPPRLPVTCMPVEPIGYS------IEHMYVDGTKT----------L   87 (267)
Q Consensus        27 PvGs~EqHGpHlPlgtD~~~a--~~i-a~~~a~~~~~~~~~~v~P~i~yG~s------~~h~~fpGTis----------l   87 (267)
                      -||-+-.-|.-+|.|--.+.+  +.+ .+.+.+.++...++.|.=.+|=|--      ....+--|-||          +
T Consensus       106 GVG~VTkpGL~~~vGepAINpvPR~mI~~~v~~~~~~~~g~~V~IsvP~Ge~lAkkT~NprLGI~GGISILGTTGiV~P~  185 (366)
T PRK00075        106 GVGTVTRPGLGLPVGEPAINPVPRRMIEENLREALPGGRGAEVTISVPEGEELAKKTLNPRLGIVGGISILGTTGIVEPM  185 (366)
T ss_pred             EEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHCCCHHCCCCCCEEECCCCEEEEEC
T ss_conf             46899137867999974249889999999999983879978999983747878674320431865675640264478747


Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEEECCCCCCC
Q ss_conf             99999999999999999749988999739878678999999998635583999824765456
Q gi|254780633|r   88 TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTI  149 (267)
Q Consensus        88 ~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~~~~~~~~~  149 (267)
                      +.+.+.+-+..-+......|+++++|+.|.-|    .+.+.+.+.......+..-+|..+..
T Consensus       186 S~~a~~~si~~~l~va~a~g~~~vvl~~G~~g----e~~a~~~~~lp~~~~V~~gnfiG~~L  243 (366)
T PRK00075        186 SCPAYLASIRQELDVARANGLDHVVLVTGNNG----EDFARELFGLPEDAIIKMGNFVGPAL  243 (366)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCEEEECCCCHH----HHHHHHHHCCCHHHEEEEEHHHHHHH
T ss_conf             86999999999999999779886999568079----99999860988689798415079999


No 67 
>COG0062 Uncharacterized conserved protein [Function unknown]
Probab=27.36  E-value=47  Score=14.36  Aligned_cols=44  Identities=16%  Similarity=0.169  Sum_probs=30.1

Q ss_pred             HHHHHHHCC-CCEEEEECCCCCCHHHHHHHHHHHHHHC-CEEEEEE
Q ss_conf             999999749-9889997398786789999999986355-8399982
Q gi|254780633|r   99 IIDAIRKMG-IRKIVILNAHGGNSPLVSIVSTEARMRF-SMLVVST  142 (267)
Q Consensus        99 i~~sl~~~G-f~~iviiNgHgGN~~~l~~a~~~l~~~~-~~~~~~~  142 (267)
                      .+...+..| .++++++-|+|.|-.---.++|.|.... ...++..
T Consensus        39 ~i~~~~~~~~~~~v~vlcG~GnNGGDG~VaAR~L~~~G~~V~v~~~   84 (203)
T COG0062          39 AILREYPLGRARRVLVLCGPGNNGGDGLVAARHLKAAGYAVTVLLL   84 (203)
T ss_pred             HHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             9998768556877999988998627899999999867984699970


No 68 
>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins. Thiamine pyrophosphate (TPP family), pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate (SEPHCHC) synthase (MenD) subfamily. The PYR domain is found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor. TPP binds in the cleft formed by a PYR domain and a PP domain. The PYR domain, binds the aminopyrimidine ring of TPP, the PP domain binds the diphosphate residue. The PYR and PP domains have a common fold, but do not share strong sequence conservation. The PP domain is not included in this sub-family. Most TPP-dependent enzymes have the PYR and PP domains on the same subunit although these domains can be alternatively arranged in the primary structure. TPP-dependent enzymes are multisubunit proteins, the smallest catalytic unit being a dim
Probab=27.33  E-value=47  Score=14.36  Aligned_cols=29  Identities=24%  Similarity=0.628  Sum_probs=19.1

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             999999974998899973987867899999
Q gi|254780633|r   98 AIIDAIRKMGIRKIVILNAHGGNSPLVSIV  127 (267)
Q Consensus        98 di~~sl~~~Gf~~iviiNgHgGN~~~l~~a  127 (267)
                      .+++.|..+|+++++.+-|. .|.+.++.+
T Consensus         2 Alv~~L~~~GV~~vFg~pG~-~~~~l~~a~   30 (162)
T cd07037           2 ALVEELKRLGVRDVVISPGS-RSAPLALAA   30 (162)
T ss_pred             HHHHHHHHCCCCEEEECCCC-CHHHHHHHH
T ss_conf             68999998799999990770-289999999


No 69 
>TIGR01383 not_thiJ DJ-1 family protein; InterPro: IPR006287    These sequences represent the DJ-1 clade of the so-called ThiJ/PfpI family of proteins. PfpI, represented by IPR006286 from INTERPRO, is a putative intracellular cysteine protease. DJ-1 is described as an oncogene that acts cooperatively with H-Ras . Many members of the DJ-1 clade are annotated (apparently incorrectly) as ThiJ (thiamine pyridinylase), a protein of thiamine biosynthesis. However, published reports of ThiJ activity and identification of a ThiJ/ThiD bifunctional protein describe an unrelated locus mapping near ThiM, rather than the DJ-1 homolog of Escherichia coli. The ThiJ designation for this family may be spurious; the cited paper  refers to a locus near thiD and thiM in E. coli, unlike the gene represented here. Current public annotation reflects ThiJ/ThiD bifunctional activity, apparently a property of ThiD and not of this locus.   This group of proteins are classified as either DJ-1 putative peptidases or non-peptidase homologs in MEROPS peptidase family C56 (clan PC(C)). .
Probab=26.40  E-value=48  Score=14.25  Aligned_cols=35  Identities=11%  Similarity=0.215  Sum_probs=27.7

Q ss_pred             CCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCC
Q ss_conf             677399914023267801136887333099999999999999999749
Q gi|254780633|r   60 PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMG  107 (267)
Q Consensus        60 ~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~G  107 (267)
                      +..+++|||-          ++||.-.|+.++   .|.++++++.+.|
T Consensus        65 ~~fD~ivLPG----------G~pGa~nL~~S~---~l~~~lk~~~~~g   99 (186)
T TIGR01383        65 EEFDLIVLPG----------GMPGAENLRDSK---LLENLLKKQESKG   99 (186)
T ss_pred             CCCCEEEECC----------CCHHHHHHHCCH---HHHHHHHHHHHCC
T ss_conf             7767789369----------822666420257---8999999999749


No 70 
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium). The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes like osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-inte
Probab=26.28  E-value=22  Score=16.40  Aligned_cols=17  Identities=35%  Similarity=0.784  Sum_probs=11.4

Q ss_pred             HHHHHHCCCCCCCCCCC
Q ss_conf             99999585300266667
Q gi|254780633|r  250 LNDINSFDVSIFDKDVQ  266 (267)
Q Consensus       250 i~e~~~~~~~~~~~~~~  266 (267)
                      |.++..|+|++.|+|+|
T Consensus        35 l~d~~~f~LKYlDDd~E   51 (82)
T cd06407          35 LDDMSAFDLKYLDDDEE   51 (82)
T ss_pred             CCCCCCEEEEEECCCCC
T ss_conf             14567255799858898


No 71 
>PRK08419 lipid A biosynthesis lauroyl acyltransferase; Reviewed
Probab=25.67  E-value=50  Score=14.17  Aligned_cols=30  Identities=30%  Similarity=0.294  Sum_probs=19.4

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             9999999749988999739878678999999
Q gi|254780633|r   98 AIIDAIRKMGIRKIVILNAHGGNSPLVSIVS  128 (267)
Q Consensus        98 di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~  128 (267)
                      +.+......| +-+|++.+|.||...+..+.
T Consensus       105 e~l~~a~~~g-kgvI~lt~H~gnwE~~~~~l  134 (301)
T PRK08419        105 EFLLDALKEK-RPIIVTTAHYGYWELVSLAL  134 (301)
T ss_pred             HHHHHHHHCC-CCEEEEEECCCCHHHHHHHH
T ss_conf             9999999769-98899960779989999999


No 72 
>PRK04946 hypothetical protein; Provisional
Probab=25.59  E-value=50  Score=14.16  Aligned_cols=53  Identities=19%  Similarity=0.113  Sum_probs=35.2

Q ss_pred             CCEEC---CHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCE
Q ss_conf             73330---99999999999999999749988999739878678999999998635583
Q gi|254780633|r   83 GTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM  137 (267)
Q Consensus        83 GTisl---~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~  137 (267)
                      .++.|   +.+--...|..-+..-..+|+|-++||.|.|.+  .|+..+..+-.+++.
T Consensus        96 a~LDLHG~t~~eAr~~L~~FI~~a~~~g~RcVlIIhGKG~~--vLK~~v~~WL~~~p~  151 (181)
T PRK04946         96 LFLDLHGLTQLQAKQELGALIAACRKEHVFCACVMHGHGKH--ILKQQTPLWLAQHPD  151 (181)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCC--HHHHHHHHHHCCCCC
T ss_conf             68878999899999999999999998598079999716876--379999999737852


No 73 
>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional
Probab=25.28  E-value=51  Score=14.12  Aligned_cols=26  Identities=15%  Similarity=0.235  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             99999999999749988999739878
Q gi|254780633|r   94 EHWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        94 ~~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      .++.-+++.+...|++.|+||.+++-
T Consensus        40 Pii~~~vee~~~aGI~ei~iV~~~~K   65 (302)
T PRK13389         40 PLIQYVVNECIAAGITEIVLVTHSSK   65 (302)
T ss_pred             EHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             75999999999869978999927984


No 74 
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase; InterPro: IPR012698   Phosphonates are a class of organophosphorus compounds, characterised by a stable C-P bond, which are found in a variety of biologically produced molecules including antiobiotics, lipids, proteins and polysaccharides . The functions of these molecules include phosphorus storage, cell communication, host recognition and chemical warfare. Phosphoenolpyruvate (PEP) phosphomutase catalyses the reversible conversion of PEP to 3-phosphonopyruvate, forming a stable C-P bond, which is the entry point to all known phosphonate biosynthetic pathways .   This entry consists of characterised and predicted PEP phosphomutases found in bacterial and eukayotic species. A closely related enzyme, phosphonopyruvate hydrolase from Variovorax sp. Pal2, is excluded from this entry, and the functional identification of some more distantly related sequences, such as from Bacteroides fragilis, Treponema denticola, and Clostridium tetani E88 is unknown.   PEP phosphomutase forms a modified TIM barrel fold where the eighth alpha helix adopts a different conformation than in the classical TIM barrel fold . The substrate binds in the central channel of the barrel and is anchored to the active site by the Mg(2+) cofactor . In the absence of substrate the active site is acessible to the solvent, while substrate-binding causes a conformational change where a large loop shields the site from solvent . This shielding appears to be required for catalysis to occur.; GO: 0050188 phosphoenolpyruvate mutase activity.
Probab=25.17  E-value=51  Score=14.11  Aligned_cols=19  Identities=16%  Similarity=0.023  Sum_probs=11.3

Q ss_pred             CCHHHHHHHHHHHHHHCCE
Q ss_conf             8678999999998635583
Q gi|254780633|r  119 GNSPLVSIVSTEARMRFSM  137 (267)
Q Consensus       119 GN~~~l~~a~~~l~~~~~~  137 (267)
                      ||+.--+.++++++++.-.
T Consensus        83 GNFNnARr~arkle~~Gaa  101 (272)
T TIGR02320        83 GNFNNARRLARKLEDRGAA  101 (272)
T ss_pred             CCHHHHHHHHHHHHHCCCC
T ss_conf             7146799999999746863


No 75 
>cd03409 Chelatase_Class_II Class II Chelatase: a family of ATP-independent monomeric or homodimeric enzymes that catalyze the insertion of metal into protoporphyrin rings. This family includes protoporphyrin IX ferrochelatase (HemH), sirohydrochlorin ferrochelatase (SirB) and the cobaltochelatases, CbiK and CbiX. HemH and SirB are involved in heme and siroheme biosynthesis, respectively, while the cobaltochelatases are associated with cobalamin biosynthesis. Excluded from this family are the ATP-dependent heterotrimeric chelatases (class I) and the multifunctional homodimeric enzymes with dehydrogenase and chelatase activities (class III).
Probab=24.34  E-value=53  Score=14.01  Aligned_cols=24  Identities=17%  Similarity=0.243  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             999999999997499889997398
Q gi|254780633|r   94 EHWLAIIDAIRKMGIRKIVILNAH  117 (267)
Q Consensus        94 ~~l~di~~sl~~~Gf~~iviiNgH  117 (267)
                      ..+.|.+++|...|.++|+++--.
T Consensus        45 P~i~eai~~l~~~G~~~ivvvP~~   68 (101)
T cd03409          45 PDTEEAIRELAEEGYQRVVIVPLA   68 (101)
T ss_pred             CCHHHHHHHHHHCCCCEEEEEEEE
T ss_conf             999999999997698679998643


No 76 
>KOG1515 consensus
Probab=23.89  E-value=54  Score=13.96  Aligned_cols=100  Identities=13%  Similarity=0.109  Sum_probs=59.9

Q ss_pred             EEEEECCCC---------CCCCCCCCHH-HHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHH
Q ss_conf             999320012---------4797465226-789999999999983566773999140232678011368873330999999
Q gi|254780633|r   24 VVLPLGAYE---------QHGPHLPMNT-DTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAI   93 (267)
Q Consensus        24 vilPvGs~E---------qHGpHlPlgt-D~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~   93 (267)
                      +.+|..+.+         =||=--.+|+ .+-.=..+|.+.|+.+    +++|. .+-|--+|+|. ||....-....+.
T Consensus        78 ly~P~~~~~~~~~p~lvyfHGGGf~~~S~~~~~y~~~~~~~a~~~----~~vvv-SVdYRLAPEh~-~Pa~y~D~~~Al~  151 (336)
T KOG1515          78 LYRPTSSSSETKLPVLVYFHGGGFCLGSANSPAYDSFCTRLAAEL----NCVVV-SVDYRLAPEHP-FPAAYDDGWAALK  151 (336)
T ss_pred             EECCCCCCCCCCCEEEEEEECCCCEECCCCCCHHHHHHHHHHHHC----CEEEE-ECCCCCCCCCC-CCCCCHHHHHHHH
T ss_conf             972777775567608999968802768788733678999999775----92999-33764289998-9854147999999


Q ss_pred             HHHHHHHHHH-HHCCCCEEEEECCC-CCCHHHHHHHHHHHHH
Q ss_conf             9999999999-97499889997398-7867899999999863
Q gi|254780633|r   94 EHWLAIIDAI-RKMGIRKIVILNAH-GGNSPLVSIVSTEARM  133 (267)
Q Consensus        94 ~~l~di~~sl-~~~Gf~~iviiNgH-gGN~~~l~~a~~~l~~  133 (267)
                      -++...  ++ ....++|++|...- |||++.  .+++++..
T Consensus       152 w~~~~~--~~~~~~D~~rv~l~GDSaGGNia~--~va~r~~~  189 (336)
T KOG1515         152 WVLKNS--WLKLGADPSRVFLAGDSAGGNIAH--VVAQRAAD  189 (336)
T ss_pred             HHHHHH--HHHHCCCCCCEEEECCCCCHHHHH--HHHHHHHH
T ss_conf             999757--998589966189983586489999--99999864


No 77 
>COG0533 QRI7 Metal-dependent proteases with possible chaperone activity [Posttranslational modification, protein turnover, chaperones]
Probab=23.51  E-value=55  Score=13.91  Aligned_cols=21  Identities=29%  Similarity=0.491  Sum_probs=9.7

Q ss_pred             HHHHHCCCCEEEEECCCCCCH
Q ss_conf             999974998899973987867
Q gi|254780633|r  101 DAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus       101 ~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      +.|.+.|++++++..|=.-|.
T Consensus       255 rAl~~~~~~~lvi~GGVaaN~  275 (342)
T COG0533         255 RALKHTGKKELVIAGGVAANS  275 (342)
T ss_pred             HHHHHHCCCEEEEECCHHHHH
T ss_conf             999980999899935587759


No 78 
>COG3395 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.16  E-value=56  Score=13.87  Aligned_cols=10  Identities=20%  Similarity=0.481  Sum_probs=6.8

Q ss_pred             EEEEECCCCC
Q ss_conf             3999140232
Q gi|254780633|r   63 PVTCMPVEPI   72 (267)
Q Consensus        63 ~~~v~P~i~y   72 (267)
                      ..++.|.+|-
T Consensus       108 ~avv~PA~P~  117 (413)
T COG3395         108 IAVVVPALPL  117 (413)
T ss_pred             CEEEECCCCC
T ss_conf             2697257667


No 79 
>TIGR01512 ATPase-IB2_Cd cadmium-translocating P-type ATPase; InterPro: IPR006404   These sequences describe the P-type ATPase primarily responsible for translocating cadmium ions (and other closely-related divalent heavy metals such as cobalt, mercury, lead and zinc) across biological membranes. These transporters are found in prokaryotes and plants. Experimentally characterised members include P37617 from SWISSPROT from Escherichia coli, Q10866 from SWISSPROT from Mycobacterium tuberculosis and Q59998 from SWISSPROT from Synechocystis PCC6803. The cadmium P-type ATPases have been characterised as Type IB based on a phylogenetic analysis which combines the copper-translocating ATPases with the cadmium-translocating species . This family and that describing the copper-ATPases (IPR006403 from INTERPRO) are well separated, and thus the copper-ATPases can be typed as IB1 and the cadmium-ATPases as IB2. ; GO: 0005524 ATP binding, 0016818 hydrolase activity acting on acid anhydrides in phosphorus-containing anhydrides, 0046872 metal ion binding, 0046873 metal ion transmembrane transporter activity, 0030001 metal ion transport, 0016020 membrane.
Probab=23.16  E-value=56  Score=13.87  Aligned_cols=97  Identities=18%  Similarity=0.178  Sum_probs=59.8

Q ss_pred             ECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEE-ECCCCCCCC------HHHCCCCCCEECCHHHHHHHHHHHH
Q ss_conf             200124797465226789999999999983566773999-140232678------0113688733309999999999999
Q gi|254780633|r   28 LGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC-MPVEPIGYS------IEHMYVDGTKTLTYAEAIEHWLAII  100 (267)
Q Consensus        28 vGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v-~P~i~yG~s------~~h~~fpGTisl~~~t~~~~l~di~  100 (267)
                      +.|.|||-.|       -+|++|.++-+ .-++...+.+ -=.+..|..      .-+-.+-|-|.++.+ ...=-.+.+
T Consensus       264 aaa~E~~S~H-------PlA~AIv~~~e-~pG~G~~a~~~g~~v~~G~~~t~~~v~~~~~~~G~i~l~D~-~R~~a~~ai  334 (494)
T TIGR01512       264 AAAAEQQSSH-------PLARAIVAAEE-VPGEGVKAVVDGEEVRIGNKRTLVLVAVDGKLIGVILLSDE-LRPEAAEAI  334 (494)
T ss_pred             HHHHHHCCCC-------HHHHHHHHHHH-CCCCCEEEEECCEEEEEECCCCEEEEEECCEEEEEEEEECC-CCHHHHHHH
T ss_conf             9997310668-------68999997420-47774489995779999737658999985849999997335-662279999


Q ss_pred             HHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             99997499889997398786789999999986355
Q gi|254780633|r  101 DAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF  135 (267)
Q Consensus       101 ~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~  135 (267)
                      +.|.++|.+++++++|  -|...-+.+++++..++
T Consensus       335 ~~L~~~G~~~~~mLTG--D~~~~A~~vA~~lGd~v  367 (494)
T TIGR01512       335 AELKALGVKKIVMLTG--DRRAVAEAVAAELGDEV  367 (494)
T ss_pred             HHHHHCCCCCCHHCCC--CCHHHHHHHHHHCCCEE
T ss_conf             9998616300010148--84899999998739102


No 80 
>PRK08905 lipid A biosynthesis lauroyl acyltransferase; Validated
Probab=23.14  E-value=56  Score=13.86  Aligned_cols=40  Identities=20%  Similarity=0.295  Sum_probs=26.1

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             99999997499889997398786789999999986355839998
Q gi|254780633|r   98 AIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS  141 (267)
Q Consensus        98 di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~  141 (267)
                      +.+..+...| |-++++.+|-||...+.   ..+...++..++.
T Consensus        94 e~l~~a~~~g-kgvi~l~~H~gnwE~~~---~~~~~~~~~~~iy  133 (278)
T PRK08905         94 EHVEQALAEG-RGILFLTPHLGCFEILA---RYIARQFPLTVMF  133 (278)
T ss_pred             HHHHHHHHCC-CCEEEEECCCCHHHHHH---HHHHHCCCEEEEE
T ss_conf             9999999769-98899966766799999---9999439827998


No 81 
>cd01846 fatty_acyltransferase_like Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
Probab=22.95  E-value=56  Score=13.84  Aligned_cols=49  Identities=14%  Similarity=0.148  Sum_probs=28.2

Q ss_pred             CCCCCCCHHHCC--CCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             023267801136--8873330999999999999999997499889997398
Q gi|254780633|r   69 VEPIGYSIEHMY--VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH  117 (267)
Q Consensus        69 ~i~yG~s~~h~~--fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH  117 (267)
                      .++.|.......  .+-+..--....++-+...++.|+..|.|+|+++|--
T Consensus       104 ~v~iG~ND~~~~~~~~~~~~~~~~~~v~~~~~~i~~L~~~Gar~~~v~~~p  154 (270)
T cd01846         104 AIWIGANDLLNALDLPQNPDTLVTRAVDNLFQALQRLYAAGARNFLVLNLP  154 (270)
T ss_pred             EEEECCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             998230888877506777889999999999999999998498589980899


No 82 
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed
Probab=22.78  E-value=57  Score=13.82  Aligned_cols=92  Identities=17%  Similarity=0.224  Sum_probs=48.0

Q ss_pred             HHHHHHHHHHHHCCCCC--EEEEECCCCCC-CCHHHCCCCC--------CEECCHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             99999999998356677--39991402326-7801136887--------3330999999999999999997499889997
Q gi|254780633|r   46 IAAGLAERIKSILPPRL--PVTCMPVEPIG-YSIEHMYVDG--------TKTLTYAEAIEHWLAIIDAIRKMGIRKIVIL  114 (267)
Q Consensus        46 ~a~~ia~~~a~~~~~~~--~~~v~P~i~yG-~s~~h~~fpG--------Tisl~~~t~~~~l~di~~sl~~~Gf~~ivii  114 (267)
                      .-+.||+++.+...+..  .+.+.-|+++. +|.-+=.|.|        -..|+.+    =+..-++.+.+.||++|+++
T Consensus        52 ~lE~ma~~A~~lt~~~fG~~I~LfaPLYlSN~C~N~C~YCGf~~~N~i~R~~Ls~e----EI~~E~~ai~~~G~k~ILLv  127 (371)
T PRK09240         52 YLEEMAQRAQALTRQRFGNTISLYTPLYLSNLCANDCTYCGFSMSNKIKRKTLDEE----EIEREMAAIKKLGFEHILLV  127 (371)
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCEECCCCCCCCCCCCCCCHH----HHHHHHHHHHHCCCCEEEEE
T ss_conf             99999999999999873985899850440222177887589867787630028999----99999999997695238854


Q ss_pred             CCCCCC---HHHHHHHHHHHHHHCCEEEEE
Q ss_conf             398786---789999999986355839998
Q gi|254780633|r  115 NAHGGN---SPLVSIVSTEARMRFSMLVVS  141 (267)
Q Consensus       115 NgHgGN---~~~l~~a~~~l~~~~~~~~~~  141 (267)
                      .|-.-.   ..-+..+++.++..+....+.
T Consensus       128 tGE~~~~~~~~Yi~~~v~~ik~~f~~v~ie  157 (371)
T PRK09240        128 TGEHEAKVGVDYIRRALPLAREYFSSVAIE  157 (371)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
T ss_conf             057877698899999999999756740799


No 83 
>KOG3655 consensus
Probab=22.53  E-value=57  Score=13.79  Aligned_cols=25  Identities=24%  Similarity=0.353  Sum_probs=19.5

Q ss_pred             HHHCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             9974998899973987867899999
Q gi|254780633|r  103 IRKMGIRKIVILNAHGGNSPLVSIV  127 (267)
Q Consensus       103 l~~~Gf~~iviiNgHgGN~~~l~~a  127 (267)
                      ....|+.||||||+-|-+.+.++.+
T Consensus        72 D~~s~l~KfvLI~W~GE~vp~~Rka   96 (484)
T KOG3655          72 DPMSGLPKFVLINWIGEGVPVLRKA   96 (484)
T ss_pred             CCCCCCCCEEEEEECCCCCHHHHHH
T ss_conf             7656776569997327765777654


No 84 
>pfam00456 Transketolase_N Transketolase, thiamine diphosphate binding domain. This family includes transketolase enzymes EC:2.2.1.1. and also partially matches to 2-oxoisovalerate dehydrogenase beta subunit EC:1.2.4.4. Both these enzymes utilize thiamine pyrophosphate as a cofactor, suggesting there may be common aspects in their mechanism of catalysis.
Probab=22.21  E-value=58  Score=13.75  Aligned_cols=91  Identities=14%  Similarity=0.170  Sum_probs=52.9

Q ss_pred             CCCCCHHHCCCCC--------------CEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHC-
Q ss_conf             3267801136887--------------3330999999999999999997499889997398786789999999986355-
Q gi|254780633|r   71 PIGYSIEHMYVDG--------------TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF-  135 (267)
Q Consensus        71 ~yG~s~~h~~fpG--------------Tisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~-  135 (267)
                      -=|.+.+-+.+.|              -|+++..|=.....|+..-+...|+.-+-+.+||  |...+..+..+.+... 
T Consensus       157 ~EG~~~EA~~~Ag~~~L~nLi~i~D~N~iqidG~t~~~~~ed~~~rf~a~GW~v~~v~DGh--D~~~I~~Ai~~Ak~~~~  234 (333)
T pfam00456       157 MEGVSSEASSLAGHLKLGNLIAFYDDNRISIDGETEISFTEDTAKRFEAYGWHVIEVEDGH--DVEAIAAAIEEAKAEKD  234 (333)
T ss_pred             CCHHHHHHHHHHHHCCCCCEEEEECCCCEECCCCCCCCCCCHHHHHHHHCCCEEEEECCCC--CHHHHHHHHHHHHHCCC
T ss_conf             5398999999998717897899974575421798453555109999876490799946999--99999999999986589


Q ss_pred             -CEEEEEECCCCCCCHHHHCCCCCCCCCCCCCHH
Q ss_conf             -839998247654565641366556678868779
Q gi|254780633|r  136 -SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEI  168 (267)
Q Consensus       136 -~~~~~~~~~~~~~~~~~~~~~~~~~~g~HAge~  168 (267)
                       +..++.-+--...     .+..+....+|+...
T Consensus       235 kPt~Ii~~TiiGkG-----~p~~eg~~~~HG~pl  263 (333)
T pfam00456       235 KPTLIICRTVIGYG-----SPNKQGTHDVHGAPL  263 (333)
T ss_pred             CCEEEEEEEEEECC-----CCCCCCCCCCCCCCC
T ss_conf             98169864215158-----844467876568888


No 85 
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins. Thiamine pyrophosphate (TPP family), pyrimidine (PYR) binding domain of  pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) subfamily. The PYR domain is found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor. TPP binds in the cleft formed by a PYR domain and a PP domain. The PYR domain, binds the aminopyrimidine ring of TPP, the PP domain binds the diphosphate residue. The PYR and PP domains have a common fold, but do not share strong sequence conservation. The PP domain is not included in this sub-family. Most TPP-dependent enzymes have the PYR and PP domains on the same subunit although these domains can be alternatively arranged in the primary structure. TPP-dependent enzymes are multisubunit proteins, the smallest catalytic unit being a dimer-of-active sites, for many 
Probab=22.17  E-value=58  Score=13.74  Aligned_cols=29  Identities=14%  Similarity=0.516  Sum_probs=20.8

Q ss_pred             HHHHHHHCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             999999749988999739878678999999
Q gi|254780633|r   99 IIDAIRKMGIRKIVILNAHGGNSPLVSIVS  128 (267)
Q Consensus        99 i~~sl~~~Gf~~iviiNgHgGN~~~l~~a~  128 (267)
                      |++.|..+|+++++-+-| +.|.+.++...
T Consensus         3 i~~~L~~~GV~~vFgvpG-~~~~~l~dal~   31 (162)
T cd07038           3 LLERLKQLGVKHVFGVPG-DYNLPLLDAIE   31 (162)
T ss_pred             HHHHHHHCCCCEEEECCC-HHHHHHHHHHH
T ss_conf             799999879999998686-64899999998


No 86 
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; InterPro: IPR012691    This entry represents a subset of the DapA (dihydrodipicolinate synthase) family which has apparently evolved a separate function. The product of DapA, dihydrodipicolinate, results from the non-enzymatic cyclization and dehydration of 6-amino-2,4-dihydroxyhept-2-ene-1,7-dioic acid, which is different from the substrate of this reaction only in the presence of the amino group. In the absence of this amino group, and running the reaction in the opposite direction, the reaction corresponds to the HpaI aldolase component of the 4-hydroxyphenylacetic acid catabolism pathway (see IPR012689 from INTERPRO). At present, this variant of DapA is found only in Oceanobacillus iheyensis HTE831 and Thermus thermophilus HB27. In both of these cases, one or more other DapA genes can be found and the members of this family are found in the operon for 4-hydroxyphenylacetic acid catabolism.; GO: 0008840 dihydrodipicolinate synthase activity, 0019877 diaminopimelate biosynthetic process, 0005737 cytoplasm.
Probab=22.16  E-value=58  Score=13.74  Aligned_cols=48  Identities=19%  Similarity=0.250  Sum_probs=26.2

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEEECCCC--CCHHHHHHHHHHHHHHCCEEE
Q ss_conf             9999999999999999974998899973987--867899999999863558399
Q gi|254780633|r   88 TYAEAIEHWLAIIDAIRKMGIRKIVILNAHG--GNSPLVSIVSTEARMRFSMLV  139 (267)
Q Consensus        88 ~~~t~~~~l~di~~sl~~~Gf~~iviiNgHg--GN~~~l~~a~~~l~~~~~~~~  139 (267)
                      .+|.+.++-.++++|.-.--   |+|-|==|  |+.-..+.++| |+.+++..+
T Consensus       110 NQE~LY~~F~~VA~~VPD~P---~~IYNIPGR~~~~~~~KT~~R-L~~D~PNIV  159 (294)
T TIGR02313       110 NQEALYDYFKEVADAVPDIP---LLIYNIPGRAAVEIEVKTVAR-LVKDFPNIV  159 (294)
T ss_pred             CHHHHHHHHHHHHHHCCCCC---EEEECCCCCCCCCCCHHHHHH-HHHCCCCCC
T ss_conf             75678999999975238975---788528885434112145555-542177511


No 87 
>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs. This group includes the ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs. Qymf is a strict anaerobe that could be grown in the presence of borax and its cells are straight rods that produce endospores. This group is a member of the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription
Probab=22.14  E-value=58  Score=13.74  Aligned_cols=37  Identities=8%  Similarity=0.064  Sum_probs=25.0

Q ss_pred             CCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             68873330999999999999999997499889997398786
Q gi|254780633|r   80 YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        80 ~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      .+| +|..+...-   ....++-|..+|.|||.+++++-..
T Consensus        88 ~~~-~V~~Dn~~~---~~~a~~~L~~~Ghr~I~~i~~~~~~  124 (265)
T cd06291          88 NIP-IVSSDNYEG---GRLAAEELIERGCKHIAHIGGPNNT  124 (265)
T ss_pred             CCC-EEEECHHHH---HHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             999-899776999---9999999997399649999668888


No 88 
>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism]
Probab=22.01  E-value=59  Score=13.72  Aligned_cols=16  Identities=44%  Similarity=0.866  Sum_probs=8.1

Q ss_pred             HHCCCCEEEEECCCCCC
Q ss_conf             97499889997398786
Q gi|254780633|r  104 RKMGIRKIVILNAHGGN  120 (267)
Q Consensus       104 ~~~Gf~~iviiNgHgGN  120 (267)
                      .++|.+||+ +.+-||-
T Consensus       160 ~~~~v~~ii-LTASGGp  175 (385)
T COG0743         160 TQKGVKKII-LTASGGP  175 (385)
T ss_pred             CCCCEEEEE-EECCCCC
T ss_conf             567601799-9567887


No 89 
>PRK10259 hypothetical protein; Provisional
Probab=21.91  E-value=59  Score=13.71  Aligned_cols=44  Identities=14%  Similarity=0.039  Sum_probs=35.6

Q ss_pred             HCCCCCCEECC-HHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             13688733309-999999999999999974998899973987867
Q gi|254780633|r   78 HMYVDGTKTLT-YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        78 h~~fpGTisl~-~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      .+.--||||.+ ..++..+=..+...-...|-+-+.|....|+|.
T Consensus        33 ~l~~iG~VSa~gA~tL~~Le~~LA~KA~~aGA~~y~I~sA~g~n~   77 (86)
T PRK10259         33 NMNKIGVVSADGASTLDALEAKLAEKAAAAGASGYSITSATNNNK   77 (86)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCE
T ss_conf             566527998248888689999999999974886589997378971


No 90 
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch. ADP-glucose pyrophosphorylase (glucose-1-phosphate adenylyltransferase) catalyzes a very important step in the biosynthesis of alpha 1,4-glucans (glycogen or starch) in bacteria and plants: synthesis of the activated glucosyl donor, ADP-glucose, from glucose-1-phosphate and ATP.  ADP-glucose pyrophosphorylase is a tetrameric allosterically regulated enzyme. While a homotetramer in bacteria, in plant chloroplasts and amyloplasts, it is a heterotetramer of two different, yet evolutionary related, subunits.  There are a number of conserved regions in the sequence of bacterial and plant ADP-glucose pyrophosphorylase subunits. It is a subfamily of a very diverse glycosy transferase family 2.
Probab=21.73  E-value=59  Score=13.69  Aligned_cols=25  Identities=16%  Similarity=0.145  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             9999999999749988999739878
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      ++.-++..|.++|+++|+++.++-+
T Consensus        32 iId~~l~~l~~~Gi~~i~i~~~y~~   56 (200)
T cd02508          32 LIDFPLSNMVNSGIRNVGVLTQYKS   56 (200)
T ss_pred             CHHHHHHHHHHCCCCEEEEECCCCH
T ss_conf             0799999887679767998345358


No 91 
>pfam01713 Smr Smr domain. This family includes the Smr (Small MutS Related) proteins, and the C-terminal region of the MutS2 protein. It has been suggested that this domain interacts with the MutS1 protein in the case of Smr proteins and with the N-terminal MutS related region of MutS2.
Probab=21.65  E-value=60  Score=13.68  Aligned_cols=46  Identities=24%  Similarity=0.320  Sum_probs=33.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC--HHHHHHHHHHHH
Q ss_conf             0999999999999999997499889997398786--789999999986
Q gi|254780633|r   87 LTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN--SPLVSIVSTEAR  132 (267)
Q Consensus        87 l~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN--~~~l~~a~~~l~  132 (267)
                      ++.+--...+...+......|.+.+.||.|.|-+  ...|+.+..++-
T Consensus         6 ~~~~eA~~~l~~~i~~~~~~~~~~l~IItGkG~~s~~G~Lr~~v~~~L   53 (82)
T pfam01713         6 LTVEEALDALEDFLDEAWAKGIRCVLIIHGKGLHSKGGVLKSAVREWL   53 (82)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHH
T ss_conf             979999999999999999859978999959888898760999999997


No 92 
>pfam10070 DUF2309 Uncharacterized protein conserved in bacteria (DUF2309). Members of this family of hypothetical bacterial proteins have no known function.
Probab=21.44  E-value=60  Score=13.65  Aligned_cols=37  Identities=22%  Similarity=0.209  Sum_probs=31.7

Q ss_pred             CCEECCHHHHHHHHHHHHHHHHH-CCCCEEEEECCCCC
Q ss_conf             73330999999999999999997-49988999739878
Q gi|254780633|r   83 GTKTLTYAEAIEHWLAIIDAIRK-MGIRKIVILNAHGG  119 (267)
Q Consensus        83 GTisl~~~t~~~~l~di~~sl~~-~Gf~~iviiNgHgG  119 (267)
                      ..+.++.+...++...+++++-= .+|-++|++-|||.
T Consensus       468 ~~~g~t~~e~~~~a~~~Lr~mGLt~~FA~lV~l~GHGS  505 (783)
T pfam10070       468 LPIGLTLEEQVALAEGALRAMGLTDNFAPLVVLVGHGS  505 (783)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCC
T ss_conf             56799989999999999986677657777589951676


No 93 
>COG1182 AcpD Acyl carrier protein phosphodiesterase [Lipid metabolism]
Probab=21.32  E-value=25  Score=16.04  Aligned_cols=58  Identities=14%  Similarity=0.067  Sum_probs=26.6

Q ss_pred             CCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             6677399914023267801136887333099999999999999999749988999739878
Q gi|254780633|r   59 PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        59 ~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      +.+.-++.+|...+.+++....|--.|.....||. |.+.=-.+|.. | ||+++++.-||
T Consensus        87 aAD~vVi~~PM~Nf~iPa~LK~yiD~i~~aGkTFk-Yte~Gp~GLl~-g-KKv~~l~srGG  144 (202)
T COG1182          87 AADKVVIAAPMYNFNIPAQLKAYIDHIAVAGKTFK-YTENGPVGLLT-G-KKVLILTSRGG  144 (202)
T ss_pred             HCCEEEEEECCCCCCCCHHHHHHHHHHHCCCCEEE-ECCCCCCCCCC-C-CEEEEEECCCC
T ss_conf             56869997354145787899988898740794578-53677632437-8-66999977887


No 94 
>cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences. In B. subtilis 168, the regulation of the diaminopimelate (Dap)-lysine biosynthetic pathway involves dual control by Dap and lysine, effected through separate Dap- and lysine-sensitive aspartokinase isoenzymes. The B. subtilis 168 AKII is induced by methionine, and repressed and inhibited by lysine. Although Corynebacterium glutamicum is known to contain a single aspartokinase isoenzyme type, both the succinylase and dehydrogenase variant pathways of DAP-lysine synthesis operate simultaneously in this organism. In this organism and other various Gram-positive bacteria, the DAP-lysine pathway is feedback regulated by the concerted action of lysine and 
Probab=21.19  E-value=61  Score=13.62  Aligned_cols=33  Identities=24%  Similarity=0.564  Sum_probs=15.9

Q ss_pred             HHHHHHCCCCEE--------EEECCCCCCHHHHHHHHHHHH
Q ss_conf             999997499889--------997398786789999999986
Q gi|254780633|r  100 IDAIRKMGIRKI--------VILNAHGGNSPLVSIVSTEAR  132 (267)
Q Consensus       100 ~~sl~~~Gf~~i--------viiNgHgGN~~~l~~a~~~l~  132 (267)
                      ...|.+.|++-.        ++.+++.+|....+.....+.
T Consensus        80 ~~~L~~~G~~a~~~~~~~~~i~t~~~~~~a~i~~~~~~~i~  120 (239)
T cd04261          80 AMALNRLGIKAISLTGWQAGILTDGHHGKARIIDIDPDRIR  120 (239)
T ss_pred             HHHHHHCCCCCEEEEHHHCCEECCCCCHHHHHHHHHHHHHH
T ss_conf             99999769975796866675431575204556889999998


No 95 
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily. Included in this CD are the rhodanese-like domains found C-terminal of the serine/threonine protein kinases catalytic (S_TKc) domain and the Tre-2, BUB2p, Cdc16p (TBC) domain. The putative active site Cys residue is not present in this CD.
Probab=20.80  E-value=62  Score=13.56  Aligned_cols=51  Identities=8%  Similarity=0.188  Sum_probs=26.3

Q ss_pred             CCCCEECCHHHHHHHHHH-----HHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             887333099999999999-----999999749988999739878678999999998635
Q gi|254780633|r   81 VDGTKTLTYAEAIEHWLA-----IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR  134 (267)
Q Consensus        81 fpGTisl~~~t~~~~l~d-----i~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~  134 (267)
                      .||+|.++..+...-..+     -+..|..+. .++|++.++.|+.+.  .+++.|...
T Consensus        33 i~~siniPf~~~~~~~~~L~~~~~~~~Lek~K-gk~VViV~~~g~~a~--~fa~~Lvk~   88 (105)
T cd01525          33 IEGSINIPFSSVFLKEGELEQLPTVPRLENYK-GKIIVIVSHSHKHAA--LFAAFLVKC   88 (105)
T ss_pred             ECCCCCCCCHHHCCCCCCCCCCCCHHHHHHCC-CCEEEEECCCCCCHH--HHHHHHHHC
T ss_conf             12755057302015544221364258999758-982999889986799--999999984


No 96 
>PRK06425 histidinol-phosphate aminotransferase; Validated
Probab=20.67  E-value=39  Score=14.87  Aligned_cols=15  Identities=13%  Similarity=0.317  Sum_probs=8.4

Q ss_pred             HHHCCCCEEEEECCC
Q ss_conf             997499889997398
Q gi|254780633|r  103 IRKMGIRKIVILNAH  117 (267)
Q Consensus       103 l~~~Gf~~iviiNgH  117 (267)
                      +.....+-++|.|=+
T Consensus       118 ~~~~~~~lv~i~nPN  132 (332)
T PRK06425        118 LNNYNFDLIFIVSPD  132 (332)
T ss_pred             HHCCCCCEEEEECCC
T ss_conf             845898989994181


No 97 
>PRK06553 lipid A biosynthesis lauroyl acyltransferase; Provisional
Probab=20.63  E-value=63  Score=13.54  Aligned_cols=31  Identities=32%  Similarity=0.555  Sum_probs=19.1

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             99999997499889997398786789999999
Q gi|254780633|r   98 AIIDAIRKMGIRKIVILNAHGGNSPLVSIVST  129 (267)
Q Consensus        98 di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~  129 (267)
                      |.+..+..+| +-++++.+|.||...+..+..
T Consensus       123 e~l~~a~~~g-kgvIl~~~H~gnwE~~~~~~~  153 (308)
T PRK06553        123 EIFERLRDDG-KPALIFTAHLGNWELLAIAAA  153 (308)
T ss_pred             HHHHHHHHCC-CCEEEEEECCCHHHHHHHHHH
T ss_conf             9999999579-987999746333999999999


No 98 
>COG3309 VapD Uncharacterized virulence-associated protein D [Function unknown]
Probab=20.36  E-value=63  Score=13.51  Aligned_cols=45  Identities=18%  Similarity=0.264  Sum_probs=33.0

Q ss_pred             HHHHHHHHHHHHHHHCCCCEE---EEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             999999999999997499889---997398786789999999986355
Q gi|254780633|r   91 EAIEHWLAIIDAIRKMGIRKI---VILNAHGGNSPLVSIVSTEARMRF  135 (267)
Q Consensus        91 t~~~~l~di~~sl~~~Gf~~i---viiNgHgGN~~~l~~a~~~l~~~~  135 (267)
                      -+..--.||-+-|.+|||.++   |.+|--|-|..+-..+++.+..++
T Consensus        20 ~~~~aY~Dir~~L~~~gF~~tQGSVYl~~~~i~~~~~~~~~q~~~~q~   67 (96)
T COG3309          20 NYRQAYDDIRRVLERHGFENTQGSVYLNDEGINQAAGTLAAQNLAKQF   67 (96)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHHHHHHHH
T ss_conf             088899899999998075224533897520278998899999999985


No 99 
>COG1634 Uncharacterized Rossmann fold enzyme [General function prediction only]
Probab=20.03  E-value=64  Score=13.46  Aligned_cols=28  Identities=29%  Similarity=0.368  Sum_probs=19.8

Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             999997499889997398786789999999
Q gi|254780633|r  100 IDAIRKMGIRKIVILNAHGGNSPLVSIVST  129 (267)
Q Consensus       100 ~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~  129 (267)
                      +.+...+|  .|++|-.||-|.+.+.....
T Consensus       107 ~~~~~~~g--~i~VVHAHGDNi~~i~~~~~  134 (232)
T COG1634         107 LLSCTAKG--SIVVVHAHGDNIWRIPKVVP  134 (232)
T ss_pred             HHHHHCCC--CEEEEEECCCCHHHHHCCCC
T ss_conf             98753369--77999946867777503553


Done!