Query         gi|254780633|ref|YP_003065046.1| creatinine amidohydrolase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 267
No_of_seqs    115 out of 722
Neff          7.4 
Searched_HMMs 23785
Date          Tue May 31 18:56:28 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780633.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1v7z_A Creatininase, creatinin 100.0       0       0  458.9  24.9  241    1-258     1-259 (260)
  2 3no4_A Creatininase, creatinin 100.0       0       0  455.6  22.1  238    3-257    18-267 (267)
  3 3lub_A Putative creatinine ami 100.0       0       0  446.9  24.1  249    1-260     2-254 (254)
  4 3dah_A Ribose-phosphate pyroph  85.2     1.9 8.1E-05   21.8   7.6   69   42-119    68-137 (319)
  5 2h06_A Ribose-phosphate pyroph  82.0     2.6 0.00011   21.0   7.8   70   42-120    64-133 (326)
  6 1dku_A Protein (phosphoribosyl  77.2     3.7 0.00016   20.0   7.6   72   39-120    68-139 (317)
  7 3dcm_X AdoMet, uncharacterized  57.2     9.5  0.0004   17.4   4.5   37   96-132    31-67  (192)
  8 2jzc_A UDP-N-acetylglucosamine  47.5      13 0.00056   16.4   3.2   39   83-122    36-76  (224)
  9 2x7j_A 2-succinyl-5-enolpyruvy  47.3      14 0.00057   16.4   4.6   54   82-142   223-276 (604)
 10 2e3d_A UTP--glucose-1-phosphat  47.1      14 0.00058   16.4   3.4   27   95-121    41-67  (302)
 11 2ji4_A Phosphoribosyl pyrophos  44.8      15 0.00063   16.1   7.3   70   39-120    91-161 (379)
 12 2bon_A Lipid kinase; DAG kinas  43.9      15 0.00064   16.1   5.3   21   98-118    73-93  (332)
 13 2ux8_A Glucose-1-phosphate uri  43.4      16 0.00066   16.0   3.8   27   95-121    47-73  (297)
 14 1jyk_A LICC protein, CTP:phosp  42.6      16 0.00067   15.9   3.5   49   85-142    51-99  (254)
 15 2pa4_A UTP-glucose-1-phosphate  40.8      17 0.00072   15.7   3.8   26   95-120    45-70  (323)
 16 2cxh_A Probable BRIX-domain ri  39.8      12 0.00049   16.8   1.9   40   81-122    59-98  (217)
 17 2rbg_A Putative uncharacterize  37.2      19 0.00082   15.4   3.3   63   84-146     9-72  (126)
 18 1tzf_A Glucose-1-phosphate cyt  36.6      20 0.00084   15.3   3.2   33   85-120    28-60  (259)
 19 1u9y_A RPPK;, ribose-phosphate  34.9      21 0.00089   15.2   7.0   69   42-120    60-128 (284)
 20 3jy6_A Transcriptional regulat  33.8      22 0.00093   15.1   7.1   50   68-121    87-136 (276)
 21 1jqn_A Pepcase, PEPC, phosphoe  31.8      18 0.00074   15.7   1.8   49   70-121   537-585 (883)
 22 2qv5_A AGR_C_5032P, uncharacte  31.1      24   0.001   14.8   6.5   74   55-135    75-155 (261)
 23 1fxo_A Glucose-1-phosphate thy  30.2      25  0.0011   14.7   2.7   22   96-117    36-57  (293)
 24 2zqe_A MUTS2 protein; alpha/be  30.2      25  0.0011   14.7   7.7   48   88-137    13-60  (83)
 25 1mc3_A Glucose-1-phosphate thy  30.0      25  0.0011   14.7   2.7   23   96-118    37-59  (296)
 26 2noc_A Putative periplasmic pr  27.2      28  0.0012   14.3   2.4   40   82-121    40-80  (99)
 27 3lq1_A 2-succinyl-5-enolpyruvy  25.8      30  0.0013   14.2   5.7   34  109-143   224-257 (578)
 28 3dk5_A Bifunctional protein GL  25.5      31  0.0013   14.1   3.6   19   99-117    40-58  (495)
 29 3cs3_A Sugar-binding transcrip  24.3      32  0.0013   14.0   5.9   52   68-123    82-133 (277)
 30 1vem_A Beta-amylase; beta-alph  23.7      33  0.0014   13.9   3.7   80   23-121    14-95  (516)
 31 3brk_X Glucose-1-phosphate ade  22.9      34  0.0014   13.8   3.2   17  107-123   125-142 (420)
 32 1d4a_A DT-diaphorase, quinone   22.4      35  0.0015   13.8   4.9   16   61-76     95-110 (273)
 33 1hv9_A UDP-N-acetylglucosamine  22.2      35  0.0015   13.8   3.2   24   95-118    35-58  (456)
 34 2aam_A Hypothetical protein TM  21.4      37  0.0015   13.6   7.6  111    9-143    56-188 (309)
 35 1rcu_A Conserved hypothetical   20.9      37  0.0016   13.6   6.3   48   90-142    41-88  (195)
 36 3juk_A UDP-glucose pyrophospho  20.8      38  0.0016   13.6   3.5   24   95-118    35-58  (281)
 37 1s3l_A Hypothetical protein MJ  20.7      38  0.0016   13.6   4.9   44   99-142    16-59  (190)
 38 2qmq_A Protein NDRG2, protein   20.4      38  0.0016   13.5   4.6   62   61-127    67-129 (286)

No 1  
>1v7z_A Creatininase, creatinine amidohydrolase; Mn-activated creatininase, substrate complex; 1.60A {Pseudomonas SP} SCOP: c.125.1.1 PDB: 1j2u_A 1j2t_A 3a6d_A 3a6j_A 3a6k_A 3a6l_A 3a6g_A 3a6f_A 3a6e_A 3a6h_A 1q3k_A
Probab=100.00  E-value=0  Score=458.87  Aligned_cols=241  Identities=25%  Similarity=0.330  Sum_probs=201.8

Q ss_pred             CCCCCCHHHCCHHHHHH-CC-CCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHH
Q ss_conf             98664046669798973-10-49889993200124797465226789999999999983566773999140232678011
Q gi|254780633|r    1 MNPLIIFTDNSLPLCAD-AR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH   78 (267)
Q Consensus         1 m~~~~~~~~lT~~e~~~-~~-~~~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h   78 (267)
                      |..+++|++|||+|+++ ++ +++++|||+||+||||||||+|||+++++++|+++|+++    +++|+|++|||+|++|
T Consensus         1 m~~~~~l~~lTw~E~~~~l~~~~~v~ilPvGs~EqHGpHLPlgtD~~ia~~ia~~~a~~~----~~~v~P~i~~G~s~~h   76 (260)
T 1v7z_A            1 MSKSVFVGELTWKEYEARVAAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAERI----GALVMPGLQYGYKSQQ   76 (260)
T ss_dssp             --CCCBGGGSCHHHHHHHHHTSCCCEEEEECCBCCCCSSBCTTHHHHHHHHHHHHHHHHH----TCEECCCBCCCBCCCH
T ss_pred             CCCCEEHHHCCHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC----CCCCCCCCCCCCCCCC
T ss_conf             985576785798999999827997899825566056886414689999999999999876----9947787665776333


Q ss_pred             CC-----CCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHH----HHHHHHHHHHH--CCEEEEEECCCCC
Q ss_conf             36-----8873330999999999999999997499889997398786789----99999998635--5839998247654
Q gi|254780633|r   79 MY-----VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL----VSIVSTEARMR--FSMLVVSTSWSRF  147 (267)
Q Consensus        79 ~~-----fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~----l~~a~~~l~~~--~~~~~~~~~~~~~  147 (267)
                      +.     ||||||++++||.++|.||++||++|||||||||||||||..+    ++.++++++.+  .+..++..+||.+
T Consensus        77 ~~~~~~~fPGTisl~~~t~~~~l~di~~sl~~~Gfr~ivivNgHgGN~~~~~~a~~~~~~el~~~~~~~~~~~~~~~~~~  156 (260)
T 1v7z_A           77 KSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYENSMFIVEGIDLALRELRYAGIQDFKVVVLSYWDF  156 (260)
T ss_dssp             HHHSCTTSSSCBCBCHHHHHHHHHHHHHHHHHHTCCEEEEEECSGGGHHHHHHHHHHHHHHHHHTTCCCCEEEEEEGGGG
T ss_pred             CCCCCCCCCCEEEECHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCC
T ss_conf             57766777725997878899999999999998089659997168764078999999999998753377616999972011


Q ss_pred             CCHHHH----CC-CCCCCCCCCCCHHHHHHHHHHCCCCCCHHHCCCCCCCCCCHHCCCCCCCCCCCCCCCCCHHHCCCCC
Q ss_conf             565641----36-6556678868779999999978132683324667644320001340001377633202288809881
Q gi|254780633|r  148 TIPQGI----IS-FPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKG  222 (267)
Q Consensus       148 ~~~~~~----~~-~~~~~~g~HAge~ETS~~lal~PelV~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~G  222 (267)
                      ......    .. ......++|||+.|||+|||++||+||+|++.+..+.....           .....|...+++++|
T Consensus       157 ~~~~~~~~~~~~~~~~~~~~~HAg~~ETS~~l~l~PelV~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~G  225 (260)
T 1v7z_A          157 VKDPAVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLVDLDRVVDHPPATFPP-----------YDVFPVDPARTPAPG  225 (260)
T ss_dssp             CCCHHHHHHHCTTCCCCSTTCSSSHHHHHHHHHHCGGGBCGGGCCCCCCCCCCS-----------SEEESCCGGGSCTTS
T ss_pred             CCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCHHHCCHHHHCCCCCCCCCC-----------CCCCCCCHHHCCCCC
T ss_conf             456066666432333567887777899999999694421876612047767884-----------334357774439998


Q ss_pred             CEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             041443079999999999999999999999995853
Q gi|254780633|r  223 VVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV  258 (267)
Q Consensus       223 v~GdP~~At~E~G~~~~~~~v~~l~~~i~e~~~~~~  258 (267)
                      ++|||+.||+|+|+++++.++++++++|++  +||-
T Consensus       226 v~Gdp~~As~E~G~~~~~~~v~~l~~~i~e--~~pp  259 (260)
T 1v7z_A          226 TLSSAKTASREKGELILEVCVQGIADAIRE--EFPP  259 (260)
T ss_dssp             CSSCCTTCCHHHHHHHHHHHHHHHHHHHHH--HSCC
T ss_pred             EECCCCHHHHHHHHHHHHHHHHHHHHHHHH--HCCC
T ss_conf             332825314999999999999999999980--5779


No 2  
>3no4_A Creatininase, creatinine amidohydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.00A {Nostoc punctiforme pcc 73102}
Probab=100.00  E-value=0  Score=455.60  Aligned_cols=238  Identities=18%  Similarity=0.220  Sum_probs=202.3

Q ss_pred             CCCCHHHCCHHHHHH-CCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCC
Q ss_conf             664046669798973-1049889993200124797465226789999999999983566773999140232678011368
Q gi|254780633|r    3 PLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV   81 (267)
Q Consensus         3 ~~~~~~~lT~~e~~~-~~~~~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~f   81 (267)
                      .++++++|||+|+++ .+++++||||+|||||||||||+|||+++++++|+++++++    +++|+|++|||+|.+|++|
T Consensus        18 ~~m~l~~~Tw~Ev~~~l~~~~~vIlPvGs~EqHGpHLPlgtD~~ia~~ia~~~a~~~----~~~v~P~i~yG~s~~h~~f   93 (267)
T 3no4_A           18 QGMLLHLSTWQEVEAYLQQSKGIIFPIGSTEQHGPTGLIGTDAICAEAIAAGVGDAT----GAIVGPTINVGMALHHTAF   93 (267)
T ss_dssp             SSEEGGGSCHHHHHHHHHHCCEEEEEECCBCCBTTTBCTTHHHHHHHHHHHHHHHHH----TCEECCCBCCCCCGGGTTS
T ss_pred             HHHHHCCCCHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC----CCEECCCCCCCCCHHHCCC
T ss_conf             412111178999998853699899965375035887438779999999999999861----9878076645778132178


Q ss_pred             CCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCC---------EEEEEECCCCCCCHHH
Q ss_conf             8733309999999999999999974998899973987867899999999863558---------3999824765456564
Q gi|254780633|r   82 DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS---------MLVVSTSWSRFTIPQG  152 (267)
Q Consensus        82 pGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~---------~~~~~~~~~~~~~~~~  152 (267)
                      |||||++++||+++|+||++||+++|||||+||||||||.++++.++++++.++.         ..+...+||.......
T Consensus        94 pGTisl~~~tl~~~l~di~~sl~~~Gf~~ivivNgHGGN~~~l~~a~~el~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  173 (267)
T 3no4_A           94 PGTISLRPSTLIQVVRDYVTCLAKAGFSKFYFINGHGGNIATLKAAFSETYAHLEDLQIANAQQVQCQVANWFMCGSVYK  173 (267)
T ss_dssp             TTCBCCCHHHHHHHHHHHHHHHHHHTCCEEEEEECCTTHHHHHHHHHHHHHHHHHHHTCTTGGGCEEEEEEGGGCHHHHH
T ss_pred             CCEEEECHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCHHHHCCCCEEEEEEEEECCCCHHH
T ss_conf             97586089999999999999997638753899956867479999999999876530232035643799976313422766


Q ss_pred             HC-CCCCCCCCCCCCHHHHHHHHHHCCCCCCHHHCCCCCCCCCCHHCCCCCCCCCCCCCCCCCHHHCCCCCCEE-CCCCC
Q ss_conf             13-66556678868779999999978132683324667644320001340001377633202288809881041-44307
Q gi|254780633|r  153 II-SFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDA  230 (267)
Q Consensus       153 ~~-~~~~~~~g~HAge~ETS~~lal~PelV~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~Gv~G-dP~~A  230 (267)
                      .. ...+...++|||+.|||+|||++||+|+++++.+..+...             .......+++.+++|++| ||+.|
T Consensus       174 ~~~~~~~~~~~~HAg~~ETSl~l~l~PelV~~~~~~~~~~~~~-------------~~~~~~~~~~~~p~g~~G~dP~~A  240 (267)
T 3no4_A          174 LAKELYGDQEGSHATPSEVALTQYVYPEAIKQAPLSPEVASGH-------------RIYSAADFRVRYPDGRMGSNPGLA  240 (267)
T ss_dssp             HHHHHHGGGSCSBSCHHHHHHHHHHCGGGCCCCCCCSSCCCCC-------------CCCCHHHHHHHSTTSCBSCCGGGC
T ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHCHHHCCCCCCCCCCCCCC-------------CCCCCCCCEEECCCCCEECCCCCC
T ss_conf             5233147624225888999988402823227000586556788-------------734555200278998654898857


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             999999999999999999999999585
Q gi|254780633|r  231 TVKKGEGLLSYFANCFIQLLNDINSFD  257 (267)
Q Consensus       231 t~E~G~~~~~~~v~~l~~~i~e~~~~~  257 (267)
                      |+||||++++.+++++++.|+++-++|
T Consensus       241 taEkG~~i~e~~v~~l~~~i~e~l~ae  267 (267)
T 3no4_A          241 TPEHGKQFYDLAVKELSNGYLEFVNAD  267 (267)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             899989999999999999999998459


No 3  
>3lub_A Putative creatinine amidohydrolase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Bacteroides fragilis}
Probab=100.00  E-value=0  Score=446.89  Aligned_cols=249  Identities=25%  Similarity=0.353  Sum_probs=207.0

Q ss_pred             CCCCCCHHHCCHHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC--CEEEEECCCCCCC-CHH
Q ss_conf             9866404666979897310498899932001247974652267899999999999835667--7399914023267-801
Q gi|254780633|r    1 MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR--LPVTCMPVEPIGY-SIE   77 (267)
Q Consensus         1 m~~~~~~~~lT~~e~~~~~~~~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~--~~~~v~P~i~yG~-s~~   77 (267)
                      |+..+-+...+|+++++.+ .+++|||+||+||||||||+|||+++|+++|+++|+++.++  .+++|+|++|||+ ++|
T Consensus         2 ~~~~~dl~~~~~~~~~~~~-~~v~ilPvGs~EqHGpHLPlgtD~~ia~~ia~~~a~~~~~~~~~~~lvlP~i~yG~~~~~   80 (254)
T 3lub_A            2 MNKEVDLSVSCLGKVKELK-YDVIILPWGATEPHNLHLPYLTDCILPHDIAVEAAELALSRSGVRCMVMPPVPFGAHNPG   80 (254)
T ss_dssp             CCTTTBTTTCBHHHHTTSC-CCEEEEEECCCCCBTTTBBTTHHHHHHHHHHHHHHHHHHHHHCCCEEECCCBCCBCCCTT
T ss_pred             CCCCCCCCCCHHHHHHHCC-CCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCC
T ss_conf             9654224323099996358-999998012611227774435689999999999998540204899799889985233721


Q ss_pred             HCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHC-CEEEEEECCCCCCCHHHHCCC
Q ss_conf             1368873330999999999999999997499889997398786789999999986355-839998247654565641366
Q gi|254780633|r   78 HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF-SMLVVSTSWSRFTIPQGIISF  156 (267)
Q Consensus        78 h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~-~~~~~~~~~~~~~~~~~~~~~  156 (267)
                      |+.||||||++++||.++|.||++||++||||||+||||||||..  ..++++++.++ +..+...+||.......   .
T Consensus        81 ~~~fpGTisl~~~t~~~~l~di~~sl~~~Gfr~ivivNgHGGN~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~  155 (254)
T 3lub_A           81 QRELPFCIHTRYATQQAILEDIVSSLHVQGFRKLLILSGHGGNNF--KGMIRDLAFEYPDFLIAAANWFEVVSPKG---Y  155 (254)
T ss_dssp             TTTSTTCCBCCHHHHHHHHHHHHHHHHHTTCCEEEEEESCTTCCC--HHHHHHHHHHCTTCEEEEEEGGGSSCCBT---T
T ss_pred             CCCCCCEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHH--HHHHHHHHHHCCCCEEEEEEHHHCCCCCC---C
T ss_conf             267797265365778999999999999838864999927862688--99999999867893899842442146211---2


Q ss_pred             CCCCCCCCCCHHHHHHHHHHCCCCCCHHHCCCCCCCCCCHHCCCCCCCCCCCCCCCCCHHHCCCCCCEECCCCCCHHHHH
Q ss_conf             55667886877999999997813268332466764432000134000137763320228880988104144307999999
Q gi|254780633|r  157 PETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE  236 (267)
Q Consensus       157 ~~~~~g~HAge~ETS~~lal~PelV~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~Gv~GdP~~At~E~G~  236 (267)
                      .+...++|||+.|||+|||++||+|+++++.+..+........     ........+.+++++++|++|||+.||+|+|+
T Consensus       156 ~~~~~~~HAg~~ETS~~lal~PelV~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~G~~GdP~~AtaE~G~  230 (254)
T 3lub_A          156 FEAEIDDHAGESETSVMMHYHPELVNLAEAGDGESKPFAIASL-----NEKVAWVPRHWDKATVDSGVGNPKKATAEKGE  230 (254)
T ss_dssp             BCCSCEEESSHHHHHHHHHHCGGGCCGGGCCCCCBCCCSSHHH-----HTTSSBCCCCHHHHBSSSCEECCTTCCHHHHH
T ss_pred             CCCCCCCCCCHHHHHHHHHHCHHHCCHHHCCCCCCCCCCCCCC-----CCCCCCCCCCHHHCCCCCCCCCCCCCCHHHHH
T ss_conf             3433667667899999998697750876546778876542234-----65412145527654999897581615999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             999999999999999999585300
Q gi|254780633|r  237 GLLSYFANCFIQLLNDINSFDVSI  260 (267)
Q Consensus       237 ~~~~~~v~~l~~~i~e~~~~~~~~  260 (267)
                      ++++.++++++++|+||.++||.+
T Consensus       231 ~l~~~~v~~l~~~i~e~~~~dl~~  254 (254)
T 3lub_A          231 RYVKPIVEKLAGLFEEMAQHDLYE  254 (254)
T ss_dssp             HHHHHHHHHHHHHHHHHHHSCSCC
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             999999999999999998678999


No 4  
>3dah_A Ribose-phosphate pyrophosphokinase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, magnesium; HET: AMP; 2.30A {Burkholderia pseudomallei 1710B}
Probab=85.23  E-value=1.9  Score=21.80  Aligned_cols=69  Identities=9%  Similarity=0.176  Sum_probs=46.7

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCC-CCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             6789999999999983566773999140232678011368-87333099999999999999999749988999739878
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~f-pGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      -|.++--.+.-.++++.+.+.-.+|+|-++  |+-....| +|-..++...       +++-|...|+.+++.++-|-.
T Consensus        68 nd~lmeLll~~~a~r~~gA~~itlViPYl~--YsRQDr~~~~g~~~isa~~-------va~ll~~~g~d~vitvDlH~~  137 (319)
T 3dah_A           68 NDNLMELMIMVDALKRASAGRITAAIPYFG--YARQDRRPRSARVAISAKV-------VANMLEIAGVERIITMDLHAD  137 (319)
T ss_dssp             HHHHHHHHHHHHHHHHTTBSEEEEEESSCT--TTTCCSCCTTCCCCCHHHH-------HHHHHHHHTCCEEEEESCSCG
T ss_pred             CHHHHHHHHHHHHHHHCCCCCEEEEECCCC--HHHHCCCCCCCCCCHHHHH-------HHHHHHHCCCCEEEEECCCHH
T ss_conf             378999999999998749772588714662--3220323467743067999-------984440058855999577848


No 5  
>2h06_A Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthetase 1, phosphoribosyl pyrophosphate synthetase 1, transferase; 2.20A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h07_A 2h08_A
Probab=81.98  E-value=2.6  Score=20.95  Aligned_cols=70  Identities=10%  Similarity=0.157  Sum_probs=48.8

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             6789999999999983566773999140232678011368873330999999999999999997499889997398786
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      -|.++-.-+.-.++++.+.+.-.+|+|  +|||+-..+.|-..-.++...+..+       |...|+.+++.++-|-.+
T Consensus        64 nd~lmelll~i~alr~~~A~~It~ViP--Yl~YaRQDr~~~~ge~isak~va~l-------L~~~G~d~vit~DlH~~~  133 (326)
T 2h06_A           64 NDNLMELLIMINACKIASASRVTAVIP--CFPYARQDKKDKSRAPISAKLVANM-------LSVAGADHIITMDLHASQ  133 (326)
T ss_dssp             HHHHHHHHHHHHHHHTTTBSEEEEEES--SCTTTTCCSCSSSSCCCHHHHHHHH-------HHHHTCCEEEEESCSSGG
T ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEEEE--ECCCCCCCCCCCCCCCEEHHHHHHH-------HHHCCCCEEEEECCCHHH
T ss_conf             668999999888887568872899987--3134313313379886539999999-------987089979996488799


No 6  
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A*
Probab=77.22  E-value=3.7  Score=20.00  Aligned_cols=72  Identities=13%  Similarity=0.212  Sum_probs=47.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             52267899999999999835667739991402326780113688733309999999999999999974998899973987
Q gi|254780633|r   39 PMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        39 PlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      |.. |.++---+.-.+++..+.+.-.+|+|-++  |+-..+.|-..-.++...       +++-|...|+.+++.+.-|-
T Consensus        68 ~~n-d~l~eLll~~~a~r~~gA~~I~~ViPYl~--YsRQDr~~~~ge~isak~-------va~lL~~~g~d~vit~DlH~  137 (317)
T 1dku_A           68 PVN-EHIMELLIMVDALKRASAKTINIVIPYYG--YARQDRKARSREPITAKL-------FANLLETAGATRVIALDLHA  137 (317)
T ss_dssp             SHH-HHHHHHHHHHHHHHHTTCSEEEEEESSCT--TTTCCSCSSTTCCCHHHH-------HHHHHHHHTCCEEEEESCSS
T ss_pred             CCC-HHHHHHHHHHHHHHHCCCCEEEEEECCCC--CCEECHHCCCCCCHHHHH-------HHHHHHHCCCCEEEEECCCC
T ss_conf             942-77999999999998689955999936664--332000027998705999-------99887624997799963684


Q ss_pred             CC
Q ss_conf             86
Q gi|254780633|r  119 GN  120 (267)
Q Consensus       119 GN  120 (267)
                      .+
T Consensus       138 ~~  139 (317)
T 1dku_A          138 PQ  139 (317)
T ss_dssp             GG
T ss_pred             HH
T ss_conf             87


No 7  
>3dcm_X AdoMet, uncharacterized protein TM_1570; trefoil knot, spout mtase, adoMet binding, transferase; HET: SAM; 2.00A {Thermotoga maritima}
Probab=57.23  E-value=9.5  Score=17.39  Aligned_cols=37  Identities=16%  Similarity=0.114  Sum_probs=29.1

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9999999997499889997398786789999999986
Q gi|254780633|r   96 WLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR  132 (267)
Q Consensus        96 l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~  132 (267)
                      |.||+|++..-||+++++||=-.++....+.+.+.+.
T Consensus        31 ihdIARamkn~Gl~~l~lV~P~~~q~~l~~~~~~~W~   67 (192)
T 3dcm_X           31 VHDIARTARTYNLKGYYIVTNLRAQQDMVSKMLKFWR   67 (192)
T ss_dssp             HHHHHHHHHHTTCSEEEEECCCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHCCC
T ss_conf             7999999986799727996762677888988875077


No 8  
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae}
Probab=47.53  E-value=13  Score=16.45  Aligned_cols=39  Identities=13%  Similarity=0.245  Sum_probs=25.9

Q ss_pred             CCEECCHHHHHHHH--HHHHHHHHHCCCCEEEEECCCCCCHH
Q ss_conf             73330999999999--99999999749988999739878678
Q gi|254780633|r   83 GTKTLTYAEAIEHW--LAIIDAIRKMGIRKIVILNAHGGNSP  122 (267)
Q Consensus        83 GTisl~~~t~~~~l--~di~~sl~~~Gf~~iviiNgHgGN~~  122 (267)
                      || +++.+.++..+  .+.+..|.+.||+++++--|.+|...
T Consensus        36 Gt-T~~F~~LI~~V~~~~fl~~L~~~Gyt~LlVQ~Gs~~a~~   76 (224)
T 2jzc_A           36 GA-TVPFPKLVSCVLSDEFCQELIQYGFVRLIIQFGRNYSSE   76 (224)
T ss_dssp             CS-CCSCHHHHHHHTSHHHHHHHHTTTCCCEEECCCSSSCCC
T ss_pred             CC-CCCHHHHHHHHCCHHHHHHHHHCCCCEEEEEECCCCHHH
T ss_conf             99-988679999985899999999879998999879980366


No 9  
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis}
Probab=47.32  E-value=14  Score=16.39  Aligned_cols=54  Identities=7%  Similarity=-0.009  Sum_probs=28.7

Q ss_pred             CCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEEE
Q ss_conf             8733309999999999999999974998899973987867899999999863558399982
Q gi|254780633|r   82 DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST  142 (267)
Q Consensus        82 pGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~~  142 (267)
                      +.......+.+.....    -|.+  -+|-+|+-|.|..... .....++.++.+..++..
T Consensus       223 ~~~~~~~~~~~~~~~~----~l~~--akrpvii~G~~~~~~~-~~~~~~lae~~~~pv~~~  276 (604)
T 2x7j_A          223 TGTQSVDRESLSDVAE----MLAE--AEKGMIVCGELHSDAD-KENIIALSKALQYPILAD  276 (604)
T ss_dssp             CCEEECCTGGGHHHHH----HHHH--CSSEEEEECCCCCHHH-HHHHHHHHHHHTCCEEEC
T ss_pred             CCCCCCCHHHHHHHHH----HHHH--CCCCEEEECCCCCHHH-HHHHHHHHHHHCCCCCCC
T ss_conf             7888899899999999----9972--7898999657330656-889887898752654111


No 10 
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli}
Probab=47.08  E-value=14  Score=16.36  Aligned_cols=27  Identities=22%  Similarity=0.306  Sum_probs=22.1

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             999999999974998899973987867
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      +|.-++..|.+.||++|+|+.+|.++.
T Consensus        41 lL~~~i~~l~~~Gi~~i~iv~~~~~~~   67 (302)
T 2e3d_A           41 LIQYVVNECIAAGITEIVLVTHSSKNS   67 (302)
T ss_dssp             HHHHHHHHHHHTTCCEEEEEECGGGHH
T ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCHH
T ss_conf             999999999986997899971132014


No 11 
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A*
Probab=44.77  E-value=15  Score=16.14  Aligned_cols=70  Identities=13%  Similarity=0.196  Sum_probs=45.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCC-CCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             52267899999999999835667739991402326780113688-73330999999999999999997499889997398
Q gi|254780633|r   39 PMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD-GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH  117 (267)
Q Consensus        39 PlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fp-GTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH  117 (267)
                      |.. |.++-.-+.-.+++..+.+.-.+|+|-++|.  -....|. |.  +...       .++.-|...|+.+++.+.-|
T Consensus        91 ~~n-d~lmELll~i~Alr~~gA~~ItlViPYl~Ys--RQDr~~~~~~--i~a~-------~va~~L~~~gvd~vitvDlH  158 (379)
T 2ji4_A           91 DVN-TTIMELLIMVYACKTSCAKSIIGVIPYFPYS--KQCKMRKRGS--IVSK-------LLASMMCKAGLTHLITMDLH  158 (379)
T ss_dssp             CHH-HHHHHHHHHHHHHHHTTCSEEEEECSSCSSC--CC-------C--CHHH-------HHHHHHHHTTCCEEEEESCS
T ss_pred             CCC-HHHHHHHHHHHHHHHHHCCEEEEEECCCCCC--CCCCCCCCCC--CHHH-------HHHHHHHHCCCCCCEEEECC
T ss_conf             815-8999999999999874056479993355334--0540003564--0688-------99878875287632245327


Q ss_pred             CCC
Q ss_conf             786
Q gi|254780633|r  118 GGN  120 (267)
Q Consensus       118 gGN  120 (267)
                      -.+
T Consensus       159 ~~~  161 (379)
T 2ji4_A          159 QKE  161 (379)
T ss_dssp             SGG
T ss_pred             CHH
T ss_conf             677


No 12 
>2bon_A Lipid kinase; DAG kinase, ATP-binding, transferase; 1.9A {Escherichia coli} SCOP: e.52.1.2 PDB: 2jgr_A 2p1r_A
Probab=43.90  E-value=15  Score=16.05  Aligned_cols=21  Identities=19%  Similarity=0.498  Sum_probs=10.3

Q ss_pred             HHHHHHHHCCCCEEEEECCCC
Q ss_conf             999999974998899973987
Q gi|254780633|r   98 AIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        98 di~~sl~~~Gf~~iviiNgHg  118 (267)
                      ++++.+...|+..||++.|=|
T Consensus        73 ~la~~a~~~g~d~IV~~GGDG   93 (332)
T 2bon_A           73 RYVEEARKFGVATVIAGGGDG   93 (332)
T ss_dssp             HHHHHHHHHTCSEEEEEESHH
T ss_pred             HHHHHHHHCCCCEEEEECCHH
T ss_conf             999999877989999998836


No 13 
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea}
Probab=43.35  E-value=16  Score=16.00  Aligned_cols=27  Identities=15%  Similarity=0.337  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             999999999974998899973987867
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      +|.-++..|.++||++|+|+.+|.++.
T Consensus        47 lI~~~l~~l~~~Gi~~iiiv~~~~~~~   73 (297)
T 2ux8_A           47 LIQYAVDEAVEAGIEQMIFVTGRGKSA   73 (297)
T ss_dssp             HHHHHHHHHHHTTCCEEEEEECTTCHH
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHH
T ss_conf             999999999986998899991235035


No 14 
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A*
Probab=42.59  E-value=16  Score=15.93  Aligned_cols=49  Identities=16%  Similarity=0.239  Sum_probs=30.8

Q ss_pred             EECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEEE
Q ss_conf             3309999999999999999974998899973987867899999999863558399982
Q gi|254780633|r   85 KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST  142 (267)
Q Consensus        85 isl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~~  142 (267)
                      +.+...+++.+   ++..|..+|+++|+|+.||.+..  ++    .+..+++..+...
T Consensus        51 l~I~gkplI~~---~i~~l~~~gi~~Iiiv~g~~~e~--i~----~~~~~~~i~i~~~   99 (254)
T 1jyk_A           51 VQVNQKPLIEY---QIEFLKEKGINDIIIIVGYLKEQ--FD----YLKEKYGVRLVFN   99 (254)
T ss_dssp             CEETTEEHHHH---HHHHHHHTTCCCEEEEECTTGGG--GT----HHHHHHCCEEEEC
T ss_pred             EEECCEEHHHH---HHHHHHHCCCCEEEEECCCCCCC--CC----CCCCCCCCCCCCC
T ss_conf             08998488999---99999986998899932643222--22----2223367632222


No 15 
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032}
Probab=40.75  E-value=17  Score=15.75  Aligned_cols=26  Identities=15%  Similarity=0.221  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             99999999997499889997398786
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      +|.-++..|...|+++|+||.+|.++
T Consensus        45 lI~~~i~~l~~~Gi~~I~iV~~~~~~   70 (323)
T 2pa4_A           45 GIELIAAEAAELGATRLAIITAPNKA   70 (323)
T ss_dssp             HHHHHHHHHHHTTCCEEEEEECTTCH
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHH
T ss_conf             99999999998599779999157434


No 16 
>2cxh_A Probable BRIX-domain ribosomal biogenesis protein; 18S rRNA, IMP4, U3 snoRNP, RNA-binding, structural genomics, NPPSFA; 1.80A {Aeropyrum pernix K1} SCOP: c.51.1.2
Probab=39.80  E-value=12  Score=16.82  Aligned_cols=40  Identities=18%  Similarity=0.230  Sum_probs=28.7

Q ss_pred             CCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHH
Q ss_conf             887333099999999999999999749988999739878678
Q gi|254780633|r   81 VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP  122 (267)
Q Consensus        81 fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~  122 (267)
                      ||+...+.-..  .-|.|++......||+.++|||-|-||..
T Consensus        59 ~Pns~~~~Rgk--~~lkei~~~A~~~g~T~liIv~E~~g~P~   98 (217)
T 2cxh_A           59 IPGAFRFTRGH--YSMEELAREAIIRGADRIVVVGERRGNPG   98 (217)
T ss_dssp             STTEEECCCTT--CCHHHHHHHHHHTTEEEEEEEEEETTEEE
T ss_pred             CCCCEEEECCC--CCHHHHHHHHHHCCCCEEEEEECCCCCCC
T ss_conf             89988962499--72999999998779988999975789787


No 17 
>2rbg_A Putative uncharacterized protein ST0493; hypothetical protein, structural genomics, unknown function, NPPSFA; 1.75A {Sulfolobus tokodaii}
Probab=37.24  E-value=19  Score=15.40  Aligned_cols=63  Identities=13%  Similarity=0.093  Sum_probs=37.8

Q ss_pred             CEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC-CCCHHHHHHHHHHHHHHCCEEEEEECCCC
Q ss_conf             3330999999999999999997499889997398-78678999999998635583999824765
Q gi|254780633|r   84 TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH-GGNSPLVSIVSTEARMRFSMLVVSTSWSR  146 (267)
Q Consensus        84 Tisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH-gGN~~~l~~a~~~l~~~~~~~~~~~~~~~  146 (267)
                      -++++.+++.++.+.+..-....|+||++|=--. -.-...+..+.+.+-..-+.-....-|-.
T Consensus         9 ivsv~~e~~~nffR~~~kD~R~~GskK~iIN~is~i~~~e~v~~aREAlLdNIDlG~ely~WK~   72 (126)
T 2rbg_A            9 LISVNNDNFENYFRKIFLDVRSSGSKKTTINVFTEIQYQELVTLIREALLENIDIGYELFLWKK   72 (126)
T ss_dssp             EEECCGGGHHHHHHHHHHHHHHHTCSEEEEEEECSSCHHHHHHHTHHHHHHTTTSEEEEEEECG
T ss_pred             EEECCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEEEECH
T ss_conf             9854666579999999999985588528999854686799999999998843454528998678


No 18 
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A*
Probab=36.58  E-value=20  Score=15.33  Aligned_cols=33  Identities=18%  Similarity=0.225  Sum_probs=24.4

Q ss_pred             EECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             330999999999999999997499889997398786
Q gi|254780633|r   85 KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        85 isl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      +.+...+++..   ++..|.++|+++|+++.||.++
T Consensus        28 l~I~gkplI~~---~i~~l~~~gi~~iiiv~gy~~~   60 (259)
T 1tzf_A           28 VEIGGKPILWH---IMKMYSVHGIKDFIICCGYKGY   60 (259)
T ss_dssp             CEETTEEHHHH---HHHHHHHTTCCEEEEEECTTHH
T ss_pred             EEECCEEHHHH---HHHHHHHCCCCEEEEECCCCHH
T ss_conf             79999998999---9999998599679983222299


No 19 
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A*
Probab=34.89  E-value=21  Score=15.16  Aligned_cols=69  Identities=10%  Similarity=0.041  Sum_probs=42.6

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             6789999999999983566773999140232678011368873330999999999999999997499889997398786
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      -|.++--.+...+++..+.+.-.+|+|-+||.  -....+-..-.++...+..+        ...|+.+++.+.-|-.+
T Consensus        60 nd~l~ell~~~~alr~~ga~~itlViPYl~Ya--RQDR~~~~ge~isak~~a~l--------l~~g~d~vvt~D~H~~~  128 (284)
T 1u9y_A           60 NDAIVETILLCDALRDEGVKKITLVAPYLAYA--RQDKKFNPGEAISIRALAKI--------YSNIVDKLITINPHETH  128 (284)
T ss_dssp             HHHHHHHHHHHHHHHTTTCCEEEEECSSCTTC--SCSSCSSTTBCCHHHHHHHH--------HHHHCSEEEEESCSCGG
T ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC--CCCCCCCCCCCHHHHHHHHH--------HHHCCCCEEEEECCCHH
T ss_conf             36599999999999871887389995223201--04654589873589999999--------87456844898378178


No 20 
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein structure initiative, structural genomics; 1.97A {Lactobacillus brevis atcc 367}
Probab=33.79  E-value=22  Score=15.05  Aligned_cols=50  Identities=20%  Similarity=0.174  Sum_probs=30.1

Q ss_pred             CCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             402326780113688733309999999999999999974998899973987867
Q gi|254780633|r   68 PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        68 P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      |.+.++.......++ .|.....-   ....+++.|.+.|.+||++++++....
T Consensus        87 PvV~~~~~~~~~~~~-~V~~d~~~---~~~~a~~~L~~~G~~~I~~i~~~~~~~  136 (276)
T 3jy6_A           87 PVVSVDREMDACPWP-QVVTDNFE---AAKAATTAFRQQGYQHVVVLTSELELS  136 (276)
T ss_dssp             CEEEESCCCTTCSSC-EEECCHHH---HHHHHHHHHHTTTCCEEEEEEECSTTC
T ss_pred             CEEEECCCCCCCCCC-EEEECHHH---HHHHHHHHHHHHCCCCCEEECCCCCCC
T ss_conf             999976777888988-89964799---877777889873566213870573110


No 21 
>1jqn_A Pepcase, PEPC, phosphoenolpyruvate carboxylase; beta barrel, Mn2+ and DCDP complex, lyase; HET: DCO; 2.35A {Escherichia coli} SCOP: c.1.12.3 PDB: 1fiy_A* 1qb4_A
Probab=31.85  E-value=18  Score=15.66  Aligned_cols=49  Identities=24%  Similarity=0.383  Sum_probs=31.8

Q ss_pred             CCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             2326780113688733309999999999999999974998899973987867
Q gi|254780633|r   70 EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        70 i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      |..|||....+ .|-++-..+.+.+-.. +..-...+|+ ++.|++||||-.
T Consensus       537 VMlGYSDS~KD-gG~laa~w~ly~aq~~-l~~~~~~~gv-~l~~FhGRGGsv  585 (883)
T 1jqn_A          537 VMIGYSDSAKD-AGVMAASWAQYQAQDA-LIKTCEKAGI-ELTLFHGRGGSI  585 (883)
T ss_dssp             EEECHHHHHHH-HCHHHHHHHHHHHHHH-HHHHHHHHTC-EEEEEECSSTGG
T ss_pred             EEECCCCCCCC-CCHHHHHHHHHHHHHH-HHHHHHHCCC-CEEEECCCCCCC
T ss_conf             44324544442-0187778999999999-9999997497-269961788878


No 22 
>2qv5_A AGR_C_5032P, uncharacterized protein ATU2773; structural genomics, unknown function, PSI-2, protein structure initiative; 1.90A {Agrobacterium tumefaciens str}
Probab=31.06  E-value=24  Score=14.77  Aligned_cols=74  Identities=16%  Similarity=0.104  Sum_probs=45.0

Q ss_pred             HHHCCCCCEEEEECCCCCCCCHHHCCCCCC--EECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC-CC----CHHHHHHH
Q ss_conf             983566773999140232678011368873--330999999999999999997499889997398-78----67899999
Q gi|254780633|r   55 KSILPPRLPVTCMPVEPIGYSIEHMYVDGT--KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH-GG----NSPLVSIV  127 (267)
Q Consensus        55 a~~~~~~~~~~v~P~i~yG~s~~h~~fpGT--isl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH-gG----N~~~l~~a  127 (267)
                      |++.+.+ -.+-+|.-|.++...-.+ |++  .+.+.+.....|...+..     +-..+-||+| |+    |...++.+
T Consensus        75 ar~~G~E-vllhlPMep~~~~~~~~g-p~~L~~~~~~~~i~~~l~~~l~~-----vP~avGvnNhmGS~~t~~~~~m~~v  147 (261)
T 2qv5_A           75 ARREGHE-ILLQIPLEPFGYPGTNPG-PDTLLAGDPAKVNIDRLHRSMAK-----ITNYTGVMNYLGGRFLAEQSALEPV  147 (261)
T ss_dssp             HHHHTCC-EEEEEEECCTTTTTSCCC-TTCBCTTSCHHHHHHHHHHHHTT-----CCCCSEEEEEECTTGGGCHHHHHHH
T ss_pred             HHHCCCE-EEEECCCCCCCCCCCCCC-CCCCCCCCCHHHHHHHHHHHHHH-----CCCEEEEECCCCCHHHCCHHHHHHH
T ss_conf             9977987-999766676688878888-55456678899999999999986-----9862998346552012698999999


Q ss_pred             HHHHHHHC
Q ss_conf             99986355
Q gi|254780633|r  128 STEARMRF  135 (267)
Q Consensus       128 ~~~l~~~~  135 (267)
                      .+.++.+.
T Consensus       148 ~~~l~~~g  155 (261)
T 2qv5_A          148 MRDIGKRG  155 (261)
T ss_dssp             HHHHHHTT
T ss_pred             HHHHHHCC
T ss_conf             99998779


No 23 
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 1mp5_A* 1mp3_A* 1mp4_A*
Probab=30.25  E-value=25  Score=14.68  Aligned_cols=22  Identities=23%  Similarity=0.382  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHCCCCEEEEECCC
Q ss_conf             9999999997499889997398
Q gi|254780633|r   96 WLAIIDAIRKMGIRKIVILNAH  117 (267)
Q Consensus        96 l~di~~sl~~~Gf~~iviiNgH  117 (267)
                      +.-++..|...|+++|+|+++|
T Consensus        36 I~~~l~~l~~~Gi~~iiii~~~   57 (293)
T 1fxo_A           36 IYYPLSTLMLAGIREILIISTP   57 (293)
T ss_dssp             THHHHHHHHHTTCCEEEEEECT
T ss_pred             HHHHHHHHHHCCCCEEEEEECC
T ss_conf             9999999998699889999266


No 24 
>2zqe_A MUTS2 protein; alpha/beta, ATP-binding, DNA-binding, nucleotide-binding, DNA binding protein; 1.70A {Thermus thermophilus HB8}
Probab=30.25  E-value=25  Score=14.68  Aligned_cols=48  Identities=23%  Similarity=0.243  Sum_probs=33.6

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCE
Q ss_conf             99999999999999999749988999739878678999999998635583
Q gi|254780633|r   88 TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM  137 (267)
Q Consensus        88 ~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~  137 (267)
                      +.+--...|..-+.....+|.+.+.||-|+|.  ..|+.+.+++-.+++.
T Consensus        13 ~~~eA~~~l~~~i~~a~~~~~~~v~IIHGkG~--gvLk~~v~~~L~~~~~   60 (83)
T 2zqe_A           13 TVAEALLEVDQALEEARALGLSTLRLLHGKGT--GALRQAIREALRRDKR   60 (83)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCSEEEEECCSTT--SHHHHHHHHHHHHCTT
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEEEECCCC--CHHHHHHHHHHHCCCC
T ss_conf             99999999999999999859938999944788--2389999999846996


No 25 
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6
Probab=30.03  E-value=25  Score=14.66  Aligned_cols=23  Identities=22%  Similarity=0.341  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             99999999974998899973987
Q gi|254780633|r   96 WLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        96 l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      +..++..|.++|+++|+|+.+|.
T Consensus        37 i~~~l~~l~~~gi~~i~iv~~~~   59 (296)
T 1mc3_A           37 IYYPLSVLMLAGIREILIITTPE   59 (296)
T ss_dssp             THHHHHHHHHTTCCEEEEEECTT
T ss_pred             HHHHHHHHHHCCCCEEEEEECCC
T ss_conf             99999999987998899992634


No 26 
>2noc_A Putative periplasmic protein; GFT STR106, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella choleraesuis} SCOP: d.230.6.1
Probab=27.17  E-value=28  Score=14.34  Aligned_cols=40  Identities=18%  Similarity=0.210  Sum_probs=30.6

Q ss_pred             CCCEECC-HHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             8733309-999999999999999974998899973987867
Q gi|254780633|r   82 DGTKTLT-YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        82 pGTisl~-~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      -|+||++ ..+..++-.+|.+.--..|-+.++|+...++|.
T Consensus        40 iG~ISv~~~~t~~d~~~~Ls~kAd~~GA~yy~Iis~~~~~~   80 (99)
T 2noc_A           40 IGTISTTGEMSPLDAREDLIKKADEKGADVVVLTSGQTENK   80 (99)
T ss_dssp             EEEEECCSCCCHHHHHHHHHHHHHHTCCSEEECCSCCSSSS
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             05999889899799999999999984999899997289995


No 27 
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes}
Probab=25.83  E-value=30  Score=14.19  Aligned_cols=34  Identities=9%  Similarity=0.077  Sum_probs=18.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEEEC
Q ss_conf             88999739878678999999998635583999824
Q gi|254780633|r  109 RKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS  143 (267)
Q Consensus       109 ~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~~~  143 (267)
                      ++.+++.+.++.... .....++.++.+..++...
T Consensus       224 ~~~iii~~g~~~~~~-~~~l~~lae~l~~pv~~~~  257 (578)
T 3lq1_A          224 KKGVFVVGPIDKKEL-EQPMVDLAKKLGWPILADP  257 (578)
T ss_dssp             SCEEEEECSCCCTTC-HHHHHHHHHHHTCCEEECG
T ss_pred             CCEEEEECCCCCHHH-HHHHHHHHHHCCCCEEECC
T ss_conf             974999424462567-8999999985177603213


No 28 
>3dk5_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann-like fold, LEFT-handed-beta-helix, trimer, cell shape; 2.23A {Mycobacterium tuberculosis} PDB: 3d8v_A 3d98_A* 3dj4_A 3foq_A 2qkx_A*
Probab=25.47  E-value=31  Score=14.14  Aligned_cols=19  Identities=21%  Similarity=0.606  Sum_probs=9.3

Q ss_pred             HHHHHHHCCCCEEEEECCC
Q ss_conf             9999997499889997398
Q gi|254780633|r   99 IIDAIRKMGIRKIVILNAH  117 (267)
Q Consensus        99 i~~sl~~~Gf~~iviiNgH  117 (267)
                      ++++|.++||++|+++.+|
T Consensus        40 ~l~~l~~~g~~eIivv~~~   58 (495)
T 3dk5_A           40 VLHAIAKLAPQRLIVVLGH   58 (495)
T ss_dssp             HHHHHHHHCCSEEEEEESS
T ss_pred             HHHHHHHCCCCEEEEEECC
T ss_conf             9999985699879999589


No 29 
>3cs3_A Sugar-binding transcriptional regulator, LACI family; structural genomics, protein structure initiative, PSI-2; 2.40A {Enterococcus faecalis V583}
Probab=24.34  E-value=32  Score=14.01  Aligned_cols=52  Identities=13%  Similarity=0.171  Sum_probs=31.4

Q ss_pred             CCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHH
Q ss_conf             40232678011368873330999999999999999997499889997398786789
Q gi|254780633|r   68 PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL  123 (267)
Q Consensus        68 P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~  123 (267)
                      |.+-++.......++ .|..+..-   ....+++.|...|++|+.++++...+...
T Consensus        82 PvV~~~~~~~~~~~~-~V~~D~~~---~~~~~~~~l~~~G~~~i~~i~~~~~~~~~  133 (277)
T 3cs3_A           82 SIVVLDRTTEHRNIR-QVLLDNRG---GATQAIEQFVNVGSKKVLLLSGPEKGYDS  133 (277)
T ss_dssp             EEEESSSCCCSTTEE-EEEECHHH---HHHHHHHHHHHTTCSCEEEEECCTTSHHH
T ss_pred             CEEEECCCCCCCCCC-EEEECCHH---HHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             899987755789998-89977589---99999999997398148885178765228


No 30 
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A
Probab=23.71  E-value=33  Score=13.93  Aligned_cols=80  Identities=14%  Similarity=0.167  Sum_probs=38.3

Q ss_pred             EEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             89993200124797465226789999999999983566773999140232678011368873330999999999999999
Q gi|254780633|r   23 IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDA  102 (267)
Q Consensus        23 vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~s  102 (267)
                      -|.||++.+-+..       |   .+.+...+...-....+++.++ ++.|.-.-..  ||.-..  +    -+.++++-
T Consensus        14 yVMlPLd~v~~~~-------~---~~~~~~~Lr~lK~aGVdgVmvd-VWWGiVE~~~--Pg~YdW--s----~Yd~l~el   74 (516)
T 1vem_A           14 YLMAPLKKIPEVT-------N---WETFENDLRWAKQNGFYAITVD-FWWGDMEKNG--DQQFDF--S----YAQRFAQS   74 (516)
T ss_dssp             EEECCSSCGGGTS-------C---HHHHHHHHHHHHHTTEEEEEEE-EEHHHHTCSS--TTCCCC--H----HHHHHHHH
T ss_pred             EEEEECCCCCCCC-------C---HHHHHHHHHHHHHCCCCEEEEE-EEEEECCCCC--CCCCCC--H----HHHHHHHH
T ss_conf             9970332246668-------9---8999999999998399889993-3412001688--983471--8----99999999


Q ss_pred             HHHCCCCEEEEECCC--CCCH
Q ss_conf             997499889997398--7867
Q gi|254780633|r  103 IRKMGIRKIVILNAH--GGNS  121 (267)
Q Consensus       103 l~~~Gf~~iviiNgH--gGN~  121 (267)
                      +.+.|.|-.+++.-|  |||.
T Consensus        75 v~~~GLKi~vVLsfH~cGgnV   95 (516)
T 1vem_A           75 VKNAGMKMIPIISTHQCGGNV   95 (516)
T ss_dssp             HHHTTCEEEEEEECSCBSSST
T ss_pred             HHHCCCEEEEEEEECCCCCCC
T ss_conf             998699589998852047877


No 31 
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens}
Probab=22.89  E-value=34  Score=13.83  Aligned_cols=17  Identities=18%  Similarity=0.081  Sum_probs=8.0

Q ss_pred             CCCEEEEECCCC-CCHHH
Q ss_conf             998899973987-86789
Q gi|254780633|r  107 GIRKIVILNAHG-GNSPL  123 (267)
Q Consensus       107 Gf~~iviiNgHg-GN~~~  123 (267)
                      .-..+++++|-- .|...
T Consensus       125 ~~~~~ll~~gD~i~~~~l  142 (420)
T 3brk_X          125 APEYMVILAGDHIYKMDY  142 (420)
T ss_dssp             CCSEEEEEESSCEECBCT
T ss_pred             CCCEEEEECCCCCCCCCH
T ss_conf             897699986863556414


No 32 
>1d4a_A DT-diaphorase, quinone reductase; flavoprotein, rossman fold, oxidoreductase; HET: FAD; 1.70A {Homo sapiens} SCOP: c.23.5.3 PDB: 1dxo_A* 1gg5_A* 1kbo_A* 1kbq_A* 2f1o_A* 3jsx_A* 1h69_A* 1h66_A* 1qbg_A* 1dxq_A* 1qrd_A*
Probab=22.36  E-value=35  Score=13.77  Aligned_cols=16  Identities=19%  Similarity=0.297  Sum_probs=6.7

Q ss_pred             CCEEEEECCCCCCCCH
Q ss_conf             7739991402326780
Q gi|254780633|r   61 RLPVTCMPVEPIGYSI   76 (267)
Q Consensus        61 ~~~~~v~P~i~yG~s~   76 (267)
                      +.-++..|.-||+.+.
T Consensus        95 D~iV~~~Plww~s~PA  110 (273)
T 1d4a_A           95 DLVIFQFPLQWFGVPA  110 (273)
T ss_dssp             SEEEEEEECBTTBCCH
T ss_pred             CEEEEECCHHHCCCCH
T ss_conf             9899976756538588


No 33 
>1hv9_A UDP-N-acetylglucosamine pyrophosphorylase; LEFT-handed parallel beta-helix, transferase; HET: COA UD1; 2.10A {Escherichia coli} SCOP: b.81.1.4 c.68.1.5 PDB: 2oi5_A* 2oi6_A* 2oi7_A* 3fww_A 1fxj_A* 1fwy_A*
Probab=22.24  E-value=35  Score=13.75  Aligned_cols=24  Identities=25%  Similarity=0.481  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             999999999974998899973987
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      +|.-++.+|.+.||+.++++.+|.
T Consensus        35 li~y~l~~L~~~g~~eiivv~~~~   58 (456)
T 1hv9_A           35 MVQHVIDAANELGAAHVHLVYGHG   58 (456)
T ss_dssp             HHHHHHHHHHHHTCSCEEEEECSC
T ss_pred             HHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             999999999877998799993799


No 34 
>2aam_A Hypothetical protein TM1410; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: MSE UNL; 2.20A {Thermotoga maritima} SCOP: c.1.8.15
Probab=21.42  E-value=37  Score=13.65  Aligned_cols=111  Identities=13%  Similarity=-0.009  Sum_probs=65.3

Q ss_pred             HCCHHHHHHCCC---CCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCC-
Q ss_conf             669798973104---9889993200124797465226789999999999983566773999140232678011368873-
Q gi|254780633|r    9 DNSLPLCADARK---DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT-   84 (267)
Q Consensus         9 ~lT~~e~~~~~~---~~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGT-   84 (267)
                      ..|-.||+.+++   ..++.|.+|++|..-+.-.-.             .....+   .++...        ..++||. 
T Consensus        56 ~~t~~~i~~L~~~g~~viaYlsvGe~e~~R~Y~~~~-------------~~~~~~---~~~~~~--------~~~W~g~~  111 (309)
T 2aam_A           56 EYSPEEIKIMVDAGVVPVAYVNIGQAEDYRFYWKES-------------WYTNTP---EWLGEE--------DPAWPGNY  111 (309)
T ss_dssp             BCCHHHHHHHHHTTCEEEEEEESSEEETTSTTCCTH-------------HHHSCC---TTEEEE--------ETTEEEEE
T ss_pred             CCCHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCHH-------------HHHCCH---HHHCCC--------CCCCCCCE
T ss_conf             689999999986896899999654113552324133-------------442798---884778--------99999984


Q ss_pred             -EECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC----------C-------CHHHHHHHHHHHHHHCCEEEEEEC
Q ss_conf             -3309999999999999999974998899973987----------8-------678999999998635583999824
Q gi|254780633|r   85 -KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG----------G-------NSPLVSIVSTEARMRFSMLVVSTS  143 (267)
Q Consensus        85 -isl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHg----------G-------N~~~l~~a~~~l~~~~~~~~~~~~  143 (267)
                       +.++......++...+..+...||.-+.+=|--+          +       ....+...++.++.+++...+..+
T Consensus       112 ~vd~~~~~w~~~~~~r~~~~~~~G~dGv~lD~vD~y~~~~~~~~~~~~~~~~~m~~~l~~L~~~~r~r~P~~~ii~N  188 (309)
T 2aam_A          112 FVKYWYNEWKEIVFSYLDRVIDQGFKGIYLDRIDSFEYWAQEGVISRRSAARKMINFVLEIAEYVRERKPDMLIIPQ  188 (309)
T ss_dssp             EECTTSHHHHHHHHHHHHHHHHTTCSEEEEECTTHHHHHHHHTSSCHHHHHHHHHHHHHHHHHHHHHHCTTCEEEEB
T ss_pred             EEECCHHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             78677499999999999999974998598535412320344577523557999999999999999975899589964


No 35 
>1rcu_A Conserved hypothetical protein VT76; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.50A {Thermotoga maritima} SCOP: c.129.1.1
Probab=20.93  E-value=37  Score=13.58  Aligned_cols=48  Identities=21%  Similarity=0.258  Sum_probs=37.0

Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEEE
Q ss_conf             99999999999999974998899973987867899999999863558399982
Q gi|254780633|r   90 AEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST  142 (267)
Q Consensus        90 ~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~~  142 (267)
                      ..+.++..++.+.|++.|+   .+++|  |+...++++++-..+..+..+-+.
T Consensus        41 ~~~~~~a~elG~~La~~G~---~V~~G--G~~GlM~a~a~ga~~~GG~viGIi   88 (195)
T 1rcu_A           41 SELRDICLELGRTLAKKGY---LVFNG--GRDGVMELVSQGVREAGGTVVGIL   88 (195)
T ss_dssp             GGGHHHHHHHHHHHHHTTC---EEEEC--CSSHHHHHHHHHHHHTTCCEEEEE
T ss_pred             HHHHHHHHHHHHHHHHCCC---EEECC--CHHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             8999999999999998799---99948--727488999998886299068873


No 36 
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A*
Probab=20.84  E-value=38  Score=13.57  Aligned_cols=24  Identities=8%  Similarity=0.142  Sum_probs=18.9

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             999999999974998899973987
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      ++.-++..|.+.|+++|+|+.++-
T Consensus        35 li~~~i~~l~~~gi~~i~iv~~~~   58 (281)
T 3juk_A           35 LIQYAVEEAMEAGCEVMAIVTGRN   58 (281)
T ss_dssp             HHHHHHHHHHHHTCCEEEEEECTT
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             999999999986998999988577


No 37 
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC structure funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A
Probab=20.74  E-value=38  Score=13.56  Aligned_cols=44  Identities=14%  Similarity=0.033  Sum_probs=31.2

Q ss_pred             HHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEEE
Q ss_conf             99999974998899973987867899999999863558399982
Q gi|254780633|r   99 IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST  142 (267)
Q Consensus        99 i~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~~  142 (267)
                      ..++|.-+|+=||.|++.=-||..+++.+.+.+..+....++..
T Consensus        16 ~~~~~~~~~~MKI~iiSDiHgn~~ale~vl~~~~~~~~D~vi~l   59 (190)
T 1s3l_A           16 TTENLYFQGHMKIGIMSDTHDHLPNIRKAIEIFNDENVETVIHC   59 (190)
T ss_dssp             ----------CEEEEECCCTTCHHHHHHHHHHHHHSCCSEEEEC
T ss_pred             CCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             75344236875899998089996999999999975599999987


No 38 
>2qmq_A Protein NDRG2, protein NDR2; 15277975, NDR family, N-MYC downstream regulated 2, structural genomics, joint center for structural genomics, JCSG; HET: 2PE; 1.70A {Mus musculus}
Probab=20.37  E-value=38  Score=13.51  Aligned_cols=62  Identities=8%  Similarity=0.006  Sum_probs=30.1

Q ss_pred             CCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC-CCCHHHHHHH
Q ss_conf             773999140232678011368873330999999999999999997499889997398-7867899999
Q gi|254780633|r   61 RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH-GGNSPLVSIV  127 (267)
Q Consensus        61 ~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH-gGN~~~l~~a  127 (267)
                      +..++..=..-+|.|.......    ....++.++..|+..-+...|+++++++... ||.. ++..+
T Consensus        67 ~~~vi~~D~~G~G~s~~~~~~~----~~~~s~~~~a~dl~~~l~~l~~~~~~lvGhS~Gg~v-a~~~A  129 (286)
T 2qmq_A           67 NFVRVHVDAPGMEEGAPVFPLG----YQYPSLDQLADMIPCILQYLNFSTIIGVGVGAGAYI-LSRYA  129 (286)
T ss_dssp             TSCEEEEECTTTSTTCCCCCTT----CCCCCHHHHHHTHHHHHHHHTCCCEEEEEETHHHHH-HHHHH
T ss_pred             CCEEEEEECCCCCCCCCCCCCC----CCCCCHHHHHHHHHHHHHHCCCCEEEEEEECHHHHH-HHHHH
T ss_conf             9989999699989999999988----775779999999999999859980899998883799-99999


Done!