HHsearch results for GI: 254780633 and protein with PDBid: 3no4_A

>3no4_A Creatininase, creatinine amidohydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.00A {Nostoc punctiforme pcc 73102}
Probab=100.00  E-value=0  Score=455.60  Aligned_cols=238  Identities=18%  Similarity=0.220  Sum_probs=202.3

Q ss_pred             CCCCHHHCCHHHHHH-CCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCC
Q ss_conf             664046669798973-1049889993200124797465226789999999999983566773999140232678011368
Q gi|254780633|r    3 PLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV   81 (267)
Q Consensus         3 ~~~~~~~lT~~e~~~-~~~~~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~f   81 (267)
                      .++++++|||+|+++ .+++++||||+|||||||||||+|||+++++++|+++++++    +++|+|++|||+|.+|++|
T Consensus        18 ~~m~l~~~Tw~Ev~~~l~~~~~vIlPvGs~EqHGpHLPlgtD~~ia~~ia~~~a~~~----~~~v~P~i~yG~s~~h~~f   93 (267)
T 3no4_A           18 QGMLLHLSTWQEVEAYLQQSKGIIFPIGSTEQHGPTGLIGTDAICAEAIAAGVGDAT----GAIVGPTINVGMALHHTAF   93 (267)
T ss_dssp             SSEEGGGSCHHHHHHHHHHCCEEEEEECCBCCBTTTBCTTHHHHHHHHHHHHHHHHH----TCEECCCBCCCCCGGGTTS
T ss_pred             HHHHHCCCCHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC----CCEECCCCCCCCCHHHCCC
T ss_conf             412111178999998853699899965375035887438779999999999999861----9878076645778132178


Q ss_pred             CCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCC---------EEEEEECCCCCCCHHH
Q ss_conf             8733309999999999999999974998899973987867899999999863558---------3999824765456564
Q gi|254780633|r   82 DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS---------MLVVSTSWSRFTIPQG  152 (267)
Q Consensus        82 pGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~---------~~~~~~~~~~~~~~~~  152 (267)
                      |||||++++||+++|+||++||+++|||||+||||||||.++++.++++++.++.         ..+...+||.......
T Consensus        94 pGTisl~~~tl~~~l~di~~sl~~~Gf~~ivivNgHGGN~~~l~~a~~el~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  173 (267)
T 3no4_A           94 PGTISLRPSTLIQVVRDYVTCLAKAGFSKFYFINGHGGNIATLKAAFSETYAHLEDLQIANAQQVQCQVANWFMCGSVYK  173 (267)
T ss_dssp             TTCBCCCHHHHHHHHHHHHHHHHHHTCCEEEEEECCTTHHHHHHHHHHHHHHHHHHHTCTTGGGCEEEEEEGGGCHHHHH
T ss_pred             CCEEEECHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCHHHHCCCCEEEEEEEEECCCCHHH
T ss_conf             97586089999999999999997638753899956867479999999999876530232035643799976313422766


Q ss_pred             HC-CCCCCCCCCCCCHHHHHHHHHHCCCCCCHHHCCCCCCCCCCHHCCCCCCCCCCCCCCCCCHHHCCCCCCEE-CCCCC
Q ss_conf             13-66556678868779999999978132683324667644320001340001377633202288809881041-44307
Q gi|254780633|r  153 II-SFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDA  230 (267)
Q Consensus       153 ~~-~~~~~~~g~HAge~ETS~~lal~PelV~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~Gv~G-dP~~A  230 (267)
                      .. ...+...++|||+.|||+|||++||+|+++++.+..+...             .......+++.+++|++| ||+.|
T Consensus       174 ~~~~~~~~~~~~HAg~~ETSl~l~l~PelV~~~~~~~~~~~~~-------------~~~~~~~~~~~~p~g~~G~dP~~A  240 (267)
T 3no4_A          174 LAKELYGDQEGSHATPSEVALTQYVYPEAIKQAPLSPEVASGH-------------RIYSAADFRVRYPDGRMGSNPGLA  240 (267)
T ss_dssp             HHHHHHGGGSCSBSCHHHHHHHHHHCGGGCCCCCCCSSCCCCC-------------CCCCHHHHHHHSTTSCBSCCGGGC
T ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHCHHHCCCCCCCCCCCCCC-------------CCCCCCCCEEECCCCCEECCCCCC
T ss_conf             5233147624225888999988402823227000586556788-------------734555200278998654898857


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             999999999999999999999999585
Q gi|254780633|r  231 TVKKGEGLLSYFANCFIQLLNDINSFD  257 (267)
Q Consensus       231 t~E~G~~~~~~~v~~l~~~i~e~~~~~  257 (267)
                      |+||||++++.+++++++.|+++-++|
T Consensus       241 taEkG~~i~e~~v~~l~~~i~e~l~ae  267 (267)
T 3no4_A          241 TPEHGKQFYDLAVKELSNGYLEFVNAD  267 (267)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             899989999999999999999998459