Query         gi|254780633|ref|YP_003065046.1| creatinine amidohydrolase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 267
No_of_seqs    115 out of 722
Neff          7.4 
Searched_HMMs 13730
Date          Wed Jun  1 08:45:11 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780633.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1v7za_ c.125.1.1 (A:) Creatin 100.0       0       0  449.8  24.4  238    3-257     1-256 (257)
  2 d1dkua1 c.61.1.2 (A:8-166) Pho  89.1    0.67 4.9E-05   23.2   7.6   70   42-120    62-131 (159)
  3 d1u9ya1 c.61.1.2 (A:1-155) Pho  70.5     3.1 0.00023   19.0   7.0   68   42-119    60-127 (155)
  4 d2c4ka1 c.61.1.2 (A:7-166) PRP  65.7     3.9 0.00028   18.3   8.5   83   19-120    50-133 (160)
  5 d1tzfa_ c.68.1.13 (A:) Glucose  59.4     3.9 0.00028   18.3   3.2   34   85-121    28-61  (259)
  6 d2nlya1 c.6.2.7 (A:31-254) Hyp  44.0     8.8 0.00064   16.1   7.4   76   55-137    46-128 (224)
  7 d1gmxa_ c.46.1.3 (A:) Sulfurtr  39.3      10 0.00076   15.6   4.0   45   81-134    37-81  (108)
  8 d1jyka_ c.68.1.13 (A:) CTP:pho  35.0      12 0.00088   15.2   3.5   48   85-141    29-76  (229)
  9 d2pl5a1 c.69.1.40 (A:5-366) Ho  34.2     7.8 0.00057   16.4   1.5   96    3-117    25-148 (362)
 10 d2aama1 c.1.8.15 (A:28-312) Hy  32.2      13 0.00098   14.9   8.6  110   10-143    44-175 (285)
 11 d1jqna_ c.1.12.3 (A:) Phosphoe  29.6      12 0.00085   15.3   1.8   49   70-121   534-582 (880)
 12 d2cxha1 c.51.1.2 (A:13-192) Pr  29.4      13 0.00091   15.1   1.9   28   95-122    39-66  (180)
 13 d1ovma2 c.36.1.5 (A:3-180) Ind  28.1      16  0.0012   14.4   4.1   29   98-127     8-36  (178)
 14 d1d4aa_ c.23.5.3 (A:) NAD(P)H:  27.3      16  0.0012   14.4   4.9   22  228-249   193-214 (273)
 15 d1fxoa_ c.68.1.6 (A:) RmlA (Rf  25.9      17  0.0013   14.2   2.7   22   97-118    36-57  (292)
 16 d1vi2a1 c.2.1.7 (A:107-288) Pu  25.6      18  0.0013   14.2   7.5   51   97-147    31-81  (182)
 17 d1mc3a_ c.68.1.6 (A:) RffH {Es  24.8      18  0.0013   14.1   2.7   19   99-117    38-56  (291)
 18 d2noca1 d.230.6.1 (A:1-91) Put  23.2      19  0.0014   13.9   2.4   39   82-120    40-79  (91)
 19 d1jqoa_ c.1.12.3 (A:) Phosphoe  23.2      19  0.0014   13.9   2.9   49   70-121   563-611 (936)
 20 d2vata1 c.69.1.40 (A:7-382) Ac  22.7      11 0.00082   15.4   0.6   92    4-120    28-147 (376)
 21 d1bn7a_ c.69.1.8 (A:) Haloalka  22.0      21  0.0015   13.7   3.1   53   60-121    54-108 (291)
 22 d1yp2a2 c.68.1.6 (A:10-316) Gl  20.2      22  0.0016   13.5   2.7   23   97-119    47-69  (307)

No 1  
>d1v7za_ c.125.1.1 (A:) Creatininase {Pseudomonas putida [TaxId: 303]}
Probab=100.00  E-value=0  Score=449.79  Aligned_cols=238  Identities=25%  Similarity=0.328  Sum_probs=197.7

Q ss_pred             CCCCHHHCCHHHHHH-CC-CCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCC
Q ss_conf             664046669798973-10-4988999320012479746522678999999999998356677399914023267801136
Q gi|254780633|r    3 PLIIFTDNSLPLCAD-AR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY   80 (267)
Q Consensus         3 ~~~~~~~lT~~e~~~-~~-~~~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~   80 (267)
                      .+++|++|||+|+++ ++ +++|+|||+||+||||||||+|||+++++++|+++|+++    +++|+|++|||+|++|+.
T Consensus         1 ~~~~l~~lT~~Ev~~~l~~~~~v~ilPvGs~EqHGpHLPlgtD~~ia~~ia~~~a~~~----~~~v~P~i~~G~s~~h~~   76 (257)
T d1v7za_           1 KSVFVGELTWKEYEARVAAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAERI----GALVMPGLQYGYKSQQKS   76 (257)
T ss_dssp             CCCBGGGSCHHHHHHHHHTSCCCEEEEECCBCCCCSSBCTTHHHHHHHHHHHHHHHHH----TCEECCCBCCCBCCCHHH
T ss_pred             CCEEHHHCCHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC----CCEECCCCCCCCCCCCCC
T ss_conf             9573774798999999836997899956563046987522589999999999999877----992836515576633457


Q ss_pred             -----CCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHH----HHHHHHHHHHHC--CEEEEEECCCCCCC
Q ss_conf             -----8873330999999999999999997499889997398786789----999999986355--83999824765456
Q gi|254780633|r   81 -----VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL----VSIVSTEARMRF--SMLVVSTSWSRFTI  149 (267)
Q Consensus        81 -----fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~----l~~a~~~l~~~~--~~~~~~~~~~~~~~  149 (267)
                           ||||||++++||.++|+||++||++|||||||||||||||..+    ++.++++++.+.  +..+...+||....
T Consensus        77 ~~~~~fPGTisl~~~t~~~~l~di~~sl~~~Gfr~ivivNgHgGN~~~~~~~~~~~~~el~~~~~~~~~~~~~~~~~~~~  156 (257)
T d1v7za_          77 GGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYENSMFIVEGIDLALRELRYAGIQDFKVVVLSYWDFVK  156 (257)
T ss_dssp             HSCTTSSSCBCBCHHHHHHHHHHHHHHHHHHTCCEEEEEECSGGGHHHHHHHHHHHHHHHHHTTCCCCEEEEEEGGGGCC
T ss_pred             CCCCCCCCEEEECHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCC
T ss_conf             65567785476077889999999999999708856999940677737899999999999765237740799997022245


Q ss_pred             HHHH----C-CCCCCCCCCCCCHHHHHHHHHHCCCCCCHHHCCCCCCCCCCHHCCCCCCCCCCCCCCCCCHHHCCCCCCE
Q ss_conf             5641----3-6655667886877999999997813268332466764432000134000137763320228880988104
Q gi|254780633|r  150 PQGI----I-SFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV  224 (267)
Q Consensus       150 ~~~~----~-~~~~~~~g~HAge~ETS~~lal~PelV~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~Gv~  224 (267)
                      ....    . .......++|||+.|||+|||++||+|+++++.+..+......           ..+.|...+.+++|++
T Consensus       157 ~~~~~~~~~~~~~~~~~~~HAge~ETS~~l~l~PelV~~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~G~~  225 (257)
T d1v7za_         157 DPAVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLVDLDRVVDHPPATFPPY-----------DVFPVDPARTPAPGTL  225 (257)
T ss_dssp             CHHHHHHHCTTCCCCSTTCSSSHHHHHHHHHHCGGGBCGGGCCCCCCCCCCSS-----------EEESCCGGGSCTTSCS
T ss_pred             CHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCHHHCCHHHHCCCCCCCCCCC-----------CCCCCCHHHCCCCCEE
T ss_conf             61666664124545667877668899999986966447133100377777722-----------2335657442989757


Q ss_pred             ECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             144307999999999999999999999999585
Q gi|254780633|r  225 GNAMDATVKKGEGLLSYFANCFIQLLNDINSFD  257 (267)
Q Consensus       225 GdP~~At~E~G~~~~~~~v~~l~~~i~e~~~~~  257 (267)
                      |||+.||+|+|+++++.+++.++++|+|  +|+
T Consensus       226 Gdp~~At~E~G~~lle~~~~~l~~~i~e--~~p  256 (257)
T d1v7za_         226 SSAKTASREKGELILEVCVQGIADAIRE--EFP  256 (257)
T ss_dssp             SCCTTCCHHHHHHHHHHHHHHHHHHHHH--HSC
T ss_pred             ECCCCCCHHHHHHHHHHHHHHHHHHHHH--HCC
T ss_conf             1734027999999999999999999974--578


No 2  
>d1dkua1 c.61.1.2 (A:8-166) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]}
Probab=89.13  E-value=0.67  Score=23.20  Aligned_cols=70  Identities=11%  Similarity=0.172  Sum_probs=50.6

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             6789999999999983566773999140232678011368873330999999999999999997499889997398786
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      .|.++---+.-.++++.+.+.-.+|+|  +|||+-....|-.--.++..++..+       |...|+.+++.++=|-.+
T Consensus        62 nd~lmelll~~~a~k~~~A~~i~~ViP--Y~~YsRQDr~~~~ge~isak~vA~l-------L~~~G~d~vitvDlH~~~  131 (159)
T d1dkua1          62 NEHIMELLIMVDALKRASAKTINIVIP--YYGYARQDRKARSREPITAKLFANL-------LETAGATRVIALDLHAPQ  131 (159)
T ss_dssp             HHHHHHHHHHHHHHHHTTCSEEEEEES--SCTTTTCCSCSSTTCCCHHHHHHHH-------HHHHTCCEEEEESCSSGG
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEEC--CCCHHHHCCCCCCCCCEEHHHHHHH-------HHHCCCCEEEEECCCCHH
T ss_conf             789999999999999757762078602--1211010123489985239998636-------764187626885278588


No 3  
>d1u9ya1 c.61.1.2 (A:1-155) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]}
Probab=70.49  E-value=3.1  Score=18.95  Aligned_cols=68  Identities=12%  Similarity=0.109  Sum_probs=43.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             678999999999998356677399914023267801136887333099999999999999999749988999739878
Q gi|254780633|r   42 TDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        42 tD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      .|.++--.+.-.+++..+.+.-.+|+|-++  |+-....|-.--.++..++..++        ..|..+++.++=|--
T Consensus        60 ~d~lmelll~~da~~~~~a~~I~~ViPY~~--YaRQDr~~~~ge~iSak~va~ll--------~~g~d~iitvDlH~~  127 (155)
T d1u9ya1          60 NDAIVETILLCDALRDEGVKKITLVAPYLA--YARQDKKFNPGEAISIRALAKIY--------SNIVDKLITINPHET  127 (155)
T ss_dssp             HHHHHHHHHHHHHHHTTTCCEEEEECSSCT--TCSCSSCSSTTBCCHHHHHHHHH--------HHHCSEEEEESCSCG
T ss_pred             CHHHHHHHHHHHHHHHHCCCCEEEECCCCH--HHCCCCCCCCCCCCCHHHHHHHH--------HHCCCCEEEEECCCH
T ss_conf             637889999999999847860478404303--20033123899752189999998--------640271599717857


No 4  
>d2c4ka1 c.61.1.2 (A:7-166) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]}
Probab=65.70  E-value=3.9  Score=18.34  Aligned_cols=83  Identities=14%  Similarity=0.225  Sum_probs=51.6

Q ss_pred             CCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCC-CCCEECCHHHHHHHHH
Q ss_conf             049889993200124797465226789999999999983566773999140232678011368-8733309999999999
Q gi|254780633|r   19 RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-DGTKTLTYAEAIEHWL   97 (267)
Q Consensus        19 ~~~~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~f-pGTisl~~~t~~~~l~   97 (267)
                      +.++|+|+-  ++-+     | --|.++--.+.-.+++..+.+.-.+|+|-++  |+-....| +|.++  ..       
T Consensus        50 rg~~V~ivq--s~~~-----~-~n~~lmeLll~~da~k~~~a~~It~ViPY~~--YaRQDk~~~~g~i~--a~-------  110 (160)
T d2c4ka1          50 RGQDIFIIQ--TIPR-----D-VNTAVMELLIMAYALKTACARNIIGVIPYFP--YSKQSKMRKRGSIV--CK-------  110 (160)
T ss_dssp             TTCCEEEEC--CCCS-----C-HHHHHHHHHHHHHHHHHTTCSCEEEEESSCT--TTTTTSCCSSSCCH--HH-------
T ss_pred             CCCCEEEEE--CCCC-----C-HHHHHHHHHHHHHHHHHHCCCCCEEECCCCH--HHHCCCCCCCCCCH--HH-------
T ss_conf             688248995--1675-----3-0779999999999999847455344023441--22054334577701--78-------


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             99999997499889997398786
Q gi|254780633|r   98 AIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        98 di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      -++..|...|+.+++.++=|-.+
T Consensus       111 ~va~~l~~~g~d~vitvDlH~~~  133 (160)
T d2c4ka1         111 LLASMLAKAGLTHIITMDLHQKE  133 (160)
T ss_dssp             HHHHHHHHTCCCEEEEESCSSGG
T ss_pred             HHHHHHHHCCCCEEEEECCCHHH
T ss_conf             88767765286437896168088


No 5  
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]}
Probab=59.38  E-value=3.9  Score=18.32  Aligned_cols=34  Identities=18%  Similarity=0.209  Sum_probs=25.4

Q ss_pred             EECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             3309999999999999999974998899973987867
Q gi|254780633|r   85 KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        85 isl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      +.+...+++.+   ++..|.++|+++|+|+.||.++.
T Consensus        28 l~i~gkplI~~---~i~~l~~~gi~~i~iv~gy~~~~   61 (259)
T d1tzfa_          28 VEIGGKPILWH---IMKMYSVHGIKDFIICCGYKGYV   61 (259)
T ss_dssp             CEETTEEHHHH---HHHHHHHTTCCEEEEEECTTHHH
T ss_pred             EEECCEEHHHH---HHHHHHHCCCCEEEECCCHHHHH
T ss_conf             49999999999---99999983997453120021789


No 6  
>d2nlya1 c.6.2.7 (A:31-254) Hypothetical protein BH1492 {Bacillus halodurans [TaxId: 86665]}
Probab=44.00  E-value=8.8  Score=16.06  Aligned_cols=76  Identities=20%  Similarity=0.198  Sum_probs=47.4

Q ss_pred             HHHCCCCCEEEEECCCCCCCCHHHCCCCCC--EECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC-----CHHHHHHH
Q ss_conf             983566773999140232678011368873--33099999999999999999749988999739878-----67899999
Q gi|254780633|r   55 KSILPPRLPVTCMPVEPIGYSIEHMYVDGT--KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG-----NSPLVSIV  127 (267)
Q Consensus        55 a~~~~~~~~~~v~P~i~yG~s~~h~~fpGT--isl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgG-----N~~~l~~a  127 (267)
                      |+..+.+ -.+-+|.-|.++...-.+ |++  .+.+.+.+...|...+.+     |-..+=+|+|-|     |..+++.+
T Consensus        46 A~~~g~E-vllhlPMep~~~~~~~~g-p~~L~~~~~~~ei~~~l~~~l~~-----vP~avGvnNhmGS~~T~~~~~m~~v  118 (224)
T d2nlya1          46 AQAAGLE-VIVHMPLEPKKGKISWLG-PSGITSNLSVGEVKSRVRKAFDD-----IPYAVGLNNHMGSKIVENEKIMRAI  118 (224)
T ss_dssp             HHHTTCE-EEEEEEECCC---------CCCBCTTCCHHHHHHHHHHHHHH-----STTCCEEEEEECTTGGGCHHHHHHH
T ss_pred             HHHCCCE-EEEECCCCCCCCCCCCCC-CCCCCCCCCHHHHHHHHHHHHHH-----CCCCEEEECCCCCCHHCCHHHHHHH
T ss_conf             9987986-999745575667767888-77677789999999999999984-----7364797137664111798999999


Q ss_pred             HHHHHHHCCE
Q ss_conf             9998635583
Q gi|254780633|r  128 STEARMRFSM  137 (267)
Q Consensus       128 ~~~l~~~~~~  137 (267)
                      .+.++.+.-.
T Consensus       119 ~~~l~~~gl~  128 (224)
T d2nlya1         119 LEVVKEKNAF  128 (224)
T ss_dssp             HHHHHHTTCE
T ss_pred             HHHHHHCCCE
T ss_conf             9999776978


No 7  
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]}
Probab=39.33  E-value=10  Score=15.61  Aligned_cols=45  Identities=13%  Similarity=-0.073  Sum_probs=21.2

Q ss_pred             CCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             887333099999999999999999749988999739878678999999998635
Q gi|254780633|r   81 VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR  134 (267)
Q Consensus        81 fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~  134 (267)
                      .||.+.++.+.+...+.++      ..=++++++-.+ |...  ..++..+...
T Consensus        37 I~gA~~ip~~~l~~~~~~~------~~~~~ivv~c~~-g~rs--~~~a~~L~~~   81 (108)
T d1gmxa_          37 AVQAFHLTNDTLGAFMRDN------DFDTPVMVMCYH-GNSS--KGAAQYLLQQ   81 (108)
T ss_dssp             ETTCEECCHHHHHHHHHHS------CTTSCEEEECSS-SSHH--HHHHHHHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHC------CCCCCCCCCCCC-CHHH--HHHHHHHHHC
T ss_conf             7875210001178875300------246762321799-7489--9999999984


No 8  
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]}
Probab=35.02  E-value=12  Score=15.18  Aligned_cols=48  Identities=17%  Similarity=0.254  Sum_probs=29.4

Q ss_pred             EECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             330999999999999999997499889997398786789999999986355839998
Q gi|254780633|r   85 KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS  141 (267)
Q Consensus        85 isl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~  141 (267)
                      +.+...+++.+   +++.|.+.|+++|+|+.||-++.  ++.    +...++..+..
T Consensus        29 l~i~gkpli~~---~i~~l~~~g~~~i~iv~g~~~e~--i~~----~~~~~~i~i~~   76 (229)
T d1jyka_          29 VQVNQKPLIEY---QIEFLKEKGINDIIIIVGYLKEQ--FDY----LKEKYGVRLVF   76 (229)
T ss_dssp             CEETTEEHHHH---HHHHHHHTTCCCEEEEECTTGGG--GTH----HHHHHCCEEEE
T ss_pred             EEECCEEHHHH---HHHHHHHHCCCCCCCCCCCCHHH--HHH----HHHHCCCCCCC
T ss_conf             07998789999---99999872876543413544113--445----42201213222


No 9  
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]}
Probab=34.16  E-value=7.8  Score=16.39  Aligned_cols=96  Identities=11%  Similarity=0.082  Sum_probs=48.9

Q ss_pred             CCCCHHHCCHHHHHHCCCCCEEEEEECCCCCC--------------------CCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             66404666979897310498899932001247--------------------9746522678999999999998356677
Q gi|254780633|r    3 PLIIFTDNSLPLCADARKDWIVVLPLGAYEQH--------------------GPHLPMNTDTIIAAGLAERIKSILPPRL   62 (267)
Q Consensus         3 ~~~~~~~lT~~e~~~~~~~~vvilPvGs~EqH--------------------GpHlPlgtD~~~a~~ia~~~a~~~~~~~   62 (267)
                      +.++++..||.++ +..++-+|++|-+-+=.|                    ||..|+.||-                  
T Consensus        25 ~~~~l~Y~t~G~l-n~~~~NaVlv~h~~tG~~~~~g~~~~~~~~~gww~~liG~g~~lDt~~------------------   85 (362)
T d2pl5a1          25 SPVVIAYETYGTL-SSSKNNAILICHALSGDAHAAGYHSGSDKKPGWWDDYIGPGKSFDTNQ------------------   85 (362)
T ss_dssp             SSEEEEEEEEECC-CTTSCCEEEEECCSSCCSCCSSBSSTTCSSCCTTTTTEETTSSEETTT------------------
T ss_pred             CCCEEEEEEEECC-CCCCCCEEEECCCCCCCHHCCCCCCCCCCCCCHHHHHCCCCCCCCCCC------------------
T ss_conf             8956999963033-888998899878877632115567766788335888459997647553------------------


Q ss_pred             EEEEECCCC---CCCCHHHCCCCCC-----EECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             399914023---2678011368873-----330999999999999999997499889997398
Q gi|254780633|r   63 PVTCMPVEP---IGYSIEHMYVDGT-----KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH  117 (267)
Q Consensus        63 ~~~v~P~i~---yG~s~~h~~fpGT-----isl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH  117 (267)
                      =.+|+|-+.   ||.|+....-|-|     ...+.-|+.+++.....-+-+-|++|+..|-|-
T Consensus        86 yfVI~~n~lG~~~~ss~~~s~~p~~~~~yg~~fP~~t~~D~v~~~~~ll~~LGI~~l~~viG~  148 (362)
T d2pl5a1          86 YFIICSNVIGGCKGSSGPLSIHPETSTPYGSRFPFVSIQDMVKAQKLLVESLGIEKLFCVAGG  148 (362)
T ss_dssp             CEEEEECCTTCSSSSSSTTSBCTTTSSBCGGGSCCCCHHHHHHHHHHHHHHTTCSSEEEEEEE
T ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEEH
T ss_conf             579962335676666675420012345557677520168899999999997186726777403


No 10 
>d2aama1 c.1.8.15 (A:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]}
Probab=32.17  E-value=13  Score=14.88  Aligned_cols=110  Identities=14%  Similarity=-0.018  Sum_probs=63.8

Q ss_pred             CCHHHHHHCCCC---CEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCCCCC--
Q ss_conf             697989731049---889993200124797465226789999999999983566773999140232678011368873--
Q gi|254780633|r   10 NSLPLCADARKD---WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT--   84 (267)
Q Consensus        10 lT~~e~~~~~~~---~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~fpGT--   84 (267)
                      .|-.||+.+++.   .++.|.+|..|.+-++-.-....             ...   .++...        ...+||.  
T Consensus        44 ~t~~~i~~L~~~g~~viaYlsvGe~e~~R~yw~~~~~~-------------~~~---~~~~~~--------~~~W~~~~~   99 (285)
T d2aama1          44 YSPEEIKIMVDAGVVPVAYVNIGQAEDYRFYWKESWYT-------------NTP---EWLGEE--------DPAWPGNYF   99 (285)
T ss_dssp             CCHHHHHHHHHTTCEEEEEEESSEEETTSTTCCTHHHH-------------SCC---TTEEEE--------ETTEEEEEE
T ss_pred             CCHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCHHHHC-------------CCH---HHHCCC--------CCCCCCCEE
T ss_conf             79999999985897799998633014553323233431-------------888---884788--------999998756


Q ss_pred             EECCHHHHHHHHHHHHHHHHHCCCCEEEEECC----------CCCC-------HHHHHHHHHHHHHHCCEEEEEEC
Q ss_conf             33099999999999999999749988999739----------8786-------78999999998635583999824
Q gi|254780633|r   85 KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNA----------HGGN-------SPLVSIVSTEARMRFSMLVVSTS  143 (267)
Q Consensus        85 isl~~~t~~~~l~di~~sl~~~Gf~~iviiNg----------HgGN-------~~~l~~a~~~l~~~~~~~~~~~~  143 (267)
                      +.++......+|...+..+...||.-+.+=|-          ..+.       ...+...++.++.+++...+..+
T Consensus       100 vd~~~~~w~~il~~ri~~~~~~GfDGvflD~lD~y~~~~~~~~~~~~~~~~~m~~~v~~I~~~~r~~~P~~~ii~n  175 (285)
T d2aama1         100 VKYWYNEWKEIVFSYLDRVIDQGFKGIYLDRIDSFEYWAQEGVISRRSAARKMINFVLEIAEYVRERKPDMLIIPQ  175 (285)
T ss_dssp             ECTTSHHHHHHHHHHHHHHHHTTCSEEEEECTTHHHHHHHHTSSCHHHHHHHHHHHHHHHHHHHHHHCTTCEEEEB
T ss_pred             EECCCHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             7468699999999999999984898598535302432113577761668999999999999999974899789974


No 11 
>d1jqna_ c.1.12.3 (A:) Phosphoenolpyruvate carboxylase {Escherichia coli [TaxId: 562]}
Probab=29.63  E-value=12  Score=15.27  Aligned_cols=49  Identities=27%  Similarity=0.407  Sum_probs=31.1

Q ss_pred             CCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             2326780113688733309999999999999999974998899973987867
Q gi|254780633|r   70 EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        70 i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      |..|||....+ .|-++-..+.+.+-. .+..-..++|+ ++.|++||||-.
T Consensus       534 VMlGYSDS~KD-gG~laa~w~ly~aq~-~L~~~~~~~gv-~l~~FhGRGGsv  582 (880)
T d1jqna_         534 VMIGYSDSAKD-AGVMAASWAQYQAQD-ALIKTCEKAGI-ELTLFHGRGGSI  582 (880)
T ss_dssp             EEECHHHHHHH-HCHHHHHHHHHHHHH-HHHHHHHHHTC-EEEEEECSSTGG
T ss_pred             HHHCCCCCCCH-HHHHHHHHHHHHHHH-HHHHHHHHCCC-CEEEEECCCCCC
T ss_conf             33133544431-568887799999999-99999997498-379860678765


No 12 
>d2cxha1 c.51.1.2 (A:13-192) Probable ribosomal biogenesis protein {Archaeon Aeropyrum pernix [TaxId: 56636]}
Probab=29.41  E-value=13  Score=15.09  Aligned_cols=28  Identities=18%  Similarity=0.245  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCHH
Q ss_conf             9999999999749988999739878678
Q gi|254780633|r   95 HWLAIIDAIRKMGIRKIVILNAHGGNSP  122 (267)
Q Consensus        95 ~l~di~~sl~~~Gf~~iviiNgHgGN~~  122 (267)
                      -+.|++......||++++|+|-|-||..
T Consensus        39 ~lk~i~~~a~~~~~t~liiv~e~~~~p~   66 (180)
T d2cxha1          39 SMEELAREAIIRGADRIVVVGERRGNPG   66 (180)
T ss_dssp             CHHHHHHHHHHTTEEEEEEEEEETTEEE
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCC
T ss_conf             1999999998779986999981489995


No 13 
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]}
Probab=28.11  E-value=16  Score=14.45  Aligned_cols=29  Identities=14%  Similarity=0.220  Sum_probs=18.7

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             999999974998899973987867899999
Q gi|254780633|r   98 AIIDAIRKMGIRKIVILNAHGGNSPLVSIV  127 (267)
Q Consensus        98 di~~sl~~~Gf~~iviiNgHgGN~~~l~~a  127 (267)
                      -+++.|.++|+++++-+-|. .|.+.++.+
T Consensus         8 ~iv~~L~~~GV~~vFg~pG~-~~~~l~~al   36 (178)
T d1ovma2           8 YLLDRLTDCGADHLFGVPGD-YNLQFLDHV   36 (178)
T ss_dssp             HHHHHHHHTTCCEEEECCCG-GGHHHHHHH
T ss_pred             HHHHHHHHCCCCEEEEECCH-HHHHHHHHH
T ss_conf             99999998799999994785-089999999


No 14 
>d1d4aa_ c.23.5.3 (A:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]}
Probab=27.33  E-value=16  Score=14.36  Aligned_cols=22  Identities=5%  Similarity=0.013  Sum_probs=9.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             3079999999999999999999
Q gi|254780633|r  228 MDATVKKGEGLLSYFANCFIQL  249 (267)
Q Consensus       228 ~~At~E~G~~~~~~~v~~l~~~  249 (267)
                      ..++.++-++.++...+++..+
T Consensus       193 ~~~~~~~r~~~le~~~~~l~~L  214 (273)
T d1d4aa_         193 GHTPADARIQILEGWKKRLENI  214 (273)
T ss_dssp             GGSCHHHHHHHHHHHHHHHTTG
T ss_pred             CCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9899999999999999999864


No 15 
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]}
Probab=25.89  E-value=17  Score=14.19  Aligned_cols=22  Identities=23%  Similarity=0.394  Sum_probs=14.4

Q ss_pred             HHHHHHHHHCCCCEEEEECCCC
Q ss_conf             9999999974998899973987
Q gi|254780633|r   97 LAIIDAIRKMGIRKIVILNAHG  118 (267)
Q Consensus        97 ~di~~sl~~~Gf~~iviiNgHg  118 (267)
                      .-++..|...|+++|+|+++|.
T Consensus        36 ~~~l~~l~~~Gi~ei~ii~~~~   57 (292)
T d1fxoa_          36 YYPLSTLMLAGIREILIISTPQ   57 (292)
T ss_dssp             HHHHHHHHHTTCCEEEEEECTT
T ss_pred             HHHHHHHHHCCCCEEEEEECCC
T ss_conf             9999999987997899995767


No 16 
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]}
Probab=25.56  E-value=18  Score=14.15  Aligned_cols=51  Identities=14%  Similarity=0.037  Sum_probs=37.7

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEEECCCCC
Q ss_conf             999999997499889997398786789999999986355839998247654
Q gi|254780633|r   97 LAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRF  147 (267)
Q Consensus        97 ~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~~~~~~~~~~~~~~  147 (267)
                      +.++..|..+|+++|.++|-.--+..-+...++++...+...+....|...
T Consensus        31 rai~~al~~~g~~~i~i~nR~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~   81 (182)
T d1vi2a1          31 TAIGAQGAIEGLKEIKLFNRRDEFFDKALAFAQRVNENTDCVVTVTDLADQ   81 (182)
T ss_dssp             HHHHHHHHHTTCSEEEEEECSSTTHHHHHHHHHHHHHHSSCEEEEEETTCH
T ss_pred             HHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             999999864487367642330677999999999987624763476520100


No 17 
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]}
Probab=24.75  E-value=18  Score=14.06  Aligned_cols=19  Identities=26%  Similarity=0.496  Sum_probs=10.0

Q ss_pred             HHHHHHHCCCCEEEEECCC
Q ss_conf             9999997499889997398
Q gi|254780633|r   99 IIDAIRKMGIRKIVILNAH  117 (267)
Q Consensus        99 i~~sl~~~Gf~~iviiNgH  117 (267)
                      ++..|...|+++|+|+.+|
T Consensus        38 ~l~~l~~~gi~~i~iv~~~   56 (291)
T d1mc3a_          38 PLSVLMLAGIREILIITTP   56 (291)
T ss_dssp             HHHHHHHTTCCEEEEEECT
T ss_pred             HHHHHHHCCCCEEEEEECC
T ss_conf             9999998699889999374


No 18 
>d2noca1 d.230.6.1 (A:1-91) Putative periplasmic protein YahO {Salmonella choleraesuis [TaxId: 28901]}
Probab=23.16  E-value=19  Score=13.87  Aligned_cols=39  Identities=18%  Similarity=0.215  Sum_probs=26.0

Q ss_pred             CCCEECC-HHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             8733309-99999999999999997499889997398786
Q gi|254780633|r   82 DGTKTLT-YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN  120 (267)
Q Consensus        82 pGTisl~-~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN  120 (267)
                      -||||++ ..+..++-.++.+---..|-+.++|+..++.|
T Consensus        40 iG~Isv~~~~sp~d~~~~Ls~KAd~~GA~~y~Iis~~~~~   79 (91)
T d2noca1          40 IGTISTTGEMSPLDAREDLIKKADEKGADVVVLTSGQTEN   79 (91)
T ss_dssp             EEEEECCSCCCHHHHHHHHHHHHHHTCCSEEECCSCCSSS
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCC
T ss_conf             4699988989979999999999998499889999835899


No 19 
>d1jqoa_ c.1.12.3 (A:) Phosphoenolpyruvate carboxylase {Escherichia coli [TaxId: 562]}
Probab=23.16  E-value=19  Score=13.87  Aligned_cols=49  Identities=16%  Similarity=0.332  Sum_probs=29.9

Q ss_pred             CCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             2326780113688733309999999999999999974998899973987867
Q gi|254780633|r   70 EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS  121 (267)
Q Consensus        70 i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~  121 (267)
                      |..|||....+ .|-++-....|.+- ..+..-..++|+ ++.|+.|+||-.
T Consensus       563 VMlGYSDS~KD-gG~laa~W~ly~Aq-~~L~~v~~~~gv-~l~~FHGRGGsv  611 (936)
T d1jqoa_         563 VMVGYSDSGKD-AGRLSAAWQLYRAQ-EEMAQVAKRYGV-KLTLFHGRGGTV  611 (936)
T ss_dssp             EEEESTTHHHH-SCHHHHHHHHHHHH-HHHHHHHHTTTC-EEEEEEECCSSG
T ss_pred             EEECCCCCCCH-HHHHHHHHHHHHHH-HHHHHHHHHCCC-EEEEEECCCCCC
T ss_conf             77535555422-57888888999999-999999998396-389970678865


No 20 
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]}
Probab=22.69  E-value=11  Score=15.40  Aligned_cols=92  Identities=12%  Similarity=0.038  Sum_probs=48.0

Q ss_pred             CCCHHHCCHHHHHHCCCCCEEEEEECCCCCC----------CCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCC--
Q ss_conf             6404666979897310498899932001247----------9746522678999999999998356677399914023--
Q gi|254780633|r    4 LIIFTDNSLPLCADARKDWIVVLPLGAYEQH----------GPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEP--   71 (267)
Q Consensus         4 ~~~~~~lT~~e~~~~~~~~vvilPvGs~EqH----------GpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~--   71 (267)
                      .++++..||.++... ++-+||++-+-+=.|          ||-.|+.||-                  =.+|+|-+.  
T Consensus        28 ~~~laY~t~G~ln~~-~~NaVlv~h~ltg~~~~~~WW~~liG~g~alDt~k------------------yfVI~~n~lG~   88 (376)
T d2vata1          28 DVPVAYKSWGRMNVS-RDNCVIVCHTLTSSAHVTSWWPTLFGQGRAFDTSR------------------YFIICLNYLGS   88 (376)
T ss_dssp             EEEEEEEEESCCCTT-SCCEEEEECCTTCCSCGGGTCGGGBSTTSSBCTTT------------------CEEEEECCTTC
T ss_pred             CCEEEEEEECCCCCC-CCCEEEECCCCCCCCCCCCCHHHHCCCCCCCCCCC------------------EEEEEECCCCC
T ss_conf             956999962564888-99889984887677021234887077998637463------------------38998346788


Q ss_pred             -CCCCHH-------------HCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC--CCC
Q ss_conf             -267801-------------1368873330999999999999999997499889997398--786
Q gi|254780633|r   72 -IGYSIE-------------HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH--GGN  120 (267)
Q Consensus        72 -yG~s~~-------------h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH--gGN  120 (267)
                       ||-+..             -..||      .=|+.+++.....-|-+-|++|+..|-|.  ||.
T Consensus        89 ~~gst~p~s~~p~~~~~~~yg~~FP------~~ti~D~v~aq~~ll~~LGI~~l~aViG~SmGGm  147 (376)
T d2vata1          89 PFGSAGPCSPDPDAEGQRPYGAKFP------RTTIRDDVRIHRQVLDRLGVRQIAAVVGASMGGM  147 (376)
T ss_dssp             SSSSSSTTSBCTTTC--CBCGGGCC------CCCHHHHHHHHHHHHHHHTCCCEEEEEEETHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCC------CCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHH
T ss_conf             7678888778962123775455688------5205788999999998738661788613427889


No 21 
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]}
Probab=22.02  E-value=21  Score=13.72  Aligned_cols=53  Identities=15%  Similarity=0.274  Sum_probs=27.4

Q ss_pred             CCCEEEEECCCCCCCCHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCC--CCCH
Q ss_conf             6773999140232678011368873330999999999999999997499889997398--7867
Q gi|254780633|r   60 PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH--GGNS  121 (267)
Q Consensus        60 ~~~~~~v~P~i~yG~s~~h~~fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgH--gGN~  121 (267)
                      ++..++..=..-+|.|...    . ...+.+.+.+   |+..-+...|.++++++ ||  ||..
T Consensus        54 ~~~~vi~~d~~G~G~S~~~----~-~~~~~~~~~~---~l~~~l~~l~~~~~~lv-GhS~Gg~i  108 (291)
T d1bn7a_          54 PSHRCIAPDLIGMGKSDKP----D-LDYFFDDHVR---YLDAFIEALGLEEVVLV-IHDWGSAL  108 (291)
T ss_dssp             TTSCEEEECCTTSTTSCCC----S-CCCCHHHHHH---HHHHHHHHTTCCSEEEE-EEHHHHHH
T ss_pred             CCCEEEEEECCCCCCCCCC----C-CCCCHHHHHH---HHHHHHHHHCCCCCCCC-CCCCCCCH
T ss_conf             6988999817987455555----4-3210367777---77656544203454565-55655524


No 22 
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]}
Probab=20.18  E-value=22  Score=13.48  Aligned_cols=23  Identities=17%  Similarity=0.153  Sum_probs=15.1

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             99999999749988999739878
Q gi|254780633|r   97 LAIIDAIRKMGIRKIVILNAHGG  119 (267)
Q Consensus        97 ~di~~sl~~~Gf~~iviiNgHgG  119 (267)
                      .-++..|.+.|+++|+|+.++-.
T Consensus        47 ~~~l~~l~~~gi~~I~Iv~~~~~   69 (307)
T d1yp2a2          47 DIPVSNCLNSNISKIYVLTQFNS   69 (307)
T ss_dssp             HHHHHHHHHTTCCEEEEEESCCC
T ss_pred             HHHHHHHHHCCCCEEEEEECCCC
T ss_conf             99999999869988999903552


Done!