BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780633|ref|YP_003065046.1| creatinine amidohydrolase
[Candidatus Liberibacter asiaticus str. psy62]
         (267 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780633|ref|YP_003065046.1| creatinine amidohydrolase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040310|gb|ACT57106.1| creatinine amidohydrolase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 267

 Score =  554 bits (1427), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 267/267 (100%), Positives = 267/267 (100%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP
Sbjct: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN
Sbjct: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL
Sbjct: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS
Sbjct: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240

Query: 241 YFANCFIQLLNDINSFDVSIFDKDVQK 267
           YFANCFIQLLNDINSFDVSIFDKDVQK
Sbjct: 241 YFANCFIQLLNDINSFDVSIFDKDVQK 267


>gi|315121832|ref|YP_004062321.1| creatinine amidohydrolase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495234|gb|ADR51833.1| creatinine amidohydrolase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 268

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/264 (74%), Positives = 223/264 (84%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           +NPL+ F DN   L     KDWIVVLPLGAYEQHGPHLPM+TDTIIA GL ER+  ILP 
Sbjct: 2   VNPLVRFADNFPSLDVGDHKDWIVVLPLGAYEQHGPHLPMDTDTIIAKGLVERVIGILPS 61

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPVT MPVE IGYSIEHMY  GTKTL+YAEAIE WL+II+ I+K+GIRK+VILNAHGGN
Sbjct: 62  TLPVTFMPVESIGYSIEHMYAHGTKTLSYAEAIERWLSIINEIQKLGIRKVVILNAHGGN 121

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPLVSIVSTEAR+RFS+L VSTSWSRF  P  I+   E  I IHGGEIETSMML LAPHL
Sbjct: 122 SPLVSIVSTEARVRFSVLAVSTSWSRFGFPHDIVLSSERGIDIHGGEIETSMMLVLAPHL 181

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           VKMDL++NFSSRQSEFL+NF YLRA+G HSFGW+M+DLNP+GVVGNAM AT +KGE LLS
Sbjct: 182 VKMDLSKNFSSRQSEFLQNFTYLRAYGPHSFGWTMEDLNPEGVVGNAMIATFEKGESLLS 241

Query: 241 YFANCFIQLLNDINSFDVSIFDKD 264
           ++ANCF+QLL DIN FDVS+FDK+
Sbjct: 242 HYANCFVQLLEDINVFDVSLFDKN 265


>gi|241206367|ref|YP_002977463.1| creatininase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860257|gb|ACS57924.1| Creatininase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 262

 Score =  316 bits (809), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 149/259 (57%), Positives = 193/259 (74%), Gaps = 1/259 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P   F D++     D R   I VLPLGA+EQHGPHLP  TDT+IA G+A R+K  LP 
Sbjct: 2   MTPSPRFEDSNPASTPDGRH-LIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKIALPA 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPVT +P E +GYSIEHM V+GTKTL + EA+  WL I + + K GIRK+V+LNAHGGN
Sbjct: 61  GLPVTFLPAESVGYSIEHMDVEGTKTLAFDEAVNRWLGIAEGLAKQGIRKLVMLNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SP+V+IV+TEAR+RF+ML V+TSW+RF +P G+++  E  IGIHGG+IETS+MLAL P  
Sbjct: 121 SPIVTIVATEARLRFAMLAVATSWTRFGLPDGVVTPEEKAIGIHGGDIETSVMLALHPDK 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M  A NFSSRQ+EF   FK+LRA+G H+FGW M DLN +GV GNA  ATV+KGE L++
Sbjct: 181 VDMAKAANFSSRQTEFAERFKHLRAYGPHAFGWKMSDLNAEGVAGNAAAATVEKGEALIA 240

Query: 241 YFANCFIQLLNDINSFDVS 259
           +     ++LL+D+++FDV+
Sbjct: 241 HAVKGLVELLSDVDAFDVA 259


>gi|222149787|ref|YP_002550744.1| creatinine amidohydrolase [Agrobacterium vitis S4]
 gi|221736769|gb|ACM37732.1| creatinine amidohydrolase [Agrobacterium vitis S4]
          Length = 273

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 151/257 (58%), Positives = 190/257 (73%)

Query: 2   NPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           +P   F  N   L    R +WI VLPLGA+EQHGPHLP  TDTIIA G+ +R+   LP  
Sbjct: 3   HPEPYFQCNDPALSPAERANWIAVLPLGAHEQHGPHLPFETDTIIAQGVVDRLILALPDT 62

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LPVT +PVEP+GYS+EHM V GT+TLT+ EA+E WL I + +   GIRK+++LNAHGGNS
Sbjct: 63  LPVTFLPVEPVGYSVEHMDVFGTRTLTFNEAVERWLGIAETLSGQGIRKLMMLNAHGGNS 122

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           PL+++V+TEAR+RFSML V+TSW+RF  P G+I   +  I IHGG+IETS+MLAL P LV
Sbjct: 123 PLMTVVATEARIRFSMLAVATSWTRFGQPDGLIRPEDKAIDIHGGDIETSVMLALRPDLV 182

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
            MD A+NFSSRQSEF   F +LRA+G H+FGW M DLNP GV GNA  AT +KGE LLS+
Sbjct: 183 AMDKAQNFSSRQSEFAARFTHLRAYGPHAFGWKMADLNPLGVAGNASVATAEKGENLLSH 242

Query: 242 FANCFIQLLNDINSFDV 258
             +  ++LL DI+ FD+
Sbjct: 243 AVHGLVELLWDIHDFDI 259


>gi|150397964|ref|YP_001328431.1| creatininase [Sinorhizobium medicae WSM419]
 gi|150029479|gb|ABR61596.1| Creatininase [Sinorhizobium medicae WSM419]
          Length = 263

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 151/260 (58%), Positives = 187/260 (71%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           P   + DNS  L A  R DWI VLPLGAYEQHGPHLP  TD +IA G+ ER+ + +P  L
Sbjct: 4   PKPRWNDNSDALAAAERHDWIAVLPLGAYEQHGPHLPFETDRLIAGGIVERVIAAMPRTL 63

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P T +PVEP+GYS+EHM+V GT+TL Y EA+E WL I + +   GIRK V+LNAHGGNSP
Sbjct: 64  PATFLPVEPVGYSVEHMHVPGTRTLAYDEAVERWLGIAEDLAGRGIRKFVMLNAHGGNSP 123

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           L+++V+TEAR RF ML V+TSW+RF  P G I   +  I IHGG+IETS+MLAL P  V 
Sbjct: 124 LMTVVATEARRRFRMLAVATSWTRFGQPDGWIGAKDRTIDIHGGDIETSVMLALHPDKVD 183

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           M  A +F SRQSEF R+FK+LRA+G H+FGW M DLNP GV GNA  AT ++GE LL + 
Sbjct: 184 MMQARDFPSRQSEFARSFKHLRAYGPHAFGWRMSDLNPDGVAGNAAAATAERGEALLGHV 243

Query: 243 ANCFIQLLNDINSFDVSIFD 262
           A   I+LL D+N+FD+   D
Sbjct: 244 AKSIIELLEDVNAFDIGELD 263


>gi|15966622|ref|NP_386975.1| hypothetical protein SMc02977 [Sinorhizobium meliloti 1021]
 gi|307300343|ref|ZP_07580123.1| Creatininase [Sinorhizobium meliloti BL225C]
 gi|307319626|ref|ZP_07599052.1| Creatininase [Sinorhizobium meliloti AK83]
 gi|15075894|emb|CAC47448.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306894748|gb|EFN25508.1| Creatininase [Sinorhizobium meliloti AK83]
 gi|306904509|gb|EFN35093.1| Creatininase [Sinorhizobium meliloti BL225C]
          Length = 263

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 152/256 (59%), Positives = 189/256 (73%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
           +TDNS  L    R+DWI VLPLGA+EQHGPHLP  TD +IAAG+ ER+ + LP  LPVT 
Sbjct: 8   WTDNSAALEPVERRDWIAVLPLGAHEQHGPHLPFETDRLIAAGIVERVIAALPQALPVTF 67

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126
           +PVEP+GYSIEHM V GT+TL Y EAIE WL I +++  +G+RK V+LNAHGGNSPL++I
Sbjct: 68  LPVEPVGYSIEHMDVSGTRTLAYDEAIERWLGIAESLAGLGVRKFVMLNAHGGNSPLMTI 127

Query: 127 VSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
           V+TEAR+RF ML V+TSW+RF  P G IS  +  + IHGG+IETS+MLAL P  V M  A
Sbjct: 128 VATEARIRFRMLAVATSWTRFGQPDGWISAKDKAVDIHGGDIETSVMLALHPDKVDMAKA 187

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
             F SRQ EF  +FK+LRA+G H+FGW M DLNP GV GNA  AT ++GE LL++ A   
Sbjct: 188 RAFPSRQGEFALSFKHLRAYGPHAFGWKMSDLNPDGVAGNAAAATAERGEALLAHAAKGI 247

Query: 247 IQLLNDINSFDVSIFD 262
           I+LL D+N+FD    D
Sbjct: 248 IELLEDVNAFDAGELD 263


>gi|86359214|ref|YP_471106.1| creatinine amidohydrolase (creatininase) protein [Rhizobium etli
           CFN 42]
 gi|86283316|gb|ABC92379.1| probable creatinine amidohydrolase (creatininase) protein
           [Rhizobium etli CFN 42]
          Length = 262

 Score =  309 bits (791), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 145/251 (57%), Positives = 187/251 (74%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           D+S  +CA   +  I VLPLGA+EQHGPHLP  TDT+IA G+A R+K  LP  LPV  +P
Sbjct: 9   DDSGSVCAPGARRPIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKMALPAGLPVIFLP 68

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
            E +GYSIEHM V+GTKTL + EA+  WL I + + K  IRK V+LNAHGGNSPL+S+V+
Sbjct: 69  AESVGYSIEHMDVEGTKTLAFDEAVNRWLGIAEGLAKRDIRKFVMLNAHGGNSPLISVVA 128

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
           TEAR+RF+ML V+TSW+RF +P G+I   E  IGIHGG+IETS+MLAL P  V M  AE+
Sbjct: 129 TEARVRFAMLAVATSWTRFGLPDGVIPPEEKAIGIHGGDIETSVMLALHPDKVDMAKAED 188

Query: 189 FSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
           FSSRQ+EF   FK+LRA+G H+FGW M D+N +GV GNA  AT +KGE L+++     ++
Sbjct: 189 FSSRQAEFATCFKHLRAYGPHAFGWKMSDINEQGVAGNASAATAEKGEALIAHAVKGLVE 248

Query: 249 LLNDINSFDVS 259
           LL D+++FDVS
Sbjct: 249 LLEDVDAFDVS 259


>gi|222087138|ref|YP_002545673.1| creatinine amidohydrolase (creatininase) protein [Agrobacterium
           radiobacter K84]
 gi|221724586|gb|ACM27742.1| creatinine amidohydrolase (creatininase) protein [Agrobacterium
           radiobacter K84]
          Length = 263

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 141/258 (54%), Positives = 190/258 (73%)

Query: 2   NPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
            PL  F DN   L    R +WI VLPLGA+EQHGPHLP +TDT+IA G+   +K+ LP  
Sbjct: 3   QPLPRFDDNDRTLAPADRANWIAVLPLGAHEQHGPHLPFDTDTLIAEGIVSHLKAALPAD 62

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LPVT +PVEP+GYSIEHM V GTKTL + EA+  WL I +A+  +GIRK V+LNAHGGNS
Sbjct: 63  LPVTFLPVEPVGYSIEHMDVVGTKTLDFDEAVNRWLGIAEAMHHLGIRKFVMLNAHGGNS 122

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           PL++IV+TEAR+RF ML V+TSW+RF +P+ +I+  +  I IHGG+IETS+MLAL P +V
Sbjct: 123 PLLTIVATEARIRFDMLAVATSWTRFGVPEDLIAPEDKAIDIHGGDIETSVMLALHPEMV 182

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
            +  A +F SRQS++ + FK+LRA+G H+FGW M DL+ +GV GNA  AT +KG+ L+++
Sbjct: 183 DVSKATDFPSRQSDYTQRFKHLRAYGPHAFGWKMSDLSAEGVAGNAGAATAEKGKRLIAH 242

Query: 242 FANCFIQLLNDINSFDVS 259
                ++LL D+++FD  
Sbjct: 243 AVKGLVELLQDVDAFDAE 260


>gi|227823444|ref|YP_002827417.1| creatinine amidohydrolase [Sinorhizobium fredii NGR234]
 gi|227342446|gb|ACP26664.1| creatinine amidohydrolase [Sinorhizobium fredii NGR234]
          Length = 263

 Score =  300 bits (769), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 147/252 (58%), Positives = 179/252 (71%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           N   L    R+DWI VLPLGA+EQHGPHLP  TD +IA G+ +R+ + LP  LP T +P 
Sbjct: 11  NPADLAPAERRDWIAVLPLGAHEQHGPHLPFETDRLIAEGIVDRVIARLPHDLPATFLPA 70

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
           EPIGYSIEHM V GT+TL Y EAI  WL I + + ++GIRK V+LNAHGGNS L++IV+T
Sbjct: 71  EPIGYSIEHMDVAGTRTLAYDEAIARWLGIAENLSRLGIRKFVMLNAHGGNSALMTIVAT 130

Query: 130 EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENF 189
           EARMRF ML V+TSW+RF  P G IS  +  I IHGG+IE S+MLAL P  V M  A  F
Sbjct: 131 EARMRFGMLAVATSWTRFGQPGGWISAEDKAIDIHGGDIEASVMLALHPDKVDMAKARQF 190

Query: 190 SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
            SRQSEF R F++LRA+G H+FGW M DLNP G VGNA  AT ++GE LL + A   I+L
Sbjct: 191 PSRQSEFQRRFEHLRAYGPHAFGWKMSDLNPDGAVGNAAAATAERGEALLGHAAGGIIEL 250

Query: 250 LNDINSFDVSIF 261
           L D+ +FDV  F
Sbjct: 251 LQDVQAFDVGEF 262


>gi|116253884|ref|YP_769722.1| hypothetical protein RL4147 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258532|emb|CAK09636.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 262

 Score =  298 bits (763), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 146/259 (56%), Positives = 191/259 (73%), Gaps = 1/259 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P   F D++     D R   I VLPLGA+EQHGPHLP  TDT+IA G+A R+K  LP 
Sbjct: 2   MTPSPRFEDSNPAFAPDGRH-LIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKMALPA 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPVT +P E +GYSIEHM V+GTKTL + EA+  WL I + + K GIRK V+LNAHGGN
Sbjct: 61  GLPVTFLPAESVGYSIEHMDVEGTKTLAFDEAVNGWLGIAEGLAKQGIRKFVMLNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPL+S+V+TEAR+RF+ML V+TSW+RF +P G+I+  E  IGIHGG+IETS+MLAL P  
Sbjct: 121 SPLISVVATEARVRFAMLAVATSWTRFGVPDGVITPEEKAIGIHGGDIETSVMLALHPDK 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M  A +F S+Q+EF  +FK+LRA+G H+FGW M DLN +GV GNA  AT +KGE L++
Sbjct: 181 VDMAKAADFRSQQTEFAESFKHLRAYGPHAFGWKMSDLNTEGVAGNAAAATAEKGEALIA 240

Query: 241 YFANCFIQLLNDINSFDVS 259
           +     ++LL+D+++FDV+
Sbjct: 241 HAVKGLVELLSDVDAFDVA 259


>gi|327189537|gb|EGE56690.1| putative creatininase protein [Rhizobium etli CNPAF512]
          Length = 259

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 144/250 (57%), Positives = 186/250 (74%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +S P    A +  I VLPLGA+EQHGPHLP  TDT+IA G+A R+K+ LP  LPVT +P 
Sbjct: 7   DSNPASVPAPRPPIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKAALPAGLPVTFLPA 66

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
           E +GYSIEHM V+GTKTL + EA+  WL I + + +  IRK+V+LNAHGGNSPL++IV+T
Sbjct: 67  ESVGYSIEHMDVEGTKTLAFDEAVNRWLGIAERLAEQNIRKLVMLNAHGGNSPLMTIVAT 126

Query: 130 EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENF 189
           EAR+RF+ML V+TSW+RF +P G+I   E  IGIHGG+IETS+MLAL P  V M  A +F
Sbjct: 127 EARIRFAMLAVATSWTRFGLPDGVIRPEEKAIGIHGGDIETSVMLALHPDKVDMAKAADF 186

Query: 190 SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
            SRQSEF   FK+LRA+G H+FGW M DLNP+GV GNA  AT +KGE L+++     ++L
Sbjct: 187 PSRQSEFAERFKHLRAYGQHAFGWKMSDLNPQGVAGNAAAATAEKGEALMAHAVKGLVEL 246

Query: 250 LNDINSFDVS 259
           L D+++FDV 
Sbjct: 247 LGDVDAFDVG 256


>gi|218673256|ref|ZP_03522925.1| creatinine amidohydrolase (creatininase) protein [Rhizobium etli
           GR56]
          Length = 262

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 148/261 (56%), Positives = 190/261 (72%), Gaps = 1/261 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P   F D S P    A +  I VLPLGA+EQHGPHLP  TDT+IA G+A+R+K+ LP 
Sbjct: 2   MTPSPRF-DESRPASTPAPRRPIAVLPLGAHEQHGPHLPFETDTLIAEGIAQRLKAALPA 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPVT +P E +GYSIEHM V+GTKTL + EA+  WL I + + K G RK+V+LNAHGGN
Sbjct: 61  GLPVTFLPAESVGYSIEHMDVEGTKTLAFDEAVHRWLGIAEGLAKQGTRKLVMLNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPL++IV+TEAR+RF+ML V+TSW+RF +P G+I   E  IGIHGG+IETS+MLAL P  
Sbjct: 121 SPLMTIVATEARVRFAMLAVATSWTRFGLPDGVIPRGEKAIGIHGGDIETSVMLALHPDR 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M  A +F SRQ+EF   FK+LRA+G H+FGW M DLN +GV GNA  AT +KGE L++
Sbjct: 181 VDMAKAADFPSRQTEFAERFKHLRAYGPHAFGWKMSDLNAEGVAGNAAAATAEKGEALIA 240

Query: 241 YFANCFIQLLNDINSFDVSIF 261
           +     ++LL D+++FDV  F
Sbjct: 241 HAVRGLVELLEDVDAFDVGEF 261


>gi|190893466|ref|YP_001980008.1| creatininase [Rhizobium etli CIAT 652]
 gi|190698745|gb|ACE92830.1| putative creatininase protein [Rhizobium etli CIAT 652]
          Length = 259

 Score =  291 bits (746), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 140/235 (59%), Positives = 180/235 (76%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           VLPLGA+EQHGPHLP  TDT+IA G+A R+K+ LP  LPVT +P E +GYSIEHM V+GT
Sbjct: 22  VLPLGAHEQHGPHLPFETDTLIAEGIAGRLKAALPAGLPVTFLPAESVGYSIEHMDVEGT 81

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSW 144
           KTL + EA+  WL I + + +  IRK+V+LNAHGGNSPL++IV+TEAR+RF+ML V+TSW
Sbjct: 82  KTLAFDEAVNRWLGIAERLAEQNIRKLVMLNAHGGNSPLMTIVATEARIRFAMLAVATSW 141

Query: 145 SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLR 204
           +RF +P G+I   E  IGIHGG+IETS+MLAL P  V M  A +F SRQSEF   FK+LR
Sbjct: 142 TRFGLPDGVIRPEEKAIGIHGGDIETSVMLALHPDKVDMAKAADFPSRQSEFAERFKHLR 201

Query: 205 AHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           A+G H+FGW M DLNP+GV GNA  AT +KGE L+++     ++LL D+++FDV 
Sbjct: 202 AYGPHAFGWKMSDLNPQGVAGNAAAATAEKGEALMAHAVKGLVELLGDVDAFDVG 256


>gi|306846191|ref|ZP_07478753.1| creatininase [Brucella sp. BO1]
 gi|306273442|gb|EFM55303.1| creatininase [Brucella sp. BO1]
          Length = 256

 Score =  291 bits (745), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 179/249 (71%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+GYSI
Sbjct: 6   DQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPGDLNVNFLPAQPVGYSI 65

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R R  
Sbjct: 66  EHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELRTRLD 125

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + QS+F
Sbjct: 126 MLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMTKARNFPNAQSQF 185

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
              FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE L+++  + FI LL D++ F
Sbjct: 186 AEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASAQAGEKLIAHAVSGFIDLLRDVDRF 245

Query: 257 DVSIFDKDV 265
           +++ F++ V
Sbjct: 246 ELARFNRKV 254


>gi|254720159|ref|ZP_05181970.1| creatininase [Brucella sp. 83/13]
 gi|265985166|ref|ZP_06097901.1| creatininase [Brucella sp. 83/13]
 gi|306839535|ref|ZP_07472342.1| creatininase [Brucella sp. NF 2653]
 gi|264663758|gb|EEZ34019.1| creatininase [Brucella sp. 83/13]
 gi|306405367|gb|EFM61639.1| creatininase [Brucella sp. NF 2653]
          Length = 256

 Score =  291 bits (744), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 178/249 (71%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+GYSI
Sbjct: 6   DQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPVGYSI 65

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R R  
Sbjct: 66  EHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELRTRLD 125

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + QS+F
Sbjct: 126 MLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNAQSQF 185

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
              FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE LL++  + FI LL D++ F
Sbjct: 186 AEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASTQAGEKLLAHAVSGFIDLLRDVDRF 245

Query: 257 DVSIFDKDV 265
           +++ F+  V
Sbjct: 246 ELARFNPKV 254


>gi|17988654|ref|NP_541287.1| creatininase [Brucella melitensis bv. 1 str. 16M]
 gi|225629438|ref|ZP_03787471.1| creatininase [Brucella ceti str. Cudo]
 gi|294853940|ref|ZP_06794612.1| creatinine amidohydrolase [Brucella sp. NVSL 07-0026]
 gi|17984460|gb|AAL53551.1| creatininase [Brucella melitensis bv. 1 str. 16M]
 gi|225615934|gb|EEH12983.1| creatininase [Brucella ceti str. Cudo]
 gi|294819595|gb|EFG36595.1| creatinine amidohydrolase [Brucella sp. NVSL 07-0026]
          Length = 277

 Score =  291 bits (744), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 178/249 (71%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+GYSI
Sbjct: 27  DQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPVGYSI 86

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R R  
Sbjct: 87  EHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELRTRLD 146

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + QS+F
Sbjct: 147 MLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNAQSQF 206

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
              FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE LL++  + FI LL D++ F
Sbjct: 207 AEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASAQAGEKLLAHAVSGFIDLLRDVDRF 266

Query: 257 DVSIFDKDV 265
           +++ F+  V
Sbjct: 267 ELARFNPKV 275


>gi|62317193|ref|YP_223046.1| creatinine amidohydrolase [Brucella abortus bv. 1 str. 9-941]
 gi|83269173|ref|YP_418464.1| creatininase [Brucella melitensis biovar Abortus 2308]
 gi|148558724|ref|YP_001257903.1| putative creatinine amidohydrolase [Brucella ovis ATCC 25840]
 gi|163845101|ref|YP_001622756.1| hypothetical protein BSUIS_B0981 [Brucella suis ATCC 23445]
 gi|189022454|ref|YP_001932195.1| Creatininase [Brucella abortus S19]
 gi|225686743|ref|YP_002734715.1| creatininase [Brucella melitensis ATCC 23457]
 gi|237816753|ref|ZP_04595745.1| creatinine amidohydrolase [Brucella abortus str. 2308 A]
 gi|254690695|ref|ZP_05153949.1| creatininase [Brucella abortus bv. 6 str. 870]
 gi|254698475|ref|ZP_05160303.1| creatininase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700183|ref|ZP_05162011.1| creatininase [Brucella suis bv. 5 str. 513]
 gi|254705553|ref|ZP_05167381.1| creatininase [Brucella pinnipedialis M163/99/10]
 gi|254710784|ref|ZP_05172595.1| creatininase [Brucella pinnipedialis B2/94]
 gi|254712743|ref|ZP_05174554.1| creatininase [Brucella ceti M644/93/1]
 gi|254715811|ref|ZP_05177622.1| creatininase [Brucella ceti M13/05/1]
 gi|254731922|ref|ZP_05190500.1| creatininase [Brucella abortus bv. 4 str. 292]
 gi|256015746|ref|YP_003105755.1| creatinine amidohydrolase, putative [Brucella microti CCM 4915]
 gi|256029167|ref|ZP_05442781.1| creatininase [Brucella pinnipedialis M292/94/1]
 gi|256043855|ref|ZP_05446776.1| creatininase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256058852|ref|ZP_05449068.1| creatininase [Brucella neotomae 5K33]
 gi|256157359|ref|ZP_05455277.1| creatininase [Brucella ceti M490/95/1]
 gi|256253661|ref|ZP_05459197.1| creatininase [Brucella ceti B1/94]
 gi|256255877|ref|ZP_05461413.1| creatininase [Brucella abortus bv. 9 str. C68]
 gi|256262122|ref|ZP_05464654.1| creatininase [Brucella melitensis bv. 2 str. 63/9]
 gi|260167740|ref|ZP_05754551.1| creatininase [Brucella sp. F5/99]
 gi|260544432|ref|ZP_05820253.1| creatininase [Brucella abortus NCTC 8038]
 gi|260565031|ref|ZP_05835516.1| creatininase [Brucella melitensis bv. 1 str. 16M]
 gi|260756271|ref|ZP_05868619.1| creatininase [Brucella abortus bv. 6 str. 870]
 gi|260759698|ref|ZP_05872046.1| creatininase [Brucella abortus bv. 4 str. 292]
 gi|260762939|ref|ZP_05875271.1| creatininase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882093|ref|ZP_05893707.1| creatininase [Brucella abortus bv. 9 str. C68]
 gi|261217572|ref|ZP_05931853.1| creatinase [Brucella ceti M13/05/1]
 gi|261220795|ref|ZP_05935076.1| creatininase [Brucella ceti B1/94]
 gi|261312960|ref|ZP_05952157.1| creatininase [Brucella pinnipedialis M163/99/10]
 gi|261318355|ref|ZP_05957552.1| creatinase [Brucella pinnipedialis B2/94]
 gi|261320449|ref|ZP_05959646.1| creatinase [Brucella ceti M644/93/1]
 gi|261322790|ref|ZP_05961987.1| creatininase [Brucella neotomae 5K33]
 gi|261750676|ref|ZP_05994385.1| creatininase [Brucella suis bv. 5 str. 513]
 gi|261757174|ref|ZP_06000883.1| creatininase [Brucella sp. F5/99]
 gi|265986154|ref|ZP_06098711.1| creatininase [Brucella pinnipedialis M292/94/1]
 gi|265990276|ref|ZP_06102833.1| creatininase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995848|ref|ZP_06108405.1| creatininase [Brucella ceti M490/95/1]
 gi|297249245|ref|ZP_06932946.1| creatinine amidohydrolase [Brucella abortus bv. 5 str. B3196]
 gi|62197386|gb|AAX75685.1| hypothetical creatinine amidohydrolase [Brucella abortus bv. 1 str.
           9-941]
 gi|82939447|emb|CAJ12413.1| Creatininase [Brucella melitensis biovar Abortus 2308]
 gi|148370009|gb|ABQ62881.1| putative creatinine amidohydrolase [Brucella ovis ATCC 25840]
 gi|163675824|gb|ABY39934.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021028|gb|ACD73749.1| Creatininase [Brucella abortus S19]
 gi|225642848|gb|ACO02761.1| Creatininase [Brucella melitensis ATCC 23457]
 gi|237787566|gb|EEP61782.1| creatinine amidohydrolase [Brucella abortus str. 2308 A]
 gi|255998406|gb|ACU50093.1| creatinine amidohydrolase, putative [Brucella microti CCM 4915]
 gi|260097703|gb|EEW81577.1| creatininase [Brucella abortus NCTC 8038]
 gi|260152674|gb|EEW87767.1| creatininase [Brucella melitensis bv. 1 str. 16M]
 gi|260670016|gb|EEX56956.1| creatininase [Brucella abortus bv. 4 str. 292]
 gi|260673360|gb|EEX60181.1| creatininase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676379|gb|EEX63200.1| creatininase [Brucella abortus bv. 6 str. 870]
 gi|260871621|gb|EEX78690.1| creatininase [Brucella abortus bv. 9 str. C68]
 gi|260919379|gb|EEX86032.1| creatininase [Brucella ceti B1/94]
 gi|260922661|gb|EEX89229.1| creatinase [Brucella ceti M13/05/1]
 gi|261293139|gb|EEX96635.1| creatinase [Brucella ceti M644/93/1]
 gi|261297578|gb|EEY01075.1| creatinase [Brucella pinnipedialis B2/94]
 gi|261298770|gb|EEY02267.1| creatininase [Brucella neotomae 5K33]
 gi|261301986|gb|EEY05483.1| creatininase [Brucella pinnipedialis M163/99/10]
 gi|261737158|gb|EEY25154.1| creatininase [Brucella sp. F5/99]
 gi|261740429|gb|EEY28355.1| creatininase [Brucella suis bv. 5 str. 513]
 gi|262550145|gb|EEZ06306.1| creatininase [Brucella ceti M490/95/1]
 gi|263000945|gb|EEZ13635.1| creatininase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263091823|gb|EEZ16145.1| creatininase [Brucella melitensis bv. 2 str. 63/9]
 gi|264658351|gb|EEZ28612.1| creatininase [Brucella pinnipedialis M292/94/1]
 gi|297173114|gb|EFH32478.1| creatinine amidohydrolase [Brucella abortus bv. 5 str. B3196]
 gi|326411146|gb|ADZ68210.1| Creatininase [Brucella melitensis M28]
 gi|326554438|gb|ADZ89077.1| Creatininase [Brucella melitensis M5-90]
          Length = 256

 Score =  291 bits (744), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 178/249 (71%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+GYSI
Sbjct: 6   DQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPVGYSI 65

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R R  
Sbjct: 66  EHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELRTRLD 125

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + QS+F
Sbjct: 126 MLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNAQSQF 185

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
              FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE LL++  + FI LL D++ F
Sbjct: 186 AEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASAQAGEKLLAHAVSGFIDLLRDVDRF 245

Query: 257 DVSIFDKDV 265
           +++ F+  V
Sbjct: 246 ELARFNPKV 254


>gi|306841098|ref|ZP_07473818.1| creatininase [Brucella sp. BO2]
 gi|306288873|gb|EFM60182.1| creatininase [Brucella sp. BO2]
          Length = 256

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 178/249 (71%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+GYSI
Sbjct: 6   DQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPGDLNVNFLPAQPVGYSI 65

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R R  
Sbjct: 66  EHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELRTRLD 125

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + QS+F
Sbjct: 126 MLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNAQSQF 185

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
              FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE LL++  + FI LL D++ F
Sbjct: 186 AEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASAQAGEKLLAHAVSGFIDLLRDVDRF 245

Query: 257 DVSIFDKDV 265
           +++ F+  V
Sbjct: 246 ELARFNPKV 254


>gi|23500710|ref|NP_700150.1| creatinine amidohydrolase [Brucella suis 1330]
 gi|23464360|gb|AAN34155.1| creatinine amidohydrolase, putative [Brucella suis 1330]
          Length = 256

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 177/249 (71%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+GYSI
Sbjct: 6   DQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPVGYSI 65

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R R  
Sbjct: 66  EHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELRTRLD 125

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + QS F
Sbjct: 126 MLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNAQSRF 185

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
              FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE LL++  + FI LL D++ F
Sbjct: 186 AEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASAQAGEKLLAHAVSGFIDLLRDVDRF 245

Query: 257 DVSIFDKDV 265
           +++ F+  V
Sbjct: 246 ELARFNPKV 254


>gi|254696000|ref|ZP_05157828.1| creatininase [Brucella abortus bv. 3 str. Tulya]
 gi|261216427|ref|ZP_05930708.1| creatininase [Brucella abortus bv. 3 str. Tulya]
 gi|260918034|gb|EEX84895.1| creatininase [Brucella abortus bv. 3 str. Tulya]
          Length = 256

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 177/249 (71%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+GYSI
Sbjct: 6   DQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPVGYSI 65

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R R  
Sbjct: 66  EHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELRTRLD 125

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + QS+F
Sbjct: 126 MLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNAQSQF 185

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
              FKYLRA+G H+FGW M DLNP GV GNA+ A  + GE LL++  + FI LL D++ F
Sbjct: 186 AEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAARAQAGEKLLAHAVSGFIDLLRDVDRF 245

Query: 257 DVSIFDKDV 265
           +++ F+  V
Sbjct: 246 ELARFNPKV 254


>gi|161621034|ref|YP_001594920.1| creatininase [Brucella canis ATCC 23365]
 gi|254703303|ref|ZP_05165131.1| creatinine amidohydrolase, putative [Brucella suis bv. 3 str. 686]
 gi|260567766|ref|ZP_05838235.1| creatininase [Brucella suis bv. 4 str. 40]
 gi|261753932|ref|ZP_05997641.1| creatininase [Brucella suis bv. 3 str. 686]
 gi|161337845|gb|ABX64149.1| Creatininase [Brucella canis ATCC 23365]
 gi|260154431|gb|EEW89512.1| creatininase [Brucella suis bv. 4 str. 40]
 gi|261743685|gb|EEY31611.1| creatininase [Brucella suis bv. 3 str. 686]
          Length = 256

 Score =  289 bits (739), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 176/249 (70%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+GYSI
Sbjct: 6   DQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPVGYSI 65

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R R  
Sbjct: 66  EHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELRTRLD 125

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + QS F
Sbjct: 126 MLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNAQSRF 185

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
              FKYLRA+G H+FGW M DLNP GV GNA+ A  + GE LL++  + FI LL D++ F
Sbjct: 186 AEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAARAQAGEKLLAHAVSGFIDLLRDVDRF 245

Query: 257 DVSIFDKDV 265
           +++ F+  V
Sbjct: 246 ELARFNPKV 254


>gi|256111095|ref|ZP_05452142.1| creatininase [Brucella melitensis bv. 3 str. Ether]
 gi|265992617|ref|ZP_06105174.1| creatininase [Brucella melitensis bv. 3 str. Ether]
 gi|262763487|gb|EEZ09519.1| creatininase [Brucella melitensis bv. 3 str. Ether]
          Length = 256

 Score =  288 bits (738), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 178/249 (71%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+GYSI
Sbjct: 6   DQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPVGYSI 65

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R R  
Sbjct: 66  EHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELRTRLD 125

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A +F + QS+F
Sbjct: 126 MLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARSFPNAQSQF 185

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
              FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE LL++  + FI LL D++ F
Sbjct: 186 AEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASAQAGEKLLAHAVSGFIDLLRDVDRF 245

Query: 257 DVSIFDKDV 265
           +++ F+  V
Sbjct: 246 ELARFNPKV 254


>gi|332717166|ref|YP_004444632.1| creatinine amidohydrolase [Agrobacterium sp. H13-3]
 gi|325063851|gb|ADY67541.1| creatinine amidohydrolase [Agrobacterium sp. H13-3]
          Length = 266

 Score =  288 bits (737), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 182/243 (74%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLPLGA+EQHGPHLP  TDT+IAAG+  R+ ++LP  LPV+ +PVEP+GYSIEHM V 
Sbjct: 24  ISVLPLGAHEQHGPHLPFETDTLIAAGIVSRLAAVLPAGLPVSFLPVEPVGYSIEHMNVP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GTK+L Y EA+E WL I  A  + G+RK V+LNAHGGNSPL++IV+TEAR RF ML V+T
Sbjct: 84  GTKSLRYDEAVERWLGIAKAEYEKGVRKFVMLNAHGGNSPLMTIVATEARARFGMLAVAT 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW+RF +P  I+   +  I IHGG+IETS+MLAL P  V M+   NF SRQS+F   F++
Sbjct: 144 SWTRFGVPADIVKPEDKAIDIHGGDIETSVMLALCPERVAMEKTANFPSRQSDFASRFRH 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFD 262
           LRA+G H+FGW M DLNP GV GNA  A+ +KGE ++S+  +  ++LL D+++FD+++F 
Sbjct: 204 LRAYGPHAFGWLMSDLNPDGVAGNAAAASAEKGERIISHAVSGLVELLEDVHAFDITLFH 263

Query: 263 KDV 265
             +
Sbjct: 264 NKI 266


>gi|209550959|ref|YP_002282876.1| creatininase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209536715|gb|ACI56650.1| Creatininase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 262

 Score =  285 bits (729), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 141/253 (55%), Positives = 187/253 (73%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           D+S  + A   +  I VLPLGA+EQHGPHLP  TDT+IA G+A R+K+ L   L VT +P
Sbjct: 9   DDSDAVSAHGGRRPIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKAALSAGLRVTFLP 68

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
            E +GYSIEHM V+ TKTL + EA++ WL I + + +  IRK+V+LNAHGGNSPL++IV+
Sbjct: 69  AESVGYSIEHMDVEETKTLAFDEAVDRWLGIAERLAEQDIRKLVMLNAHGGNSPLMTIVA 128

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
           TEAR+RF+ML V+TSW+RF +P G+I   E  IGIHGG+IETS+MLAL P  V M  A +
Sbjct: 129 TEARIRFAMLAVATSWTRFGLPDGVIPPEEKAIGIHGGDIETSVMLALHPDKVDMAKAAD 188

Query: 189 FSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
           FSSRQSEF   FK+LRA+G H+FGW M DLNP+G  GNA  AT +KGE L+++     ++
Sbjct: 189 FSSRQSEFAGRFKHLRAYGPHAFGWKMSDLNPQGAAGNAAAATAEKGEALIAHAVKGLVE 248

Query: 249 LLNDINSFDVSIF 261
           LL D+++FD++ F
Sbjct: 249 LLEDVDAFDITQF 261


>gi|15890482|ref|NP_356154.1| creatinine amidohydrolase [Agrobacterium tumefaciens str. C58]
 gi|15158717|gb|AAK88939.1| creatinine amidohydrolase [Agrobacterium tumefaciens str. C58]
          Length = 266

 Score =  283 bits (723), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 183/243 (75%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLPLGA+EQHGPHLP  TDT+IAAG+  R+ ++LP  LPV+ +PVEP+GYSIEHM V 
Sbjct: 24  ISVLPLGAHEQHGPHLPFETDTLIAAGIVSRLAAVLPAHLPVSFLPVEPVGYSIEHMDVP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GTKTL Y EAIE WL I +A  + G+RK V+LNAHGGNSPL++IV+TEAR RF ML V+T
Sbjct: 84  GTKTLCYDEAIERWLGIAEAEYEKGVRKFVMLNAHGGNSPLMTIVATEARARFGMLAVAT 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW+RF +P  I+   +  + IHGG+IETS+MLAL P  V M+ A NF SRQS+F + F +
Sbjct: 144 SWTRFGVPADIVKPQDKAVDIHGGDIETSVMLALHPERVVMEKAANFPSRQSDFSQRFSH 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFD 262
           LRA+G H+FGW M DLNP GV GNA  A+  KGE L+S+  N  ++LL D+++FD+++F 
Sbjct: 204 LRAYGPHAFGWLMSDLNPDGVAGNAAAASAGKGERLISHAVNGLLELLEDVHAFDITLFH 263

Query: 263 KDV 265
             +
Sbjct: 264 NKI 266


>gi|163758918|ref|ZP_02166005.1| creatinine amidohydrolase [Hoeflea phototrophica DFL-43]
 gi|162284208|gb|EDQ34492.1| creatinine amidohydrolase [Hoeflea phototrophica DFL-43]
          Length = 247

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 122/235 (51%), Positives = 164/235 (69%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLPLGA+EQHGPHLP  TD +IA  +A+R+    PP + V  +P+EP+GYSIEHM VD
Sbjct: 8   IAVLPLGAHEQHGPHLPFETDAVIAGAVAQRLAKTAPPGIKVEVLPLEPVGYSIEHMDVD 67

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT+TL + EA+  W+ I       G+R++++LNAHGGNSPL++IV+TEAR+RF+MLVV+T
Sbjct: 68  GTQTLAFDEAVNRWIRIAGECADRGVRRLMLLNAHGGNSPLLTIVATEARVRFNMLVVAT 127

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW+RF +P  +IS  +    IH G+IETS+MLAL P LV+ +   +F S Q +F   FK+
Sbjct: 128 SWTRFGVPDEVISPDDKAYDIHAGDIETSVMLALRPELVRQEAIRDFPSSQQDFTARFKH 187

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
           LRA+G H+FGW M DLN  G  G A  A+  KGE LL +      +LL+D+  FD
Sbjct: 188 LRAYGPHAFGWKMSDLNSDGAAGKASQASAAKGEALLDHAVAGLCELLDDMAQFD 242


>gi|153008705|ref|YP_001369920.1| creatininase [Ochrobactrum anthropi ATCC 49188]
 gi|151560593|gb|ABS14091.1| Creatininase [Ochrobactrum anthropi ATCC 49188]
          Length = 260

 Score =  268 bits (684), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 177/246 (71%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D   D IVVLPLGA+EQHGPHLP  TDTIIA G+  R+   LP  L V  +P +P+GYSI
Sbjct: 6   DQNSDMIVVLPLGAHEQHGPHLPFETDTIIAEGIVARVSDALPAELNVNFLPAQPVGYSI 65

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EHM  +GT++L +AEA+  W+ I + +   GIRK+V+LNAHGGNSPL++IV+TE R R  
Sbjct: 66  EHMDTEGTQSLAFAEAVNQWIGIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELRTRLD 125

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NFS+ QS +
Sbjct: 126 MLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMSKARNFSNAQSRY 185

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
              FK+LRA+G H+FGW M DLNP+GV GNA  AT + GE L++     FI+LL D++ F
Sbjct: 186 AEEFKFLRAYGPHAFGWKMHDLNPEGVAGNAAAATAEAGERLITNAVTGFIELLRDVDRF 245

Query: 257 DVSIFD 262
           D++ F+
Sbjct: 246 DLARFE 251


>gi|254501396|ref|ZP_05113547.1| creatininase subfamily [Labrenzia alexandrii DFL-11]
 gi|222437467|gb|EEE44146.1| creatininase subfamily [Labrenzia alexandrii DFL-11]
          Length = 263

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 121/243 (49%), Positives = 170/243 (69%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           KDWI VLP+ A EQHGPHLP+ TDT IA G  +R+  +LP  +P + +PV+ IG S EH+
Sbjct: 21  KDWIAVLPVAAIEQHGPHLPVYTDTAIAEGQIQRVIELLPDDVPASFLPVQAIGKSNEHI 80

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              GT T+T+  A++ WL + D+I + G+RK+V++N+HGGN PL+ I++ E R+R +ML 
Sbjct: 81  SSAGTLTMTWETALQAWLELGDSILRAGVRKVVVVNSHGGNVPLIGILTRELRVRHNMLA 140

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           V T+W+ F  P+G+ S  E   GIHGG++ETS+ML L P LV MD A NF S Q +    
Sbjct: 141 VGTAWASFGQPEGVFSDHELTFGIHGGDVETSIMLHLRPDLVNMDKARNFRSSQEDLASK 200

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           FK+LRAHG H+FGW  +DLNP G VG+A  AT +KG+  L + A  F++LL D+++FD++
Sbjct: 201 FKHLRAHGPHAFGWKAQDLNPAGTVGDASIATAEKGKASLDHAARGFVELLQDVHAFDLA 260

Query: 260 IFD 262
            FD
Sbjct: 261 HFD 263


>gi|239832634|ref|ZP_04680963.1| creatininase [Ochrobactrum intermedium LMG 3301]
 gi|239824901|gb|EEQ96469.1| creatininase [Ochrobactrum intermedium LMG 3301]
          Length = 260

 Score =  265 bits (676), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 134/245 (54%), Positives = 175/245 (71%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           +   D IVVLPLGA+EQHGPHLP  TDTIIA G+  R+   LP  L V  +P +P+GYSI
Sbjct: 6   EQNSDMIVVLPLGAHEQHGPHLPFETDTIIAEGIVARVSDALPADLNVNFLPAQPVGYSI 65

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EHM  +GT++L YAEA+  W+ I + +   GIRK+V+LNAHGGNSPL++IV+TE R R  
Sbjct: 66  EHMDTEGTQSLAYAEAVNQWIGIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELRTRLD 125

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NFS+ QS +
Sbjct: 126 MLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMSKARNFSNAQSRY 185

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
              F++LRA+G H+FGW M DLNP+GV GNA  AT + GE L++     FI LL D++ F
Sbjct: 186 AEEFRFLRAYGPHAFGWKMHDLNPEGVAGNAAAATAEAGEKLIANAVAGFIDLLRDVDRF 245

Query: 257 DVSIF 261
           D++ F
Sbjct: 246 DLARF 250


>gi|254501782|ref|ZP_05113933.1| creatininase subfamily [Labrenzia alexandrii DFL-11]
 gi|222437853|gb|EEE44532.1| creatininase subfamily [Labrenzia alexandrii DFL-11]
          Length = 266

 Score =  261 bits (666), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 169/241 (70%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
            R+DWI VLP+ A EQHGPHLP++TDT +A G  +R+  ++P  LPVT +PV+ IG S E
Sbjct: 19  GREDWIAVLPVAAVEQHGPHLPLSTDTTLAEGQIQRVIELIPKHLPVTFLPVQTIGKSDE 78

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           H+   GT TL++    + W+ I +++ + GIRK+VI+N+HGGN P++ IVS E R++  M
Sbjct: 79  HIDYPGTLTLSWDTITKCWIEIGESVARAGIRKLVIINSHGGNVPVIDIVSRELRIKHDM 138

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
            V+ T+W RF  P+G+    E   GIHGG+IETS+MLAL P LV+++L+++FSS Q  FL
Sbjct: 139 FVLGTNWLRFGQPEGLFPDDEFTYGIHGGDIETSLMLALRPDLVRVELSQDFSSEQQSFL 198

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
           + F+YLR HG   FGW  +DLNP G  GNA  ATV+KG   L++ A  FI+LL D+ S++
Sbjct: 199 KEFRYLRGHGKAQFGWKAQDLNPHGTQGNASAATVEKGRQSLNHAAQAFIELLEDVQSYN 258

Query: 258 V 258
           +
Sbjct: 259 L 259


>gi|319409084|emb|CBI82729.1| creatinine amidohydrolase [Bartonella schoenbuchensis R1]
          Length = 247

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/237 (51%), Positives = 167/237 (70%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA+E HG HLP  TD IIA   A+ +   +  +  +  +PVE IGYSIEHM V 
Sbjct: 8   LALLPLGAHEYHGNHLPFETDWIIAEAFAKALILQIKGQFHIKLLPVEKIGYSIEHMDVP 67

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT+TLT+++AIE W+ I +   + GI++ + LNAHGGNSPL+SIV TE R RFSML V+T
Sbjct: 68  GTQTLTFSDAIERWINIGERCHRKGIKRFLFLNAHGGNSPLISIVITELRKRFSMLAVAT 127

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW+RF +P+G+I   E  + IHGG IETS+ML LAP  V+M+ AENF ++Q++ + N++Y
Sbjct: 128 SWNRFGLPEGLIEPSEHHLDIHGGFIETSLMLYLAPEKVQMEQAENFYNKQADMIANYQY 187

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           LRA+G H+FGW+M+DLNP+G  GNA  AT K G  + S+       LL DIN F +S
Sbjct: 188 LRAYGPHAFGWTMRDLNPRGAAGNASKATSKAGAAIFSHVLCGLRDLLYDINQFKIS 244


>gi|240851047|ref|YP_002972447.1| creatinine amidohydrolase [Bartonella grahamii as4aup]
 gi|240268170|gb|ACS51758.1| creatinine amidohydrolase [Bartonella grahamii as4aup]
          Length = 247

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/241 (49%), Positives = 172/241 (71%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           ++ +LPLGA+E HG HLP  TD IIA   A+ +      +  +  +PVE IGYSIEHM V
Sbjct: 7   FLALLPLGAHEYHGEHLPFETDWIIAEAFAKALTLQTKEQFHIALLPVEKIGYSIEHMDV 66

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT+TLT+++AIE W++I +   + GI++ ++LNAHGGNSPL+SIV TE R RFSML V+
Sbjct: 67  TGTQTLTFSDAIERWISIGENCYRKGIKRFLLLNAHGGNSPLMSIVITELRRRFSMLAVA 126

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSWSRF +PQG+++  +  + IHGG IETS+ML LAP  V M+ A NF ++Q++ + N++
Sbjct: 127 TSWSRFGLPQGLMAPSQQHLDIHGGFIETSLMLYLAPEKVHMEKATNFHNKQADMIANYQ 186

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           YLRA+G H+FGW+M+DLN +G  GNA  AT + GE + S+  +    LL+DIN F+++ +
Sbjct: 187 YLRAYGPHAFGWTMRDLNTQGAAGNASKATPQAGEAIFSHVLSQLRDLLDDINRFNINTW 246

Query: 262 D 262
            
Sbjct: 247 Q 247


>gi|254472937|ref|ZP_05086335.1| creatinine amidohydrolase, putative [Pseudovibrio sp. JE062]
 gi|211957658|gb|EEA92860.1| creatinine amidohydrolase, putative [Pseudovibrio sp. JE062]
          Length = 287

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 168/244 (68%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           +WI VLP+ A EQHGPHLP+ TDT IA G   R   +LP  LPVT +PV+ +G S EH  
Sbjct: 44  EWIAVLPIAAIEQHGPHLPVYTDTCIAEGQVARTVELLPDDLPVTFLPVQAVGKSDEHHS 103

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT +LT+  A++ W+ I + + + GIRK+V+ N+HGGNSPL+ I++ + R++ +ML V
Sbjct: 104 FPGTLSLTWETAVKAWIEIGECVARAGIRKLVLANSHGGNSPLMDIITRDLRLKHNMLAV 163

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
            +SW RF  P+G+ S  E   GIHGG+IETS+MLAL P LV+MD A +F+S Q++ + N 
Sbjct: 164 ESSWLRFGQPEGLFSEEEFTYGIHGGDIETSIMLALRPDLVRMDQATDFTSTQTDHINND 223

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
            YLRAHG H +GW  +DLN  G +GNA  AT +KG+  L++ +  FI+LL D+  FDVS 
Sbjct: 224 AYLRAHGRHQYGWMSEDLNKTGALGNASLATAEKGQASLTHASQEFIKLLRDVQRFDVSS 283

Query: 261 FDKD 264
           F K+
Sbjct: 284 FGKN 287


>gi|328542404|ref|YP_004302513.1| Creatininase subfamily [polymorphum gilvum SL003B-26A1]
 gi|326412151|gb|ADZ69214.1| Creatininase subfamily [Polymorphum gilvum SL003B-26A1]
          Length = 269

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 165/249 (66%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
            +L     + KDWI VLP+ A EQHGPHLP+ TDT IA G   R   +LP  +P T +PV
Sbjct: 13  TTLDFADPSVKDWIAVLPVAAIEQHGPHLPVFTDTAIAIGQVRRTLDMLPADIPATFLPV 72

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
           + IG S EH+   GT TL++      WL I  ++ + GIRK+VI+N+HGGN P++ IV+ 
Sbjct: 73  QAIGKSNEHISSPGTLTLSWDTVTRAWLEIGHSVARAGIRKLVIINSHGGNVPIIDIVAR 132

Query: 130 EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENF 189
           E R+   MLV +T+WSRF  P+G+    E   GIHGG++ETS+ML L P LV+M+LAE+F
Sbjct: 133 ELRVTHEMLVTATAWSRFGQPEGLFPSEEFTYGIHGGDVETSLMLHLHPELVRMELAEDF 192

Query: 190 SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
           +S Q +F++ FKYLR HG   FGW  +DL  KG +GNA +A+  KG   L + A  F++L
Sbjct: 193 TSAQQDFIKEFKYLRGHGQQQFGWKAQDLGAKGALGNAANASADKGRASLDHAAREFVEL 252

Query: 250 LNDINSFDV 258
           L D+++FD+
Sbjct: 253 LKDVHAFDI 261


>gi|319899180|ref|YP_004159273.1| creatinine amidohydrolase [Bartonella clarridgeiae 73]
 gi|319403144|emb|CBI76702.1| creatinine amidohydrolase [Bartonella clarridgeiae 73]
          Length = 247

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 118/240 (49%), Positives = 165/240 (68%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA+E HG HLP  TD IIA   A+ +      +  +T +PVE +GYS+EHM V 
Sbjct: 8   LALLPLGAHEYHGNHLPFETDWIIAESFAKALALATKEQFQITLLPVEKVGYSVEHMSVI 67

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT+TLT+++AIE W+ I +     GI++ +ILNAHGGN+PL+SIV TE R RFSML V+T
Sbjct: 68  GTQTLTFSKAIERWINIGENCYHKGIKRFLILNAHGGNTPLMSIVITELRRRFSMLAVAT 127

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW+RF +P+G++   +  + IHGG IETS+ML LAP  V MD AENF ++Q+E ++N++Y
Sbjct: 128 SWNRFDLPEGLMEQSQKHLDIHGGFIETSLMLYLAPEKVHMDKAENFHNKQAEMIQNYRY 187

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFD 262
           LRA+G H+FGW M D+N +G  GNA  AT K GE + S+       LL+D+  F + +  
Sbjct: 188 LRAYGPHAFGWMMHDINEQGAAGNASQATAKAGEAIFSHVLCELRALLDDMKKFKIDLLQ 247


>gi|319406030|emb|CBI79660.1| creatinine amidohydrolase [Bartonella sp. AR 15-3]
          Length = 246

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 120/236 (50%), Positives = 162/236 (68%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA+E HG HLP  TD IIA   A+ +      +  +T +PVE IGYS+EHM V 
Sbjct: 8   LALLPLGAHEYHGNHLPFETDWIIAESFAKALTLATKEQFQITLLPVEKIGYSVEHMDVI 67

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT+TLT+++AI+ W+ I +     GIR+ +ILNAHGGN PL++IV TE R RF+ML V+T
Sbjct: 68  GTQTLTFSKAIKRWIHIGENCYHKGIRRFLILNAHGGNGPLMNIVITELRRRFAMLAVAT 127

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SWSRF +P+G++   +  + IHGG IETS+ML LAP  V M+  ENF ++Q+E ++N++Y
Sbjct: 128 SWSRFGLPEGLMEPSQAHLDIHGGFIETSLMLYLAPEKVHMEKTENFYNKQAEMIQNYRY 187

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           LRA+G HSFGW M DLN KG  GNA  AT + GE + S+       LLNDI  F +
Sbjct: 188 LRAYGPHSFGWMMHDLNEKGAAGNASQATAQAGEAIFSHVLRELRALLNDIKKFKI 243


>gi|110635177|ref|YP_675385.1| creatininase [Mesorhizobium sp. BNC1]
 gi|110286161|gb|ABG64220.1| Creatininase [Chelativorans sp. BNC1]
          Length = 246

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 171/244 (70%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A ++ I +LPLGA EQHGPHLP  TD IIA  +A+RIK  +   + +  +PVE  GYSIE
Sbjct: 2   APREKIAILPLGATEQHGPHLPPETDWIIAEAIADRIKMRVGGAMHLDILPVEKTGYSIE 61

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           H     T++L + EAIE W+ I + + + G  K V+LNAHGGNSPL++IV+TE R R  M
Sbjct: 62  HSDDPRTRSLGFPEAIERWIGIGEDLCRKGTYKFVMLNAHGGNSPLMTIVATELRARHGM 121

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
           L V+TSW+RF  P G++S  E  +GIHGG IETS+MLAL P LVKM+ A++FSS Q+ F 
Sbjct: 122 LAVATSWTRFGTPPGLVSDVEKALGIHGGFIETSVMLALRPDLVKMEEAKDFSSEQARFQ 181

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
           R F YLRA+G H+FGW M+DL+ +GVVGNA  A+ + GE LL +  + F +LL D++ F+
Sbjct: 182 REFTYLRAYGPHAFGWMMRDLSAEGVVGNAAAASAEAGETLLEHAVSGFAELLADVDRFE 241

Query: 258 VSIF 261
           +  F
Sbjct: 242 LKTF 245


>gi|49474560|ref|YP_032602.1| hypothetical protein BQ10260 [Bartonella quintana str. Toulouse]
 gi|49240064|emb|CAF26494.1| hypothetical protein BQ10260 [Bartonella quintana str. Toulouse]
          Length = 246

 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 118/237 (49%), Positives = 166/237 (70%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           ++ +LPLGA+E HG HLP  TD IIA   A+ +      +  +  +PVE IGYS+EHM V
Sbjct: 7   FLALLPLGAHEYHGNHLPFETDWIIAEAFAKALILQTKKQFSIALLPVEKIGYSVEHMDV 66

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT+T T++ AIE W+ I +   + GI++ ++LNAHGGNSPL+SIV TE R RFSML V+
Sbjct: 67  AGTQTRTFSNAIERWINIGENCYRKGIKRFLLLNAHGGNSPLMSIVITELRRRFSMLAVA 126

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSW+RF +PQG++   +  + IHGG IETS+ML LAP  V M+ AENF ++Q++ + N++
Sbjct: 127 TSWNRFGLPQGLMKPSQHHLDIHGGFIETSLMLYLAPEKVHMEKAENFHNKQADMIANYQ 186

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           YLRA+G H+FGW+M+DLN +G  GNA +AT + GE + S+       LL+DIN F +
Sbjct: 187 YLRAYGPHAFGWTMRDLNLQGAAGNAREATSQAGEAIFSHVLCGLRGLLDDINRFKI 243


>gi|121601642|ref|YP_989369.1| creatininase [Bartonella bacilliformis KC583]
 gi|120613819|gb|ABM44420.1| creatininase [Bartonella bacilliformis KC583]
          Length = 247

 Score =  251 bits (641), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 117/237 (49%), Positives = 164/237 (69%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           ++ +LPLGA+E HG HLP  TD IIA   A+ +      +  +TC+PVE IGYS+EHM +
Sbjct: 7   FLALLPLGAHEYHGDHLPFETDWIIAESFAKALILKTKKQFHITCLPVEKIGYSVEHMDI 66

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT+TLT+ +AIE W+ I +   + GI+++++LNAHGGNSPL+SIV TE R RFSML V+
Sbjct: 67  AGTQTLTFFDAIERWINIGENCYRKGIKRLLLLNAHGGNSPLMSIVITELRKRFSMLAVA 126

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSW RF +P+G++   +  + IHGG +ETS+ML LAP  V M  A+NF ++Q++ +   K
Sbjct: 127 TSWKRFGLPEGLMEASQHHLDIHGGFLETSLMLYLAPEKVHMKKAKNFHNKQADMIAYHK 186

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           YLRA+G H+FGW M+DLN +G  GNA  AT + GE + S+       LL+DIN F +
Sbjct: 187 YLRAYGPHAFGWIMRDLNAQGAAGNASQATSQAGEAIFSHVLCGLCDLLDDINQFKI 243


>gi|49475992|ref|YP_034033.1| hypothetical protein BH12970 [Bartonella henselae str. Houston-1]
 gi|49238800|emb|CAF28071.1| hypothetical protein BH12970 [Bartonella henselae str. Houston-1]
          Length = 246

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/237 (49%), Positives = 166/237 (70%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           ++ +LPLGA+E HG HLP  TD IIA   A+ +      +  +  +PVE IGYSIEHM V
Sbjct: 7   FLALLPLGAHEYHGDHLPFETDWIIAEAFAKALTVKTKKQFHIALLPVEKIGYSIEHMDV 66

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT+TLT++EAIE W+ I +   + GI++ ++LNAHGGNSPL+SIV TE R RFSML V+
Sbjct: 67  SGTQTLTFSEAIERWINIGEDCYRKGIKRFLLLNAHGGNSPLMSIVITELRKRFSMLAVA 126

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSW+RF +P G++   +  + IHGG IETS+ML LAP  V M+ A+NF ++Q++ + N++
Sbjct: 127 TSWTRFGLPHGLMHPSQHHLDIHGGFIETSLMLYLAPEKVHMEKAKNFYNKQADMIANYQ 186

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           YLRA+G H+FGW+M+DLN +G  G A +AT + G+ + S+       LL+DIN F +
Sbjct: 187 YLRAYGPHAFGWTMRDLNLQGAAGKAREATSQAGKAIFSHVLGGLRGLLDDINRFKI 243


>gi|307944411|ref|ZP_07659751.1| creatininase [Roseibium sp. TrichSKD4]
 gi|307772160|gb|EFO31381.1| creatininase [Roseibium sp. TrichSKD4]
          Length = 266

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/248 (47%), Positives = 165/248 (66%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           AD   +WI VLP+ A EQHGPHLP++TDT IA G  +++  ILP  LPVT +P++ IG S
Sbjct: 17  ADTVSEWIAVLPVAAIEQHGPHLPVSTDTAIAEGQIKKVLEILPDHLPVTFLPLQAIGKS 76

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            EH+   GT TL++     +W+ I + + + G+RK+VI+NAHGGN P++  V+ E R+  
Sbjct: 77  NEHITSPGTLTLSWETLTRNWIEIGECVARAGLRKLVIINAHGGNVPVMDTVALELRINC 136

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
            MLV +T+W RF  P G+    E   GIHGG+IETS+M+ L P LV+ D   +F S Q +
Sbjct: 137 GMLVTATNWLRFGQPDGLYPEEEFSYGIHGGDIETSIMMHLHPDLVRTDQLRDFPSAQQD 196

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           FLR+FK+LR HG   FGW  KDLNP+G +GNA +A+  KG   L + A  FI+LL D+++
Sbjct: 197 FLRDFKHLRGHGKAQFGWMAKDLNPEGALGNAANASADKGRQSLEHAAKGFIELLEDVHA 256

Query: 256 FDVSIFDK 263
           FD+   D+
Sbjct: 257 FDMGRLDQ 264


>gi|163868834|ref|YP_001610060.1| creatinine amidohydrolase [Bartonella tribocorum CIP 105476]
 gi|161018507|emb|CAK02065.1| creatinine amidohydrolase [Bartonella tribocorum CIP 105476]
          Length = 247

 Score =  248 bits (633), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 116/240 (48%), Positives = 168/240 (70%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           ++ +LPLGA+E HG HLP  TD IIA   ++ +      +  +  +PVE IGYS+EHM V
Sbjct: 7   FLALLPLGAHEYHGEHLPFETDWIIAEAFSKALILQTKEQFHIALLPVEKIGYSVEHMDV 66

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT+TLT+++AI+ W+ I +     GI+++++LNAHGGNSPL++IV TE R R SML V+
Sbjct: 67  IGTQTLTFSDAIKRWIKIGENCYHKGIKRLLLLNAHGGNSPLMNIVITELRRRLSMLAVA 126

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSWSRF +PQG+I   +  + IHGG IETS+ML LAP  V M+ A NF ++Q++ + N++
Sbjct: 127 TSWSRFGLPQGLIEPAQQHLDIHGGFIETSLMLYLAPEKVHMEKAANFHNKQADMIANYR 186

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           YLRA+G H+FGW+M+DLN  G  GNA  AT + GE + S+  +    LL+DIN F+++ +
Sbjct: 187 YLRAYGPHAFGWTMRDLNTHGAAGNASKATPQAGEAIFSHVLSQLRDLLDDINRFNINTW 246


>gi|118588462|ref|ZP_01545871.1| Creatininase [Stappia aggregata IAM 12614]
 gi|118439168|gb|EAV45800.1| Creatininase [Stappia aggregata IAM 12614]
          Length = 267

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 114/240 (47%), Positives = 162/240 (67%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +DWI VLP+ A EQHGPHLP++TDT IA G  +R+  +LP  LPVT +PV+ +G S EH+
Sbjct: 21  EDWIAVLPVAAIEQHGPHLPLSTDTTIAEGQIQRVLELLPDGLPVTFLPVQAVGKSDEHI 80

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              GT TL +      WL + +++ + GIRK+V++N+HGGN P++ IV+ E R++  M V
Sbjct: 81  SSPGTLTLAWDTVTRCWLELGESVARAGIRKLVLINSHGGNVPVLDIVARELRVKHGMFV 140

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
            +T+W RF  P G+ +  E   GIHGG+IETS+ML L P LV+M+LA +F S+Q  +L+ 
Sbjct: 141 TATNWLRFGQPDGLYADEEFTYGIHGGDIETSLMLHLRPDLVRMELAADFPSQQQSYLKE 200

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           FK+LR HG   +GW  +DLN  G +GNA  A+ +KG   L + A  FI+LL D+ SFD+ 
Sbjct: 201 FKHLRGHGKAQYGWKAQDLNETGALGNAALASAEKGRQSLDHAARGFIELLEDVRSFDLE 260


>gi|319407527|emb|CBI81175.1| creatinine amidohydrolase [Bartonella sp. 1-1C]
          Length = 247

 Score =  244 bits (624), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 117/230 (50%), Positives = 158/230 (68%)

Query: 29  GAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLT 88
           GA+E HG HLP  TD IIA   A+ +      +  +T +PVE IGYS+EHM V GT+TLT
Sbjct: 14  GAHEYHGNHLPFETDWIIAESFAKALTLETKEQFQITLLPVEKIGYSVEHMNVIGTQTLT 73

Query: 89  YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFT 148
           ++ AIE W+ I +     GIR+ +ILNAHGGN+PL++IV TE R RFSML V+TSWSRF 
Sbjct: 74  FSGAIERWINIGEHCYHKGIRRFLILNAHGGNAPLMNIVITELRKRFSMLAVATSWSRFG 133

Query: 149 IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGS 208
           +P+G++   +  + IHGG IETS+ML LAP  V M+  ENF ++Q+E ++N++YLRA+G 
Sbjct: 134 LPKGLMDPSQIHLDIHGGFIETSLMLYLAPEKVHMEKTENFHNKQAEMIQNYQYLRAYGP 193

Query: 209 HSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           H+FGW M DLN +GV GNA  AT + GE + S+       LL+DI  F +
Sbjct: 194 HAFGWMMHDLNEQGVAGNASQATAQAGEAIFSHVLCGLRALLDDIKKFKI 243


>gi|319404535|emb|CBI78139.1| creatinine amidohydrolase [Bartonella rochalimae ATCC BAA-1498]
          Length = 247

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 158/230 (68%)

Query: 29  GAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLT 88
           GA+E HG HLP  TD IIA   A+ +      +  +T +PVE IGYS+EHM V GT+TLT
Sbjct: 14  GAHEYHGNHLPFETDWIIAESFAKALTLETKEQFQITLLPVEKIGYSVEHMNVIGTQTLT 73

Query: 89  YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFT 148
           ++ AIE W+ I +     GIR+ +ILNAHGGN+PL++IV TE R RFSML V+TSWSRF 
Sbjct: 74  FSGAIERWINIGEHCYHKGIRRFLILNAHGGNAPLMNIVITELRKRFSMLAVATSWSRFG 133

Query: 149 IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGS 208
           +P+G++   +  + IHGG IETS+ML LAP  V M+  ENF ++Q+E ++N++YLRA+G 
Sbjct: 134 LPEGLMDPSQIHLDIHGGFIETSLMLYLAPEKVHMEKTENFHNKQAEMIQNYQYLRAYGP 193

Query: 209 HSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           H+FGW M DLN +GV GNA  AT + G+ + S+       LL+DI  F +
Sbjct: 194 HAFGWMMHDLNEQGVAGNASQATAQAGKAIFSHVLCGLRALLDDIKKFKI 243


>gi|218461974|ref|ZP_03502065.1| Creatininase [Rhizobium etli Kim 5]
          Length = 199

 Score =  235 bits (599), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 145/196 (73%), Gaps = 1/196 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P   F D+  P  A  R+  I VLPLGA+EQHGPHLP  TDT+IA G+A R+K+ LP 
Sbjct: 2   MTPSPRFEDSD-PASAAGRRCPIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKAALPA 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPVT +P E +GYSIEHM V+GTKTLT+ EA+  WL I + + K  IRK+V+LNAHGGN
Sbjct: 61  GLPVTFLPAESVGYSIEHMDVEGTKTLTFDEAVHRWLGIAEGLAKQNIRKLVMLNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPL++IV+TEAR+RF+ML V+TSW+RF +P G+I   E  IGIHGG+IETS+MLAL P  
Sbjct: 121 SPLMTIVATEARVRFAMLAVATSWTRFGLPDGVIPPVEKAIGIHGGDIETSVMLALHPDR 180

Query: 181 VKMDLAENFSSRQSEF 196
           V M  A +F SRQ+E 
Sbjct: 181 VDMAKAADFPSRQTEL 196


>gi|209883206|ref|YP_002287063.1| creatininase [Oligotropha carboxidovorans OM5]
 gi|209871402|gb|ACI91198.1| creatininase [Oligotropha carboxidovorans OM5]
          Length = 267

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 157/241 (65%), Gaps = 4/241 (1%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
            WI VLPL A EQHGPHLP+ TDT+IA      +++ LPP +P + +PV+ +G+SIEH+ 
Sbjct: 21  QWIAVLPLAATEQHGPHLPLGTDTMIAEAYLAEVQAQLPPNIPASFLPVQSVGFSIEHID 80

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT TL Y  AI HW+++ +++ + G++KIV++ +HGGNS  ++IV+ E R R  ML V
Sbjct: 81  YPGTVTLPYHVAIRHWMSLGESVARSGVKKIVMVTSHGGNSAPMAIVAQELRSRVGMLAV 140

Query: 141 STSWSRFTIPQGIISFPETEI--GIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           ST+W RF  P+G+  FPE E+  G+HGG IETS+MLA  P LV+ D    F         
Sbjct: 141 STNWHRFGTPEGL--FPEEEVTHGVHGGAIETSIMLAARPDLVRKDKIAKFEPSSVAMAN 198

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
            F++L  H    F W+ +DL+P GV G+A  AT  KG  LL++ A  F +LL D+++FD+
Sbjct: 199 EFRWLSPHRPAPFAWAAQDLHPSGVAGDATLATADKGRQLLTHGAKAFCELLADVHAFDM 258

Query: 259 S 259
           +
Sbjct: 259 A 259


>gi|304393374|ref|ZP_07375302.1| creatininase [Ahrensia sp. R2A130]
 gi|303294381|gb|EFL88753.1| creatininase [Ahrensia sp. R2A130]
          Length = 243

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 116/239 (48%), Positives = 156/239 (65%), Gaps = 3/239 (1%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I ++PLGA+EQHGPHLP  TD +IA+G+ +R  +     L +  MP EP+GYS EHM  +
Sbjct: 6   ITIIPLGAHEQHGPHLPFETDALIASGVMQRTLAK-AADLNLHVMPAEPVGYSPEHMRFE 64

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           G++TL ++EAI  W+ + +     G  +IV +NAHGGN PLV IV  E R R ++L VST
Sbjct: 65  GSRTLGWSEAIIRWIGLGEQAIADGSDRIVFMNAHGGNVPLVQIVCQELRSRHAVLAVST 124

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W RFT   GI+S  E  +GIHGGEIET++MLAL P LV M  A +F + QS       +
Sbjct: 125 KWDRFTRGYGIVSQSEEALGIHGGEIETAVMLALHPELVDMSKAVDFPNLQSRL--TGPH 182

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           LRA+G HSFGW M DLNP GV GN+  AT + GE LL   ++  + LL+++  FD+S+ 
Sbjct: 183 LRAYGPHSFGWMMGDLNPDGVAGNSAAATAETGEKLLDIASDGLLALLHEVADFDLSLL 241


>gi|299132803|ref|ZP_07025998.1| Creatininase [Afipia sp. 1NLS2]
 gi|298592940|gb|EFI53140.1| Creatininase [Afipia sp. 1NLS2]
          Length = 270

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 154/242 (63%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A  +WI VLPL A EQHGPHLP+ TDT IA     R++++LP  +P + +PV+ IG+SIE
Sbjct: 21  AASEWIAVLPLAATEQHGPHLPVGTDTFIAEAYLARVQALLPGHVPASFLPVQSIGFSIE 80

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           H+   GT TL Y  AI HW+++ +++ + G++K+V++ +HGGNS  ++IV+ E R R  M
Sbjct: 81  HIDYPGTVTLPYHVAIRHWMSLGESVARSGVKKLVMVTSHGGNSAPMAIVAQELRARLGM 140

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
           L V+T+W RF  P+G+    E   GIHGG +ETS+MLA  P LV+ D   NF        
Sbjct: 141 LAVTTNWHRFGTPEGLFPHEEIAHGIHGGAVETSIMLAAQPDLVRKDKIANFEPASVAMA 200

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
           R F++L  H    F W+ +DL+P GV G+A  A+  KG  L+ + A    +LL D++ FD
Sbjct: 201 REFRWLSPHRPAPFAWAAQDLHPSGVAGDATLASADKGRQLIEHGAKALCELLADVHGFD 260

Query: 258 VS 259
           ++
Sbjct: 261 MA 262


>gi|148258657|ref|YP_001243242.1| hypothetical protein BBta_7483 [Bradyrhizobium sp. BTAi1]
 gi|146410830|gb|ABQ39336.1| hypothetical protein BBta_7483 [Bradyrhizobium sp. BTAi1]
          Length = 275

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 106/238 (44%), Positives = 153/238 (64%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           WI VLPL A EQHGPHLP+ TD  IA+    R++++LP  LPVT +PV+P+G S EH+  
Sbjct: 28  WIAVLPLAATEQHGPHLPLGTDVYIASAYLARVRTLLPATLPVTILPVQPVGISTEHIDY 87

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT T+    A++ W AI D++ + G+RK+VI+ +HGGNS  +++V+ E R    MLVV+
Sbjct: 88  PGTLTVPTEIALQSWRAIGDSVARAGLRKLVIVTSHGGNSAAMTLVAQELRAVHRMLVVT 147

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSWSRF +P G+ S  E   GIHGG +ETS+MLA  P LV+ +   +F+S  +E  + ++
Sbjct: 148 TSWSRFGVPDGLFSADEMRHGIHGGAVETSIMLACHPELVRSEAIADFASSAAEMEKTYR 207

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
            L         W  +DLN  G VG+A  A+ +KGE +L++ A  F  LL ++  FDV+
Sbjct: 208 VLSTQRPAPLAWQTQDLNASGAVGDATQASAEKGERVLAHGARAFCTLLEEVGHFDVN 265


>gi|146337820|ref|YP_001202868.1| putative creatinine amidohydrolase [Bradyrhizobium sp. ORS278]
 gi|146190626|emb|CAL74628.1| Conserved hypothetical protein; putative creatinine amidohydrolase
           (=creatininase) [Bradyrhizobium sp. ORS278]
          Length = 275

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 150/240 (62%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           WI VLPL A EQHGPHLP+ TD  IA     R++++LPP LPVT +PV+P+G S EH+  
Sbjct: 28  WIAVLPLAATEQHGPHLPLGTDVYIAEAYLARVRALLPPALPVTVLPVQPVGISTEHIDF 87

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT T+    A++ W A+ D++ + G+RK+VI+ +HGGNS  +++V+ + R    MLVV+
Sbjct: 88  PGTLTVPTETALQSWRALGDSVARAGLRKLVIVTSHGGNSAAMTLVAQDLRAAHRMLVVT 147

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSWSRF  P+G+ S  E   GIHGG +ETS+MLA  P LV+ +   +F S      R  +
Sbjct: 148 TSWSRFGAPEGLFSADELRHGIHGGAVETSIMLARHPQLVRGNAIADFVSSAVATERANR 207

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
            L       F W  +DLN  G VG+A  A+ +KGE +L + A  F  LL DI+ FDV+  
Sbjct: 208 VLSTQRPAPFAWQTQDLNASGAVGDATQASAEKGERVLDHGAAAFCALLEDIDKFDVNTL 267


>gi|85713473|ref|ZP_01044463.1| creatininase [Nitrobacter sp. Nb-311A]
 gi|85699377|gb|EAQ37244.1| creatininase [Nitrobacter sp. Nb-311A]
          Length = 272

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 106/248 (42%), Positives = 155/248 (62%)

Query: 14  LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG 73
           + A+   +WI VLPL A EQHGPHLP+ TD +IA     +++ +LP  +P T +PV+P+G
Sbjct: 17  VAAENAANWIAVLPLAATEQHGPHLPLTTDVLIAEAYIAKVRELLPQDIPATFLPVQPVG 76

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
            S EHM   GT+TLT   A+  W A+ + + + GI+KIV++++HGGNS  +S+V+ + R 
Sbjct: 77  ISTEHMDFPGTRTLTNEAALRAWTALGEEVARRGIKKIVMVSSHGGNSAAMSMVAQDLRA 136

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           R  ML VST+WSRF +P G+    E   GIHGG +ETS+MLA  P  V+ D   +FS   
Sbjct: 137 RHRMLAVSTAWSRFGVPDGLFDAQELRHGIHGGAVETSIMLARYPDQVRSDCIADFSPAS 196

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
               + +++L       F W  +DL+P G VG+A  A+ +KGE LL++ A  F +LL DI
Sbjct: 197 IAIEKTYRWLGTRRPAPFAWQAQDLHPSGAVGDATLASAEKGERLLAHGARAFCELLADI 256

Query: 254 NSFDVSIF 261
             FD ++ 
Sbjct: 257 MKFDPAVL 264


>gi|115522139|ref|YP_779050.1| creatininase [Rhodopseudomonas palustris BisA53]
 gi|115516086|gb|ABJ04070.1| Creatininase [Rhodopseudomonas palustris BisA53]
          Length = 270

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 106/242 (43%), Positives = 149/242 (61%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           WI VLPL A EQHGPHLP+ TD  IA     R+  +LP  LPV+ +P++PIG S EH+  
Sbjct: 25  WIAVLPLAATEQHGPHLPLGTDVTIAQAYLTRVHELLPADLPVSFLPLQPIGISTEHIDY 84

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT TL  A AIE W AI D++ + G+RK+V++ +HGGNS  +++V+ E R R  ML V+
Sbjct: 85  PGTLTLPPAVAIESWSAIGDSVARAGVRKLVLVTSHGGNSAAMALVAQELRARHRMLAVT 144

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSWSRF +P+G+    E   GIHGG +ETS+MLA AP  V+ D   +F S      +  +
Sbjct: 145 TSWSRFGVPEGLFDAEELRHGIHGGAVETSIMLAHAPDQVRTDKIAHFQSAGIAIAQQHR 204

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
            L         W  +DL+P G VG+A  A+ +KG  L+ + A  F  LL+D++ FD++  
Sbjct: 205 LLSTQRPAPLAWQAQDLHPSGAVGDATQASAQKGRQLIDHGARAFCDLLDDVDRFDLAAL 264

Query: 262 DK 263
            +
Sbjct: 265 GR 266


>gi|323136933|ref|ZP_08072013.1| Creatininase [Methylocystis sp. ATCC 49242]
 gi|322397694|gb|EFY00216.1| Creatininase [Methylocystis sp. ATCC 49242]
          Length = 263

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 109/239 (45%), Positives = 147/239 (61%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP+  D +I  G  ER+   LP  L    +PV+ +G SIEH    
Sbjct: 24  IAVLPIAAVEQHGPHLPLGVDAMIMEGCIERVSMRLPEDLEAVFLPVQSVGVSIEHRDFP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L+   A      I + + + G++K+V++N+HGGNS L+S V+ + R RF +L V+ 
Sbjct: 84  GTLSLSQETAARMLGEIAEGVVRAGVKKLVLMNSHGGNSALISQVALDLRARFGVLAVTC 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW+RF  P G+    E   GIHGGEIETS+MLA  P LV M  A+NF     +F R+F +
Sbjct: 144 SWARFGYPDGLFPAQEQRHGIHGGEIETSLMLAFRPELVDMARAKNFPPATLDFERDFAW 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           LRA     FGW  +DL+P G +G+A  AT  KGE +  Y+A  FI+LL DI SFD+  F
Sbjct: 204 LRADRPAGFGWMAQDLSPAGAMGDATKATAGKGEAVADYWATAFIELLRDIESFDLERF 262


>gi|316931547|ref|YP_004106529.1| creatininase [Rhodopseudomonas palustris DX-1]
 gi|315599261|gb|ADU41796.1| Creatininase [Rhodopseudomonas palustris DX-1]
          Length = 270

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 107/250 (42%), Positives = 155/250 (62%), Gaps = 1/250 (0%)

Query: 13  PLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEP 71
           P  AD++ + WI VLPL A EQHGPHLP++TD  IA     R+  +LP  LP + +P++ 
Sbjct: 15  PEIADSQPERWIAVLPLAATEQHGPHLPLSTDVDIAEAYLARVHDLLPAELPASFLPLQA 74

Query: 72  IGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
           IG S EH+   GT TL+   A+  W  I D+I + G+RK+V++ +HGGNS  + +V+ E 
Sbjct: 75  IGLSTEHLAFPGTLTLSAETALRVWTEIGDSIARAGVRKLVMVTSHGGNSAAMGLVAQEL 134

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSS 191
           R R  MLVV+T W+RF +P G+ +  E   GIHGG +ETS+MLA AP LV+ D    F  
Sbjct: 135 RARHRMLVVTTGWARFGVPDGLFAADELRHGIHGGAVETSIMLAHAPALVRTDRLAEFRP 194

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                 + +++L A     F W+ +DL+P G +G+A  AT +KG  LL + A  F +LL+
Sbjct: 195 ASVAMEQQYRWLSAQRPAPFAWAAEDLHPGGAIGDATAATAEKGRQLLDHGARAFCELLD 254

Query: 252 DINSFDVSIF 261
           DI+ FD++  
Sbjct: 255 DIHRFDLAAL 264


>gi|118592958|ref|ZP_01550346.1| probable creatininase (creatinine amidohydrolase) protein [Stappia
           aggregata IAM 12614]
 gi|118434492|gb|EAV41145.1| probable creatininase (creatinine amidohydrolase) protein [Stappia
           aggregata IAM 12614]
          Length = 265

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 108/237 (45%), Positives = 153/237 (64%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP  + EQHGPHLP+ TD +IA G+    +  LP  + +  +PV+ IG + EH+Y  
Sbjct: 24  IAILPTASTEQHGPHLPIATDVVIAVGMLAETRKQLPDDVDILVLPVQEIGKANEHIYGP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L     I  W AI   + + GIRK+VI+N+HGGN+ ++SIVS E R+R+ M V+ T
Sbjct: 84  GTLSLGAELLIPVWTAIGQKVSEAGIRKMVIVNSHGGNTDIISIVSRELRVRYEMAVLVT 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            WSRF  P+G+IS  E++ GIHGGE+ETS+ML   P LV+MD AENF SR  E L N KY
Sbjct: 144 HWSRFGHPEGMISAHESKFGIHGGEVETSLMLHFRPELVRMDKAENFVSRAEEMLENSKY 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           ++    H+  W   DLNP GVVG+A   T +KG  + ++ A  FI++L D  ++ ++
Sbjct: 204 IQPTPPHALAWIAHDLNPAGVVGDASKGTAEKGAAISAHQAAGFIEMLRDFAAYPLA 260


>gi|91974743|ref|YP_567402.1| creatininase [Rhodopseudomonas palustris BisB5]
 gi|91681199|gb|ABE37501.1| Creatininase [Rhodopseudomonas palustris BisB5]
          Length = 270

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 106/256 (41%), Positives = 154/256 (60%), Gaps = 1/256 (0%)

Query: 7   FTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
           +T+   P   DA    WI VLPL A EQHGPHLP+ TD +IA     R+  +LP  LPV+
Sbjct: 9   WTEIRWPEIGDADPARWIAVLPLAATEQHGPHLPLGTDVMIARAYLARVHELLPAELPVS 68

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
            +P++PIG S EH+   GT TL    A+  W  I D++ + G+RK+V++ +HGGNS  +S
Sbjct: 69  FLPLQPIGLSTEHLAFPGTLTLGTETALRLWTEIGDSVARAGVRKLVMVTSHGGNSAAMS 128

Query: 126 IVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
           +V+ E R R +ML V+T W+RF +P G+ +  E   GIHGG +ETS+MLA AP  V+ D 
Sbjct: 129 LVAQELRARHAMLAVTTGWARFGLPDGLFADDELRHGIHGGAVETSIMLAHAPQQVRTDR 188

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
             +F    +     F++L A     F W+ +DL+P G +G+A  A+  KG   L + A  
Sbjct: 189 IADFRPATAAMEHEFRWLSAQRPAPFAWAAQDLHPSGAIGDATAASADKGRKALDHGARA 248

Query: 246 FIQLLNDINSFDVSIF 261
           F +LL D++ FD++  
Sbjct: 249 FCELLADVDRFDLATL 264


>gi|75674528|ref|YP_316949.1| creatininase [Nitrobacter winogradskyi Nb-255]
 gi|74419398|gb|ABA03597.1| creatininase [Nitrobacter winogradskyi Nb-255]
          Length = 272

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 102/244 (41%), Positives = 150/244 (61%)

Query: 14  LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG 73
           +  +A  +WI VLPL A EQHGPHLP+ TD +IA     +++  LP  +P T +PV+PIG
Sbjct: 17  VAPEAAANWIAVLPLAATEQHGPHLPLTTDVLIAEAYLAKVREWLPQEIPATFLPVQPIG 76

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
            S EHM   GT+TL+   A+  W A+ +   + GIRKIV++++HGGNS  +S+V+ + R 
Sbjct: 77  ISTEHMDFPGTRTLSNEAALRAWTALGEEAARRGIRKIVMVSSHGGNSAAMSMVAQDLRA 136

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           R  ML V+T+W+RF +P G+    E   G+HGG +ETS+MLA  P  V+ D   +FS   
Sbjct: 137 RHRMLAVTTAWARFGVPDGLFDAQELRHGVHGGAVETSIMLARYPDRVRSDRIADFSPAS 196

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
               + +++L       F W  +DL+P G  G+A  A+ +KGE LL++ A  F +LL D+
Sbjct: 197 IAIEKTYRWLGTQRPAPFAWQAQDLHPSGAAGDATQASAEKGERLLAHGARAFCELLADV 256

Query: 254 NSFD 257
             FD
Sbjct: 257 ARFD 260


>gi|92116046|ref|YP_575775.1| creatininase [Nitrobacter hamburgensis X14]
 gi|91798940|gb|ABE61315.1| Creatininase [Nitrobacter hamburgensis X14]
          Length = 272

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 103/241 (42%), Positives = 149/241 (61%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           +WI VLPL A EQHGPHLP+ TD +IA     R++ +LP  +P   +PV+PIG S EH  
Sbjct: 24  NWIAVLPLAATEQHGPHLPLTTDVLIAEAYLARVRELLPQDIPANFLPVQPIGISTEHTD 83

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT+TLT   A++ W A+ + + + GIRKIV++++HGGNS  +++V+ + R R  ML V
Sbjct: 84  FPGTQTLTNEAALKAWTALGEDVARTGIRKIVMVSSHGGNSAAMTMVAQDLRARHRMLAV 143

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           +T+WSRF +P G+    E   GIHGG IETS+MLA  P  V+ D   +F        + +
Sbjct: 144 TTAWSRFGVPDGLFDAQELRHGIHGGAIETSIMLARYPEQVRRDSIADFHPASIAIEKIY 203

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
           ++L       F W  +DL+P G VG+A  A+ +KGE LL + A  F +LL D+  FD ++
Sbjct: 204 RWLGTQRPAPFAWQTQDLHPSGAVGDATQASAEKGERLLEHGARAFCELLADMARFDPAV 263

Query: 261 F 261
            
Sbjct: 264 L 264


>gi|192288903|ref|YP_001989508.1| Creatininase [Rhodopseudomonas palustris TIE-1]
 gi|192282652|gb|ACE99032.1| Creatininase [Rhodopseudomonas palustris TIE-1]
          Length = 270

 Score =  218 bits (556), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 104/238 (43%), Positives = 149/238 (62%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           WI VLPL A EQHGPHLP++TD  IA     R++  LP  +P T +PV+ IG S EH+  
Sbjct: 25  WIAVLPLAAIEQHGPHLPLSTDVTIAEAYLARVRERLPADIPATFLPVQAIGLSTEHLSF 84

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT TL+   A++ W  I D+I + G+RK+V++ +HGGNS  + +V+ E R R  MLVV+
Sbjct: 85  PGTLTLSTETALKLWTEIGDSIARAGVRKLVMVTSHGGNSAAMGLVAQELRARHQMLVVT 144

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           T W+RF +P G+ +  E   GIHGG  ETS+MLA AP LV+ D   +F        + ++
Sbjct: 145 TGWARFGMPDGLFAADELRHGIHGGATETSIMLAHAPELVRADRIADFRPTSVAMEQTYR 204

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           +L A     F W+ +DL+P G +G+A  AT +KG  LL + A  F +LL D++ FD++
Sbjct: 205 WLSAQRPAPFAWAAEDLHPSGAIGDASAATAEKGWRLLDHGAGAFCELLADMHRFDLA 262


>gi|39933548|ref|NP_945824.1| creatininase [Rhodopseudomonas palustris CGA009]
 gi|39647394|emb|CAE25915.1| putative creatine amidohydrolase [Rhodopseudomonas palustris
           CGA009]
          Length = 270

 Score =  216 bits (549), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 103/240 (42%), Positives = 148/240 (61%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           WI VLPL A EQHGPHLP++TD  IA     R++  L   +P T +PV+ IG S EH+  
Sbjct: 25  WIAVLPLAAIEQHGPHLPLSTDVTIAEAYLARVRERLRDDIPATFLPVQAIGLSTEHLSF 84

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT TL+   A++ W  I D+I + G+RK+V++ +HGGNS  + +V+ E R R  MLVV+
Sbjct: 85  PGTLTLSTETALKLWTEIGDSIARAGVRKLVMVTSHGGNSAAMGLVAQELRARHQMLVVT 144

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           T W+RF +P G+ +  E   GIHGG  ETS+MLA AP LV+ D   +F        + ++
Sbjct: 145 TGWARFGMPDGLFAADELRHGIHGGATETSIMLAHAPELVRADRIADFRPTSVAMEQTYR 204

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           +L A     F W+ +DL+P G +G+A  AT +KG  LL + A  F +LL D++ FD++  
Sbjct: 205 WLSAQRPAPFAWAAEDLHPSGAIGDASAATAEKGRRLLDHGAGAFCELLADMHRFDLAAL 264


>gi|86747695|ref|YP_484191.1| creatininase [Rhodopseudomonas palustris HaA2]
 gi|86570723|gb|ABD05280.1| Creatininase [Rhodopseudomonas palustris HaA2]
          Length = 270

 Score =  214 bits (546), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 145/245 (59%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           WI VLPL A EQHGPHLP+ TD IIA     R+  +LP  LP T +P++P+G S EH+  
Sbjct: 25  WIAVLPLAATEQHGPHLPLGTDVIIAQAYLARVHELLPAELPATFLPLQPVGLSGEHLSF 84

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT TL+   A+  W  I D++ + G+RK+V++ +HGGNS  + +V+ + R R  ML V+
Sbjct: 85  PGTLTLSTETALRLWTEIGDSVARAGVRKLVMVTSHGGNSAAMGLVAQDLRTRHRMLAVT 144

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           T W+RF +P G+ +  E   GIHGG +ET++MLA AP  V+ D   +F        R F+
Sbjct: 145 TGWARFGLPDGLFAADELRHGIHGGAVETAIMLAHAPDQVRTDRIADFRPATLAMEREFR 204

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           +L A     F W+ +DL+  G +G+A  A+  KG   L + A  F +LL D++ FD+   
Sbjct: 205 FLSAQRPAPFAWAAQDLHRSGAIGDATAASADKGRQALDHGARAFCELLADVDRFDLEAL 264

Query: 262 DKDVQ 266
               Q
Sbjct: 265 GAAPQ 269


>gi|217977345|ref|YP_002361492.1| Creatininase [Methylocella silvestris BL2]
 gi|217502721|gb|ACK50130.1| Creatininase [Methylocella silvestris BL2]
          Length = 268

 Score =  214 bits (545), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 103/236 (43%), Positives = 144/236 (61%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP+  D  I  G  E++ + LPP LPV  +PV+ +G SIEH    
Sbjct: 24  IAVLPVAAIEQHGPHLPVGVDHFIMDGYIEQVAARLPPELPVLFLPVQSVGCSIEHADFP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           G  +L+ A AI  W  I +++R+ G RK+V+LN+HGGNS ++++++ + R R  ML V  
Sbjct: 84  GALSLSAATAIRAWTEIAESVRRAGCRKLVLLNSHGGNSAILNVIAHDLRARLGMLAVMA 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SWSRF  P G+ S  E   G+H G+IETS+ML+  P LV+M+ A +F          F +
Sbjct: 144 SWSRFGAPDGLFSENEKIHGVHAGDIETSLMLSFRPDLVRMEEAGDFVPESVAIENEFNW 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           LR      FGW  +DL+  G +G+A  AT +KGE    Y A  F++LL DI  FD+
Sbjct: 204 LRVGRPTGFGWMSQDLSETGAMGDAGGATARKGEACADYGATAFVELLQDIEGFDL 259


>gi|220924362|ref|YP_002499664.1| Creatininase [Methylobacterium nodulans ORS 2060]
 gi|219948969|gb|ACL59361.1| Creatininase [Methylobacterium nodulans ORS 2060]
          Length = 267

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 149/237 (62%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP+ TD IIA G   R+++++P  L V  +PV+ +G S EH+   
Sbjct: 23  IAVLPVAAVEQHGPHLPLGTDVIIAEGYLARMRALVPEDLEVLLLPVQAVGKSDEHLSFP 82

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+   A+  W+ I  A+ + G RK+VI+ +HGGNS L+ +V+ E R    ++ V+T
Sbjct: 83  GTLTLSGPTALAAWVEIGTAVHRAGCRKLVIVTSHGGNSALIDLVALELRRSCGLVAVTT 142

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           +WSRF  P G+    E   GIHGG +ET++MLAL P LV+ D   +F  R     R+F +
Sbjct: 143 AWSRFGYPPGLFPPEEVRHGIHGGAVETALMLALRPDLVRRDELRDFMPRSRAMERDFTH 202

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           LRA    +F W  +DLNP G +G+A  AT+  GE  L++ A  F++LL D++ F ++
Sbjct: 203 LRAGRPAAFAWLAEDLNPSGAIGDATLATLDAGEAALAHGARAFVELLRDVDRFSLT 259


>gi|163760221|ref|ZP_02167304.1| hypothetical protein HPDFL43_08164 [Hoeflea phototrophica DFL-43]
 gi|162282620|gb|EDQ32908.1| hypothetical protein HPDFL43_08164 [Hoeflea phototrophica DFL-43]
          Length = 264

 Score =  211 bits (538), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 147/233 (63%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP++TD+ I  G+ + + +  P  L +  +P++P+G S EH +  
Sbjct: 24  IAVLPIAAIEQHGPHLPVSTDSAIMQGMLDTVIAQTPADLDIRILPIQPVGKSNEHQHAP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT T+     IEHW+ +  +I + G+RK+VI+N+HGGN  ++ IV+ E R+R  MLV  T
Sbjct: 84  GTLTIPATTLIEHWVELGHSIARAGVRKLVIVNSHGGNEEIMGIVARELRVRARMLVAKT 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW RF  P+G+ S  E   GIHGG++ETS+ML   P LV M+ AE+F S  +     F+ 
Sbjct: 144 SWMRFGFPEGLYSARELAYGIHGGDVETSLMLHFRPDLVAMEKAEDFVSAVTRAETEFEL 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           LR  G+H+F W   DLNP G VG A  AT  KG+   ++ A  F++L+ D+ +
Sbjct: 204 LRHAGTHAFAWIASDLNPAGAVGEASKATPGKGQLTAAHQAEGFVKLMMDVRA 256


>gi|170747316|ref|YP_001753576.1| creatininase [Methylobacterium radiotolerans JCM 2831]
 gi|170653838|gb|ACB22893.1| Creatininase [Methylobacterium radiotolerans JCM 2831]
          Length = 262

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 106/247 (42%), Positives = 149/247 (60%), Gaps = 7/247 (2%)

Query: 18  ARKDW---IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           AR+D    I VLP+ A EQHGPHLP+ TDT+IA G   R++  +P  L V  +PV+P+G 
Sbjct: 15  ARRDMGRAIAVLPVAATEQHGPHLPLATDTLIAEGYLARVRDGVPADLDVLLLPVQPVGK 74

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           S EH    GT +L    A+  W  I  A+ + G RK+VI+ +HGGNS L+ +V+ E R R
Sbjct: 75  SDEHDAFPGTLSLETGTALAAWTGIGAAVHRAGCRKLVIVTSHGGNSALIDLVAGELRAR 134

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEI--GIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
           F M+ V+TSW+R   P G+  FP  EI  GIH G IET++MLAL P LV+ D   +F  R
Sbjct: 135 FGMVAVTTSWARLGYPDGL--FPADEIAHGIHAGGIETALMLALRPDLVRTDRVADFPPR 192

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
               +R+F +LRA    +F W   DL   G +G+A   T + G   L + A  F+ LL D
Sbjct: 193 TLSMIRDFTHLRAGRPAAFAWKAGDLQASGAMGDARLGTAEAGRAALDHGARAFVALLRD 252

Query: 253 INSFDVS 259
           +++F+++
Sbjct: 253 VDAFELA 259


>gi|222149606|ref|YP_002550563.1| creatinine amidohydrolase [Agrobacterium vitis S4]
 gi|221736588|gb|ACM37551.1| creatinine amidohydrolase [Agrobacterium vitis S4]
          Length = 266

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 108/237 (45%), Positives = 144/237 (60%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ + EQHGPHLP+ TD  IA G+   +K   P  L    +P + IG + EH+Y  
Sbjct: 24  IAVLPIASTEQHGPHLPIATDVAIANGMLAELKRQRPDDLNFLVLPTQEIGKANEHVYGP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L+    I  W AI   + + G+RK+VI+N+HGGN  ++SIV  E R+R  M VVST
Sbjct: 84  GTLSLSADLLIAAWTAIGAKVAEAGLRKLVIVNSHGGNVDIMSIVGRELRVRHKMAVVST 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            WSRF  P+G+IS  E   GIHGGE+ETS+ML   P LV+MD AENF S+         +
Sbjct: 144 QWSRFGNPEGMISEHENRYGIHGGEVETSLMLHFRPELVRMDKAENFVSKAEWMKERSDF 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           L+    HS  W   DLNP GVVG+A   T +KGE +  +  + FIQLL D+  + +S
Sbjct: 204 LQPLPPHSLAWIAHDLNPAGVVGDASKGTAEKGEAICRHQVSGFIQLLRDVRDYPLS 260


>gi|90422093|ref|YP_530463.1| creatininase [Rhodopseudomonas palustris BisB18]
 gi|90104107|gb|ABD86144.1| Creatininase [Rhodopseudomonas palustris BisB18]
          Length = 271

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 145/245 (59%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           WI VLPL A EQHGPHLP+ TD  IA     R++++LP  +P + +P++PIG S EH+  
Sbjct: 26  WIAVLPLAATEQHGPHLPLGTDVFIAEAYLSRVRALLPAAVPASFLPLQPIGISTEHIGF 85

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT TL    AI  W AI  ++ + G+RK+VI+ +HGGNS  +++V+ + R    ML V+
Sbjct: 86  PGTLTLPAELAIATWTAIGASVARAGLRKLVIVTSHGGNSAAMNLVAQQLRADHGMLAVT 145

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSWSRF  P G+    E   GIHGG +ETS+MLA  P  V+ D   +F     E  R F+
Sbjct: 146 TSWSRFGGPAGLFDDEELRHGIHGGAVETSIMLAHDPQQVRSDKIADFHPASLEIARRFQ 205

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
            L         W  +DLN  G +G+A  A+ + G  L+++ A  F +LL D++ FD++ F
Sbjct: 206 RLSTQRPAPLAWQAEDLNRSGAIGDATKASAEAGRQLIAHGARAFCELLEDVDRFDLTTF 265

Query: 262 DKDVQ 266
            +  Q
Sbjct: 266 GQTPQ 270


>gi|218514494|ref|ZP_03511334.1| putative creatininase protein [Rhizobium etli 8C-3]
          Length = 229

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 98/154 (63%), Positives = 123/154 (79%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           VLPLGA+EQHGPHLP  TDT+IA G+A R+K+ LP  LPVT +P E +GYSIEHM V+GT
Sbjct: 22  VLPLGAHEQHGPHLPFETDTLIAEGIAGRLKTALPAGLPVTFLPAESVGYSIEHMDVEGT 81

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSW 144
           KTL + EA+  WL I + + +  IRK V+LNAHGGNSPL++IV+TEAR+RF+ML V+TSW
Sbjct: 82  KTLAFDEAVNRWLGIAERLAEQKIRKFVMLNAHGGNSPLMTIVATEARIRFAMLAVATSW 141

Query: 145 SRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           +RF +P G+I   E  IGIHGG+IETS+MLAL P
Sbjct: 142 TRFGLPDGVIRPQEKAIGIHGGDIETSVMLALHP 175


>gi|240138723|ref|YP_002963195.1| creatininase (creatine amidohydrolase) [Methylobacterium extorquens
           AM1]
 gi|240008692|gb|ACS39918.1| creatininase (creatine amidohydrolase) [Methylobacterium extorquens
           AM1]
          Length = 258

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 103/236 (43%), Positives = 145/236 (61%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP+ TDT+IA G   R+   +P  L V  +PV+ +G S EH    
Sbjct: 23  IAVLPVAAVEQHGPHLPLGTDTLIAEGYLARVAPQVPEALDVLLLPVQSVGKSDEHDSFP 82

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TLT   A+  W  I  ++ + G  K+VI+++HGGNS L+ +V+ E R RF M+ V+T
Sbjct: 83  GTLTLTAPTALAAWTEIGASLHRAGCTKLVIVSSHGGNSALIDLVAGELRGRFGMVAVTT 142

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SWSR  +P+G+    E   GIH G IET++MLAL P LV+ D  E+F  R     R+F  
Sbjct: 143 SWSRLGLPEGLFPAGEIRHGIHAGGIETALMLALRPDLVRRDHIEDFEPRTVAMERDFAL 202

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           LRA    +F W  +DL+P G +G+A   T + GE  L+Y A  F++LL +++ F +
Sbjct: 203 LRAGRPAAFAWKTEDLHPSGALGDARLGTAEAGEAALAYGAQAFVRLLEEVDRFSL 258


>gi|218530365|ref|YP_002421181.1| creatininase [Methylobacterium chloromethanicum CM4]
 gi|218522668|gb|ACK83253.1| Creatininase [Methylobacterium chloromethanicum CM4]
          Length = 258

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 103/236 (43%), Positives = 146/236 (61%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP+ TDT+IA G   R+   +P  L V  +PV+ +G S EH    
Sbjct: 23  IAVLPVAAVEQHGPHLPLGTDTLIAEGYLARVAPQVPEALDVLLLPVQTVGKSDEHDSFP 82

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TLT   A+  W  I  ++ + G  K+VI+++HGGNS L+ +V+ E R RF M+ V+T
Sbjct: 83  GTLTLTAPTALAAWTEIGASLHRAGCTKLVIVSSHGGNSALIDLVAGELRGRFGMVAVTT 142

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SWSR  +P+G+    E   GIH G IET++MLAL P LV+ D  E+F  R     R+F  
Sbjct: 143 SWSRLGLPEGLFPAGEIRHGIHAGGIETALMLALRPDLVRRDHIEDFEPRTVAMERDFAL 202

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           LRA    +F W  +DL+P G +G+A   T + GE  L+Y A+ F++LL +++ F +
Sbjct: 203 LRAGRPAAFAWKTEDLHPSGALGDARLGTAEAGEAALAYGAHAFVRLLEEVDRFSL 258


>gi|260459614|ref|ZP_05807868.1| Creatininase [Mesorhizobium opportunistum WSM2075]
 gi|259034416|gb|EEW35673.1| Creatininase [Mesorhizobium opportunistum WSM2075]
          Length = 267

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 145/232 (62%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP++TDT I  G+ + + S LP  L +  +PV+ +G S EH++  
Sbjct: 27  IAVLPVAAIEQHGPHLPVSTDTSIMNGMLDTVISRLPDDLDIRILPVQAVGKSNEHLHAP 86

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL     +E W  +  +I + G+RK++++N+HGGN  ++ I++ E R+R  ML V T
Sbjct: 87  GTLTLPATTLVEAWTELGLSIARAGVRKLIVVNSHGGNEEIMGIITRELRVREKMLAVKT 146

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW RF  P G+ +  E   GIHGG++ETS+ML   P LV M  A+NF S  ++  + F  
Sbjct: 147 SWQRFGRPAGMYTELEDRHGIHGGDVETSLMLHFRPDLVDMGKADNFVSNVAKAEQEFSL 206

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           LR  G+H+F W   DLNP GVVG+A  AT +KG     Y A+ FI LL D+ 
Sbjct: 207 LRHTGTHAFAWIASDLNPNGVVGDASIATAEKGRLTAEYQADGFISLLKDVR 258


>gi|298292804|ref|YP_003694743.1| creatininase [Starkeya novella DSM 506]
 gi|296929315|gb|ADH90124.1| Creatininase [Starkeya novella DSM 506]
          Length = 272

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 104/260 (40%), Positives = 151/260 (58%), Gaps = 1/260 (0%)

Query: 1   MNPLIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   +T+ + P  A+   ++WI VLP+ A EQHGPHLP+  DT I  G  + +   LP
Sbjct: 1   MPPKRFWTELTWPDFANGDPENWIAVLPVAAVEQHGPHLPVGVDTFIGEGYLKEVMQRLP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             +P   +P++ IG S EH++  GT TL+    I  W  I +++ + G+RK+VI+N+HGG
Sbjct: 61  NDIPAVFLPLQAIGKSNEHIHFPGTLTLSAETVIRAWTEIGESVHRAGVRKLVIVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N P++ IV+ + R R  ML V+ SW RF  P+G+ S  E + GIH G +ETS+M A  P 
Sbjct: 121 NVPILDIVTRDLRARLGMLAVTISWHRFGYPEGLFSAQERQHGIHAGGVETSLMQAFRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            VK     +F        + F YLRA     FGW  +D+ P G +G+A +A+ +KGE   
Sbjct: 181 TVKQGEIRDFPPVTLAMEQEFDYLRAGSPAGFGWMAQDIQPAGAMGDATEASKEKGEACA 240

Query: 240 SYFANCFIQLLNDINSFDVS 259
            Y A  FI LL D++ F +S
Sbjct: 241 LYGARAFIALLADVHRFGLS 260


>gi|13471353|ref|NP_102919.1| hypothetical protein mlr1298 [Mesorhizobium loti MAFF303099]
 gi|14022095|dbj|BAB48705.1| mlr1298 [Mesorhizobium loti MAFF303099]
          Length = 267

 Score =  208 bits (529), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 144/232 (62%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP++TDT I  G+ + + S LP  L +  +PV+ +G S EH++  
Sbjct: 27  IAVLPVAAIEQHGPHLPVSTDTSIMNGMLDTVISRLPDDLDIRILPVQAVGKSNEHLHAP 86

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL     +E W  +  +I + G+RK++++N+HGGN  ++ I++ E R+R  ML V T
Sbjct: 87  GTLTLPATTLVEAWTELGVSIARAGVRKLIVVNSHGGNEEIMGIITRELRVREKMLAVKT 146

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW RF  P G+ S  E   GIHGG++ETS+ML   P LV M  A+NF S  +   + F  
Sbjct: 147 SWQRFGRPAGMYSELEDRHGIHGGDVETSLMLHFRPDLVDMAKADNFVSNVTRAEKEFSL 206

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           LR  G+H+F W   DLNP GVVG+A  AT +KG     + A+ FI LL D+ 
Sbjct: 207 LRHTGTHAFAWIASDLNPNGVVGDASIATAEKGRLTAEHQADGFISLLRDVR 258


>gi|241113022|ref|YP_002972857.1| Creatininase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240861230|gb|ACS58896.1| Creatininase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 288

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 150/237 (63%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ + EQHGPHLP+ TD  IA G+   +K      L +  +P + IG + EH+Y  
Sbjct: 47  IAVLPIASTEQHGPHLPIATDVAIATGMLAELKRQRSEDLDILVLPTQEIGKANEHIYGP 106

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L+    I  W AI   + + G+RK+VI+N+HGGN  ++SIV+ E R+R  M VVST
Sbjct: 107 GTLSLSAELLIPVWTAIGAKVAEAGLRKMVIVNSHGGNVDIMSIVARELRVRQQMAVVST 166

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W RF  P+G++S  E++ GIHGG++ETS+ML   P LV+MD A+NF+S+     +  K+
Sbjct: 167 QWGRFGHPEGMVSDHESKYGIHGGDVETSLMLHFRPELVRMDKAQNFASKAEGMRQQSKF 226

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           L+    HS  W   DLNP GVVG+A  AT +KGE +  +    F++LL D+ ++ +S
Sbjct: 227 LQPLPPHSLAWIAHDLNPLGVVGDASIATAEKGEAICRHQVKGFVELLRDLKAYPLS 283


>gi|163851556|ref|YP_001639599.1| creatininase [Methylobacterium extorquens PA1]
 gi|163663161|gb|ABY30528.1| Creatininase [Methylobacterium extorquens PA1]
          Length = 258

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 145/236 (61%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP+ TDT+IA G   R+   +P  L V  +PV+ +G S EH    
Sbjct: 23  IAVLPVAAVEQHGPHLPLGTDTLIAEGYLARVAPQVPEALDVLLLPVQSVGKSDEHDSFP 82

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TLT   A+  W  I  ++ + G  K+VI+++HGGNS L+ +V+ E R RF M+ V+T
Sbjct: 83  GTLTLTAPTALAAWTEIGASLHRAGCTKLVIVSSHGGNSALIDLVAGELRGRFGMVAVTT 142

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SWSR  +P+G+    E   GIH G IET++MLAL P LV+    E+F  R     R+F  
Sbjct: 143 SWSRLGLPEGLFPAGEIRHGIHAGGIETALMLALRPDLVRQAHIEDFEPRTVAMERDFAL 202

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           LRA    +F W  +DL+P G +G+A   T + GE  L+Y A+ F++LL +++ F +
Sbjct: 203 LRAGRPAAFAWKTEDLHPSGALGDARLGTAEAGEAALAYGAHAFVRLLEEVDRFSL 258


>gi|319783017|ref|YP_004142493.1| creatininase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168905|gb|ADV12443.1| Creatininase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 267

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 145/232 (62%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP++TDT I  G+ + + S LP  L +  +PV+ +G S EH++  
Sbjct: 27  IAVLPVAAIEQHGPHLPVSTDTSIMNGMLDTVISRLPDDLDIRILPVQAVGKSNEHLHAP 86

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL     IE W  +  +I + G+RK++++N+HGGN  ++ IV+ E R+R  ML V T
Sbjct: 87  GTLTLPATTLIEAWTELGLSIARAGVRKLIVVNSHGGNEEIMGIVTRELRVREKMLAVKT 146

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW RF  P G+ +  E   GIHGG++ETS+ML   P LV M  +++F S  ++  + F  
Sbjct: 147 SWQRFGRPAGMYTELEDRHGIHGGDVETSLMLHFRPDLVDMGKSDSFVSNVAKAEKEFSL 206

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           LR  G+H+F W   DLNP GVVG+A  AT +KG     Y A+ FI LL D+ 
Sbjct: 207 LRHTGTHAFAWIASDLNPNGVVGDASIATAEKGRLTAEYQADGFISLLQDVR 258


>gi|222086849|ref|YP_002545383.1| creatininase (creatinine amidohydrolase) protein [Agrobacterium
           radiobacter K84]
 gi|221724297|gb|ACM27453.1| creatininase (creatinine amidohydrolase) protein [Agrobacterium
           radiobacter K84]
          Length = 265

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 145/237 (61%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP+ + EQHGPHLP+ TD  IA G+   +K   P  L    +P + IG + EH+Y  
Sbjct: 24  IAILPIASTEQHGPHLPIATDVAIATGMLAELKVQRPNDLDFLVLPTQEIGKANEHVYGP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L+    I  W AI   + + GIRK+VI+N+HGGN  ++ IV+ E R+R+ M VV+T
Sbjct: 84  GTLSLSAELLIPVWTAIGAKVAEAGIRKMVIVNSHGGNLDIMGIVARELRVRYQMAVVAT 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W RF  P G+IS  E   GIHGG++ETS+ML   P LV+MD AENF+S+         Y
Sbjct: 144 QWMRFGTPDGMISEHEQCYGIHGGDVETSLMLHFRPELVRMDKAENFASKAEWMKERSNY 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           L+    HS  W   DLNP GVVGNA + T +KG  + S+  N FI++L D+  + +S
Sbjct: 204 LQPLPPHSLAWIAHDLNPNGVVGNAANGTAEKGALICSHQINGFIEMLRDLRDYPLS 260


>gi|116248972|ref|YP_764813.1| putative creatinine amidohydrolase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115253622|emb|CAK12015.1| putative creatinine amidohydrolase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 272

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 101/237 (42%), Positives = 149/237 (62%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP+ + EQHGPHLP+ TD  IA G+   +K   P  L +  +P + IG + EH+Y  
Sbjct: 31  IAILPIASTEQHGPHLPIATDVAIATGMLAELKRQRPEDLDMLVLPTQEIGKANEHIYGP 90

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L     I  W AI   + + G+RK+VI+N+HGGN  ++SIV+ E R+ + M VVST
Sbjct: 91  GTLSLGAELLIPVWTAIGAKVAEAGLRKMVIVNSHGGNVDIMSIVARELRVHYQMAVVST 150

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W RF  P+G++S  E++ GIHGG++ETS+ML   P LV+MD A+NF+S+        ++
Sbjct: 151 QWGRFGHPEGMVSDHESKYGIHGGDVETSLMLHFRPELVRMDKAQNFASKAERMREQSRF 210

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           L+    HS  W   DLNP GVVG+A  AT +KGE +  +    F++LL D+ ++ +S
Sbjct: 211 LQPLPPHSLAWIAHDLNPFGVVGDASIATAEKGEAICRHQVKGFVELLRDLKAYPLS 267


>gi|209549277|ref|YP_002281194.1| creatininase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535033|gb|ACI54968.1| Creatininase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 265

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 147/237 (62%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP+ + EQHGPHLP+ TD  IA G+   ++   P  L    +P + IG + EH+Y  
Sbjct: 24  IAILPIASTEQHGPHLPIATDVAIANGMLAELRQQKPDDLDFLVLPTQEIGKANEHIYGP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L     I  W AI   + + G+RK+V++N+HGGN  ++SIV+ E R+R+ M VVST
Sbjct: 84  GTLSLGAELLIPVWTAIGAKVAEAGLRKMVVVNSHGGNVDIMSIVARELRVRYQMAVVST 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W RF  P+G+IS  E + GIHGGE+ETS+ML   P LV+MD A+NF+S+        +Y
Sbjct: 144 QWGRFGHPEGMISEDELKYGIHGGEVETSLMLHFRPDLVRMDKAQNFTSKAEWMRGQSRY 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           ++    HS  W   DLNP GVVG+A   T  KGE +  +  + FI+LL+D+  + +S
Sbjct: 204 IQPLPPHSLAWIAHDLNPAGVVGDASRGTAAKGEAICRHQVSGFIELLSDLKRYPLS 260


>gi|327188276|gb|EGE55496.1| putative creatininase protein [Rhizobium etli CNPAF512]
          Length = 265

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 104/237 (43%), Positives = 145/237 (61%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP+ + EQHGPHLP+ TD  IA G+   ++   P  L    +P + IG + EH+Y  
Sbjct: 24  IAILPIASTEQHGPHLPIATDVAIANGMLAELRKQKPADLDFLVLPTQEIGKANEHVYGP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L+    I  W AI   + + GIRK+VI+N+HGGN  ++SIV+ E R+   M VVST
Sbjct: 84  GTLSLSAELLIPVWTAIGAKVAEAGIRKMVIVNSHGGNVDIMSIVARELRVLHQMAVVST 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W RF  P+G+I   E + GIHGGE+ETS+ML   P LV+MD AENF+S+        KY
Sbjct: 144 QWGRFGHPEGMIGEHELKYGIHGGEVETSLMLHFRPDLVRMDKAENFTSKAEWMRGQSKY 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           ++    HS  W   DLNP GVVG+A   T +KGE +  +    FI+LL+D+  + +S
Sbjct: 204 IQPLPPHSLAWIAHDLNPNGVVGDASRGTAEKGEAICRHQVTGFIELLHDLKRYPLS 260


>gi|154246579|ref|YP_001417537.1| creatininase [Xanthobacter autotrophicus Py2]
 gi|154160664|gb|ABS67880.1| Creatininase [Xanthobacter autotrophicus Py2]
          Length = 285

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 144/243 (59%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+ A EQHGPHLP+ TD  IA G  ERI   +P  L    +PV+ +G S EH+   
Sbjct: 43  VAVLPVAAVEQHGPHLPLGTDLFIAEGYIERIAFQVPRDLDAVFLPVQAVGKSDEHITFA 102

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+ A A+  W+ + D + + G+R++V++N HGGN P++ +V+   R++  ML V+ 
Sbjct: 103 GTLTLSPATALATWVELGDCLARAGVRRLVLMNTHGGNVPVIDLVARTLRVKHRMLAVTC 162

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           S  RF  P G+ +  E   GIHGGEIETS+MLA  P LV +  A +FS         F  
Sbjct: 163 SMHRFGYPVGLFTDHERAHGIHGGEIETSLMLAFRPELVDLTHAGDFSPYSVAMESEFAR 222

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFD 262
           LRA+    FGW  +DL+  G +G+A  AT  KGE    + A  FI+LL D+ +FD+  FD
Sbjct: 223 LRANHPVGFGWLAEDLSADGAMGDARGATALKGEAATEFGARAFIELLRDVANFDLERFD 282

Query: 263 KDV 265
             V
Sbjct: 283 HHV 285


>gi|218516320|ref|ZP_03513160.1| probable creatininase protein [Rhizobium etli 8C-3]
          Length = 265

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 150/252 (59%), Gaps = 3/252 (1%)

Query: 8   TDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           TD+   L  D     I +LP+ + EQHGPHLP+ TD  IA G+   ++   P  L    +
Sbjct: 12  TDDFAGLSPDTT---IAILPIASTEQHGPHLPIATDVAIANGMLAELRKQKPADLDFLVL 68

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P + IG + EH+Y  GT +L+    I  W AI   + + GIRK+VI+N+HGGN  ++SIV
Sbjct: 69  PTQEIGKANEHVYGPGTLSLSAELLIPVWTAIGAKVAEAGIRKMVIVNSHGGNVDIMSIV 128

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
           + E R+   M VVST W RF  P+G+I   E + GIHGGE+ETS+ML   P LV+MD AE
Sbjct: 129 ARELRVLHQMAVVSTQWGRFGHPEGMIGEHELKYGIHGGEVETSLMLHFRPDLVRMDKAE 188

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
           NF+S+        KY++    HS  W   DLNP GVVG+A   T +KGE +  +    FI
Sbjct: 189 NFTSKAEWMRGQSKYIQPLPPHSLAWIAHDLNPNGVVGDASLGTAEKGEAICRHQVTGFI 248

Query: 248 QLLNDINSFDVS 259
           +LL+D+  + +S
Sbjct: 249 ELLHDLKRYPLS 260


>gi|86357667|ref|YP_469559.1| creatininase (creatinine amidohydrolase) protein [Rhizobium etli
           CFN 42]
 gi|86281769|gb|ABC90832.1| probable creatininase (creatinine amidohydrolase) protein
           [Rhizobium etli CFN 42]
          Length = 265

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 145/237 (61%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP+ + EQHGPHLP+ TD  IA G+   ++   P  L    +P + IG + EH+Y  
Sbjct: 24  IAILPIASTEQHGPHLPIATDVAIAEGMLAELRKQKPVDLDCLVLPTQEIGKANEHIYGP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L     I  W AI   + + GIRK+VI+N+HGGN  ++SIV+ E R+R++M V+ST
Sbjct: 84  GTLSLGAELLIPVWTAIGAKVAEAGIRKMVIINSHGGNVDIMSIVARELRVRYAMAVIST 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W RF  P G+IS  E + GIHGGE+ETS+ML   P LV+M+ A+NF S+ +       Y
Sbjct: 144 QWGRFGHPGGMISEHELKYGIHGGEVETSLMLHFRPDLVRMEKAQNFKSKAAWMREQSNY 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           ++    HS  W   DLNP GVVG+A   T +KGE +  +    FI+LL D+  + +S
Sbjct: 204 IQPLPPHSLAWIAHDLNPNGVVGDASRGTAEKGEAICRHQVKGFIELLCDLKRYPLS 260


>gi|190894439|ref|YP_001984732.1| putative creatininase [Rhizobium etli CIAT 652]
 gi|190700100|gb|ACE94182.1| probable creatininase protein [Rhizobium etli CIAT 652]
          Length = 265

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 104/237 (43%), Positives = 145/237 (61%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP+ + EQHGPHLP+ TD  IA G+   ++   P  L    +P + IG + EH+Y  
Sbjct: 24  IAILPIASTEQHGPHLPIATDVAIANGMLAELRKQKPADLDFLVLPTQEIGKANEHVYGP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L+    I  W AI   + + GIRK+VI+N+HGGN  ++SIV+ E R+   M VVST
Sbjct: 84  GTLSLSAELLIPVWTAIGAKVAEAGIRKMVIVNSHGGNVDIMSIVARELRVLHQMAVVST 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W RF  P+G+I   E + GIHGGE+ETS+ML   P LV+MD AENF+S+        KY
Sbjct: 144 QWGRFGHPEGMIGEHELKYGIHGGEVETSLMLHFRPDLVRMDKAENFTSKAEWMRGQSKY 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           ++    HS  W   DLNP GVVG+A   T +KGE +  +    FI+LL+D+  + +S
Sbjct: 204 IQPLPPHSLAWIAHDLNPNGVVGDASLGTAEKGEAICRHQVTGFIELLHDLKRYPLS 260


>gi|330992831|ref|ZP_08316774.1| creatinine amidohydrolase family protein [Gluconacetobacter sp.
           SXCC-1]
 gi|329759985|gb|EGG76486.1| creatinine amidohydrolase family protein [Gluconacetobacter sp.
           SXCC-1]
          Length = 273

 Score =  201 bits (512), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 144/234 (61%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+GA EQHGPHLP+  D+ I AGL ER     P  LP+T +P++ +G S EH+   
Sbjct: 26  VAVLPVGAIEQHGPHLPVCVDSCINAGLLERALERAPADLPITALPIQSVGKSDEHIAYP 85

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+    +   L +  ++ + G+R++V+LN+HGG   ++ IV+ E R   ++ VV  
Sbjct: 86  GTLTLSANTLLNVLLDLGASVARAGVRRLVLLNSHGGQPQILDIVARELRRTHNLFVVCV 145

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           +W RF  P+G+ S  E + GIHGG++ETS+M  L P LV+MD AENF S   E  R +K+
Sbjct: 146 AWGRFGCPEGLFSTTELKYGIHGGDVETSLMCYLRPDLVQMDRAENFVSWPEEMAREYKW 205

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           L+A G   FGW   DL+P G  G+A  AT +KG  +   +   F++L+ ++  +
Sbjct: 206 LQAEGRVGFGWHAHDLHPAGACGDASGATAEKGRLVADQYIAGFLELMAEVARY 259


>gi|27375203|ref|NP_766732.1| hypothetical protein blr0092 [Bradyrhizobium japonicum USDA 110]
 gi|27348339|dbj|BAC45357.1| blr0092 [Bradyrhizobium japonicum USDA 110]
          Length = 268

 Score =  201 bits (511), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 142/242 (58%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           WI VLPL A EQHGPHLP+ TD +IA     R++ +LP  +P + +PVEP+G S EH+  
Sbjct: 23  WIAVLPLAATEQHGPHLPLATDVLIADAYLARVRELLPATIPASFLPVEPVGISTEHIDY 82

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT+TL    A++ W AI + + + G++K+VI+ +HGGNS  + +V+ + R    + VV+
Sbjct: 83  PGTQTLPTDVALKRWTAIGEEVARRGVKKLVIITSHGGNSAAMMLVAQDLRAHHKLFVVT 142

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSWSR +    +    E   GIHGG IETS+MLA  P  V+ D   +F +        ++
Sbjct: 143 TSWSRLSGADKLFPAEEVRHGIHGGAIETSIMLARYPDQVRKDAIADFPASSVAMETQYR 202

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           +L       F W  +DLN  G +GNA  A  +KG  LL   A  F +LL ++++FDV+  
Sbjct: 203 WLSTQRPAPFAWQAQDLNASGAIGNATLAVPEKGAQLLDQGARAFCELLTEVDNFDVNRL 262

Query: 262 DK 263
            K
Sbjct: 263 AK 264


>gi|218672053|ref|ZP_03521722.1| probable creatininase protein [Rhizobium etli GR56]
          Length = 265

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/237 (42%), Positives = 144/237 (60%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP+ + EQHGPHLP+ TD  IA G+   ++   P  L    +P + IG + EH++  
Sbjct: 24  IAILPIASTEQHGPHLPIATDVAIANGMLAELRKQKPEDLDFLVLPTQEIGKANEHIHGP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L+    I  W AI   + + GIRK+VI+N+HGGN  ++SIV+ E R+R  M V+ST
Sbjct: 84  GTLSLSAELLIPVWTAIGAKVAETGIRKMVIVNSHGGNVDIMSIVARELRVRCQMAVIST 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W RF  P+G+I   E + GIHGGE+ETS+ML   P LV+MD A+NF+S+     +  KY
Sbjct: 144 QWGRFGHPEGMIGEHEMKYGIHGGEVETSLMLHFRPDLVRMDKAQNFTSKAEWMRQQSKY 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           ++    HS  W   DLNP GVVG+A   T  KGE +  +    F+ LL D+  + +S
Sbjct: 204 IQPLPPHSLAWIAHDLNPNGVVGDASLGTAGKGEAICRHQVKGFVDLLYDLKRYPLS 260


>gi|209964752|ref|YP_002297667.1| Creatinine amidohydrolase, putative [Rhodospirillum centenum SW]
 gi|209958218|gb|ACI98854.1| Creatinine amidohydrolase, putative [Rhodospirillum centenum SW]
          Length = 272

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 137/234 (58%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP+ A EQHGPHLP+ TD +I  G+ ER  ++LPP LP   +P + +G+S EH    
Sbjct: 28  VAILPVAATEQHGPHLPLATDAVINRGILERALALLPPELPALALPAQGVGHSPEHGGFP 87

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL    A   W  + +     G+R++V+ N+HGGN PL+ +++ + R+R  +LVV  
Sbjct: 88  GTLTLRAETARAAWTELAEGAHAAGVRRLVLFNSHGGNPPLLDLMAVDLRVRRGLLVVPA 147

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW+RF  P G+    E E GIHGG +ETS+ML L P LV+ D   +F S         ++
Sbjct: 148 SWTRFGYPPGLFPPEELEFGIHGGAVETSLMLHLRPDLVRRDRIADFPSAARAVAAGNRF 207

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           LR+HG    GW   DLNP G VG+A  AT + G+ LL + A     L+ +++  
Sbjct: 208 LRSHGRIGTGWMTGDLNPAGAVGDARLATAEAGQALLEHAATALATLVGEVHRL 261


>gi|170742681|ref|YP_001771336.1| creatininase [Methylobacterium sp. 4-46]
 gi|168196955|gb|ACA18902.1| Creatininase [Methylobacterium sp. 4-46]
          Length = 267

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 148/239 (61%), Gaps = 4/239 (1%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP+ TD +I  G   R+   +P  L V  +PV+ IG S EH+   
Sbjct: 23  IAVLPVAAVEQHGPHLPLGTDAVIQEGYLARVAPQVPEDLDVLLLPVQAIGKSDEHLSFP 82

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL    A+  W+ I +A+ + G RK+VI+ +HGGNS L+ +V+ E R R  +L V+T
Sbjct: 83  GTLTLAGPTALAAWVEIGEAVHRAGCRKLVIVTSHGGNSALIDLVALELRRRCGLLAVTT 142

Query: 143 SWSRFTIPQGIISFPETEI--GIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           +WSRF  P G+  FPE EI  GIHGG +ET++MLAL P LV+ D   +F  R     R++
Sbjct: 143 AWSRFGYPPGL--FPEEEIRHGIHGGAVETALMLALRPDLVRRDRVRDFVPRSRAMERDY 200

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
             LRA    +F W  +DLNP+G +G+A  AT   GE  L++ A  F+ LL D++ F ++
Sbjct: 201 AQLRAGRPAAFAWLAEDLNPEGAIGDARLATAAAGEAALAHGARAFVALLGDVDRFSLA 259


>gi|255076517|ref|XP_002501933.1| predicted protein [Micromonas sp. RCC299]
 gi|226517197|gb|ACO63191.1| predicted protein [Micromonas sp. RCC299]
          Length = 352

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 99/238 (41%), Positives = 141/238 (59%), Gaps = 2/238 (0%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP+GA EQHGPHLP+  D  I AG+  R   +LPP +P+T +P  P G S+EH    
Sbjct: 69  IALLPVGATEQHGPHLPVCVDAAINAGVLNRAMELLPPEIPLTRLPPLPFGKSVEHDDFA 128

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L     +  W  I +++R+ G++K+V+ N+HGG   +  IV+ + R R  MLVV+ 
Sbjct: 129 GTISLGTNTLMAAWTDIGESVRRAGVKKLVLFNSHGGQPQVAEIVARDLRKRLGMLVVTV 188

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSS--RQSEFLRNF 200
            W  F +P+G+    E   G+HGG++ETS+ML L P LV M  A +F S  R  E   +F
Sbjct: 189 DWFSFGLPEGMFDDDELRHGLHGGDVETSVMLHLHPDLVDMSKAGDFRSAGRDMEESGDF 248

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           K L   G   FGW  +DLNP G  GNA  AT +KG   + + A+  + LL +++ FDV
Sbjct: 249 KLLTPEGGIGFGWLAQDLNPSGATGNASKATAEKGRACVEHAASRLVDLLKEVDDFDV 306


>gi|254561323|ref|YP_003068418.1| creatininase [Methylobacterium extorquens DM4]
 gi|254268601|emb|CAX24560.1| creatininase (creatine amidohydrolase) [Methylobacterium extorquens
           DM4]
          Length = 258

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 145/236 (61%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP+ TDT+IA G   R+   +P  L V  +PV+ +G S EH    
Sbjct: 23  IAVLPVAAVEQHGPHLPLGTDTLIAEGYLARVAPQVPEALDVLLLPVQSVGKSDEHDSFP 82

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TLT   A+  W  I  ++ + G  K+VI+++HGGNS L+ +V+ E R R  M+ V+T
Sbjct: 83  GTLTLTATTALAAWTEIGASLHRAGCTKLVIVSSHGGNSALIDLVAGELRGRLGMVAVTT 142

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SWSR  +P+G+    E   GIH G IET++MLAL P LV+ D  E+F  R     R+F  
Sbjct: 143 SWSRLGLPEGLFPAGEIRHGIHAGGIETALMLALRPDLVRRDHIEDFEPRTVAMERDFAL 202

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           LRA    +F W  +DL+P G +G+A   T + GE  L+Y A+ F++LL +++ F +
Sbjct: 203 LRAGRPAAFAWKTEDLHPSGALGDARLGTAEAGEAALAYGAHAFVRLLEEVDRFSL 258


>gi|310814586|ref|YP_003962550.1| Creatininase [Ketogulonicigenium vulgare Y25]
 gi|308753321|gb|ADO41250.1| Creatininase [Ketogulonicigenium vulgare Y25]
          Length = 263

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 96/231 (41%), Positives = 139/231 (60%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP+ A EQHGPHLP+ TD II  G  E +    P  L +  +PV+P+G S EH++  
Sbjct: 24  IAILPIAAVEQHGPHLPVGTDVIINTGHLEMLAKAAPADLDIRILPVQPVGKSNEHIWAK 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +      I+ W+ I   + + GIRK+VI+N+HGGN  ++ IV  E R+R  + VV T
Sbjct: 84  GTVSHEAKTLIDSWVEIGLHVARTGIRKLVIVNSHGGNEEIMGIVGRELRVRCGLFVVKT 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SWSRF  P G+IS  E   GIHGGE+ET+++L   P LV M  A NF+S  +    ++ Y
Sbjct: 144 SWSRFGAPAGLISDTEARQGIHGGEVETALVLHFRPELVDMAKAGNFTSVAAAEEVDYTY 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
           LR  G+H++ W   D++P G +GNA   T +KG  +     + F+ LL ++
Sbjct: 204 LRPTGTHAWSWIASDVHPSGAIGNATLGTAEKGAAIAQNHVDRFLDLLAEV 254


>gi|296446248|ref|ZP_06888195.1| Creatininase [Methylosinus trichosporium OB3b]
 gi|296256285|gb|EFH03365.1| Creatininase [Methylosinus trichosporium OB3b]
          Length = 264

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 146/243 (60%), Gaps = 4/243 (1%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R   I VLPL A EQHGPHLP+  D+ I  G+ ER+   LP  L V  +P + IG SIEH
Sbjct: 20  RSRVIAVLPLAAVEQHGPHLPVGVDSAIMQGMIERVVERLPEDLDVLFLPQQAIGVSIEH 79

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT TL++  A+     I + + + G RK+V+LN+HGGN+PL+S  + E R R  ML
Sbjct: 80  GDFPGTLTLSHETALRLVTEIGEGVARAGCRKLVLLNSHGGNTPLLSQAALELRARRGML 139

Query: 139 VVSTSWSRFTIPQGIISFPETEI--GIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
            V+ SW RF  P G+  FPE EI  G+HGGEIETS+MLALAP  V    A  F S    F
Sbjct: 140 AVACSWHRFGYPDGL--FPEDEIRLGVHGGEIETSLMLALAPDFVDTARAARFGSESEAF 197

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
            R F +LRA     FGW  +DL+  G +G+A  A+  KGE    Y+A  F++LL D+ +F
Sbjct: 198 EREFTWLRADKPIGFGWMTQDLSRDGALGDAAAASAAKGEAAADYWATAFVELLRDVEAF 257

Query: 257 DVS 259
           D+ 
Sbjct: 258 DLE 260


>gi|303276611|ref|XP_003057599.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226460256|gb|EEH57550.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 301

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/243 (39%), Positives = 143/243 (58%), Gaps = 2/243 (0%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP+GA EQHGPHLP+  D  I AG+ +    +LP  +P+T +P  P G S+EH    
Sbjct: 15  IALLPVGAIEQHGPHLPVCVDAAINAGVLDVALRLLPSEIPLTVLPAFPYGKSVEHDDFA 74

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L+ +  I  W  I +++ + GI K+V+ N+HGG   ++ IV+ + R RF M VV  
Sbjct: 75  GTISLSASTLIAAWTDIGESVHRAGIEKLVLFNSHGGQPQVMDIVARDLRKRFGMFVVCV 134

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           +W  F +P+G+    E + G+H G++ETS+ML L P  V M  A +F S  ++  R+F Y
Sbjct: 135 NWFSFGVPEGLYDDEEIKHGLHAGDVETSVMLHLHPESVTMSRARDFPSAGADMERDFTY 194

Query: 203 LRAHGSH-SFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD-VSI 260
           L   G    FGW  +DLN  G  GNA +AT  KGE  + + A   ++LL +++ FD   +
Sbjct: 195 LSPEGGGIGFGWLAQDLNHAGATGNASEATAVKGEATVEHAAERLVELLREVHDFDPACV 254

Query: 261 FDK 263
           F K
Sbjct: 255 FRK 257


>gi|188581345|ref|YP_001924790.1| creatininase [Methylobacterium populi BJ001]
 gi|179344843|gb|ACB80255.1| Creatininase [Methylobacterium populi BJ001]
          Length = 258

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 144/234 (61%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP+ TDT+IA G  ER+  ++P  L V  +PV+ +G S EH    
Sbjct: 23  IAVLPVAAVEQHGPHLPLGTDTLIAEGYLERVARLVPDGLDVLLLPVQAVGKSDEHDSFP 82

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TLT A A+  W  I  ++ + G  ++VI+++HGGNS L+ +V+ E R RF M+ V+T
Sbjct: 83  GTLTLTAATALAAWTEIGASLHRAGCTRLVIVSSHGGNSALIDLVAGELRGRFGMVAVTT 142

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SWSR  +P+G+    E   GIH G IET++MLAL P LV+ +    F  R     R+F  
Sbjct: 143 SWSRLGLPEGLFPAEEIRHGIHAGGIETALMLALRPDLVRREHVAAFVPRTVAMARDFTL 202

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           LRA    +F W  +DL+P G +G+A   T + GE  L + A  F++LL +++ F
Sbjct: 203 LRAGRPAAFAWKTEDLHPSGALGDARLGTAEAGEAALDHGARTFVRLLEEVDRF 256


>gi|254438886|ref|ZP_05052380.1| creatininase subfamily [Octadecabacter antarcticus 307]
 gi|198254332|gb|EDY78646.1| creatininase subfamily [Octadecabacter antarcticus 307]
          Length = 259

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 142/234 (60%), Gaps = 9/234 (3%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP  A EQHGPHLP+ TDT+IA G+  + +   P  L V  +PV+ +G S EH++  
Sbjct: 24  IAILPTAAIEQHGPHLPVGTDTMIAEGMLAQFRRDCPSDLDVRILPVQSVGKSNEHLWAT 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TLT A  ++ W  I  ++ + G+RKIVI+N+HGGN  LVSI++ E R++  ML +  
Sbjct: 84  GTITLTAATVLQAWTEIGLSVARAGLRKIVIVNSHGGNLDLVSILTRELRVQADMLAIKC 143

Query: 143 SWSRFTIPQGIISFPETEI--GIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
            WS F  P G+  +PE E+  GIHGG++ETS+ML+ AP  V+M  A +F S  +E  R  
Sbjct: 144 QWSGFGTPVGL--YPEKEMAYGIHGGDVETSLMLSFAPDTVEMSCARDFPS-TAENTR-- 198

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
             L   GS S+GW   DL   GVVG+A  AT KKG     +    FI LL D+ 
Sbjct: 199 --LHPTGSVSYGWISSDLGAAGVVGDASLATAKKGADTAVHQVAGFIDLLRDVR 250


>gi|254471105|ref|ZP_05084508.1| creatininase [Pseudovibrio sp. JE062]
 gi|211960247|gb|EEA95444.1| creatininase [Pseudovibrio sp. JE062]
          Length = 262

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 98/240 (40%), Positives = 138/240 (57%), Gaps = 1/240 (0%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP  + EQHGPHLP+  DT I  G+ E + +  P  L    +P++ IG S EH++  
Sbjct: 24  IAILPTASVEQHGPHLPLGVDTYINQGMLETLCARAPEALDFRILPLQCIGKSDEHIHAP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L    A +HW+ +  ++   GIRK+VI N+HGGN  L+ IV+ E R+R  MLV   
Sbjct: 84  GTLSLRADTAAKHWIDVGTSVAACGIRKMVIANSHGGNLDLIGIVARELRIRSKMLVGKC 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            WS F  P+G+ S  E + G+HGG+ ETS+ML     LV M  A++F S   +   N + 
Sbjct: 144 LWSSFGAPEGMFSEEELKFGLHGGDEETSLMLHFRADLVDMQRAQDFRSSAQDLDENAR- 202

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFD 262
           L   G  S+GW   DLNP G VGNA +A+ +KG     +  + FI  L +   FD+S FD
Sbjct: 203 LGPTGLPSYGWIASDLNPHGTVGNAANASSEKGRLTAEHQVDGFIGFLQETADFDISRFD 262


>gi|310814587|ref|YP_003962551.1| Creatininase [Ketogulonicigenium vulgare Y25]
 gi|308753322|gb|ADO41251.1| Creatininase [Ketogulonicigenium vulgare Y25]
          Length = 268

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 140/237 (59%), Gaps = 3/237 (1%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP+   EQHGPHLP+  D++I AG+  R+ + + P LPV  +P+ P+G S EH+   
Sbjct: 22  VAILPIATVEQHGPHLPVGVDSMINAGIIARVMAQIDPALPVFTLPMIPVGKSTEHLSYP 81

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL++    + W  + + +R+ G RKI++ N+HGG   L  IV+ + R +  ML V+ 
Sbjct: 82  GTLTLSWELVAKIWFEMGECVRRTGCRKIILFNSHGGQVALSEIVARDLRAKLGMLAVAA 141

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           +W R T  +GI S  E   G HGGEIETSMMLAL P LV M  AE+F       +   + 
Sbjct: 142 TWFRITPVEGIFSAYEDLHGYHGGEIETSMMLALHPELVDMTKAEDFRQLSQVMVDEAEI 201

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           LR      FGW  +DL+P GV GNA  +   +GE L+   A+  +QL+++  +F +S
Sbjct: 202 LR---PGLFGWMAEDLHPAGVSGNAAASDAARGEALVQRAADRLVQLIHETAAFPLS 255


>gi|90418743|ref|ZP_01226654.1| putative creatinine amidohydrolase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336823|gb|EAS50528.1| putative creatinine amidohydrolase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 282

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 140/237 (59%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           D + V+P+ A EQHGPHLP+ TD I+A  + + + + LP   PVT +P   IG S EH  
Sbjct: 41  DAVAVVPIAAIEQHGPHLPLGTDAILADAMVDAVIARLPEDRPVTFLPTLRIGKSCEHAA 100

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT +  +  A    + +  ++   G R++VI+NAHGGN+P++   + E R R  +LV 
Sbjct: 101 FPGTLSHEWQTATSALIEVGASLAAAGFRRLVIVNAHGGNTPVMDTAALELRRRHGLLVA 160

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           + SW RF  P G++   E   GIHGG +ET++ML L P +V+ +    F S Q E   + 
Sbjct: 161 TCSWLRFGYPDGLLPPEEIASGIHGGAVETALMLHLRPDMVRREAIAAFDSLQDELGGSA 220

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
            +LRAHG   FGW  +DLNP GVVG+A  AT + G  + ++ A+ F   L+D+ +FD
Sbjct: 221 AHLRAHGRIGFGWMAQDLNPAGVVGDARLATAEIGAAIAAHQADAFTAFLDDVLAFD 277


>gi|218529990|ref|YP_002420806.1| creatininase [Methylobacterium chloromethanicum CM4]
 gi|218522293|gb|ACK82878.1| Creatininase [Methylobacterium chloromethanicum CM4]
          Length = 272

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 139/242 (57%), Gaps = 3/242 (1%)

Query: 18  ARKDW---IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           +R DW   + +LP+ A EQHGPHLP+  D  I AG+  R  +++P  LP   +P+ PIG 
Sbjct: 17  SRLDWGPLVAILPVAAVEQHGPHLPVRVDAAINAGILARAVALMPDELPALVLPMLPIGK 76

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           S EH    GT +L++      W+   +++ + G R+++ILN+HGG   ++ IV+ E R+R
Sbjct: 77  SNEHHAFPGTLSLSHETLARLWIETAESVHRAGCRRLLILNSHGGQPQVMEIVTRELRVR 136

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
             ML V +SW   T    + +  E   GIHGGEIETS MLAL P LV+M+ A++F     
Sbjct: 137 LGMLAVGSSWGGVTPMDDLFAQAERRHGIHGGEIETSAMLALHPDLVRMERADDFVPLSV 196

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           E  R    L   G   FGW  +DL+P GV GNA  A V++G  L+   A   ++L+ +I 
Sbjct: 197 EMERAGGLLTPEGRVGFGWMAQDLHPSGVSGNAAAADVRRGAELVERAAAGVVRLVREIA 256

Query: 255 SF 256
            F
Sbjct: 257 DF 258


>gi|319796474|ref|YP_004158114.1| creatininase [Variovorax paradoxus EPS]
 gi|315598937|gb|ADU40003.1| Creatininase [Variovorax paradoxus EPS]
          Length = 273

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 138/241 (57%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R+  I VLP+GA EQHGPHLPM+TDT    G+       LP  LPV  +P  P G S EH
Sbjct: 24  RERLIAVLPVGATEQHGPHLPMSTDTATIDGMVRATLPHLPDDLPVLFLPTVPYGKSNEH 83

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT T++    I  W  I   + K G+RK+V+ N+HGG   ++ IV+ + R    M+
Sbjct: 84  SRYPGTLTVSANTLISLWKDIGACVAKAGVRKLVLYNSHGGQMSVMDIVARDLREEHDMM 143

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           VV+ +W    +P+G+ +  E + GIH G++E+S+ML L P  V+ D  +NFSS   +   
Sbjct: 144 VVAANWYTLGLPEGLFTAHEGKHGIHAGDLESSVMLHLTPDYVRKDQFQNFSSMTEQLAA 203

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
             K+L    S   GW M D+NP G  G+A  AT +KG  +L +    F++LL++++ F +
Sbjct: 204 ENKFLSITPSGKLGWQMHDINPSGAAGDATRATAEKGAAVLDHVGRRFVELLHEVDRFPL 263

Query: 259 S 259
           S
Sbjct: 264 S 264


>gi|222106356|ref|YP_002547147.1| creatinine amidohydrolase [Agrobacterium vitis S4]
 gi|221737535|gb|ACM38431.1| creatinine amidohydrolase [Agrobacterium vitis S4]
          Length = 278

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 139/238 (58%), Gaps = 2/238 (0%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +VVLP+ A EQHGPHLP++ D  I A +  R  + L P   V  +P   +G S EH+   
Sbjct: 24  VVVLPIAAVEQHGPHLPVDVDAAINAEIIRRTVARLQPDTDVLFLPPMMVGKSDEHIAFP 83

Query: 83  GTKTLTYAEAIEH-WLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
           GT  ++  E + H WL +  ++++ G  K+++ N+HGG   L+ IV  + R+   ML VS
Sbjct: 84  GTLAIS-GETLRHVWLDLARSVKRAGAAKLILFNSHGGQMALMDIVCRDIRIELGMLAVS 142

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
            SW R    + + S  E + GIHGG+IETSMMLA+AP  V MD AENF        ++  
Sbjct: 143 CSWFRIAPVEDLFSRAEIDHGIHGGDIETSMMLAIAPERVAMDKAENFVPLTVAIEKSGS 202

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
            L A G+  FGW  +DL+P GV GNA +AT +KG+ +L   A+  + L+    +FD+S
Sbjct: 203 MLTAEGAVGFGWQAQDLHPAGVCGNASNATAQKGQIVLDRAADGLVSLIAATQAFDLS 260


>gi|159043925|ref|YP_001532719.1| creatininase [Dinoroseobacter shibae DFL 12]
 gi|157911685|gb|ABV93118.1| creatininase [Dinoroseobacter shibae DFL 12]
          Length = 265

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 130/234 (55%), Gaps = 5/234 (2%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP  A EQHGPHLP  TDT+I AG+ + + + LP  L +  +P++ +G S EH++  
Sbjct: 25  IAILPTAAIEQHGPHLPTGTDTMIMAGMLDALCAALPEDLNIRILPIQAVGKSNEHIHAP 84

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL    A+  W     ++ + G+RKIV +N+HGGN  LVSI+S E R+R  ML V T
Sbjct: 85  GTLTLEAETALGAWRETGLSVARAGLRKIVCVNSHGGNLDLVSILSRELRVRAGMLAVKT 144

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W  F  P+G+ S  E   GIHGG++ETS+ML   PH V M  A NF+S           
Sbjct: 145 QWMSFGTPEGMYSDTERAFGIHGGDVETSLMLHFQPHTVDMAQARNFASTA-----QGAP 199

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           +   G  S GW   DLN  G VG+A  AT  KGE   ++     I LL  +   
Sbjct: 200 ISPIGPVSLGWVSSDLNAAGTVGDASAATAAKGEATCAHQVGGMIDLLRKLRDL 253


>gi|182678069|ref|YP_001832215.1| creatininase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633952|gb|ACB94726.1| Creatininase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 272

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 100/240 (41%), Positives = 140/240 (58%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +D I VLP+ A EQHGPHLP+  DT +      RI + LP  LPV  +PV+  G S+EH+
Sbjct: 21  QDVIAVLPVAATEQHGPHLPLGVDTFLMEETIARITNRLPDDLPVLFLPVQNCGLSVEHL 80

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              GT +++    +  W  +   I + G RK+V+ N+HGGN  L+ +++ E R +  + V
Sbjct: 81  DFPGTLSISPDILLRAWGELGACIHRAGCRKLVLANSHGGNVGLLDMLAHELRAKLGLFV 140

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           V  +  RF  P G+ S  E   GIH G+IETS MLAL P LV+ +   +FSS      R+
Sbjct: 141 VMATLHRFGTPDGLFSEEEKRHGIHAGDIETSQMLALRPDLVRREALADFSSASESLERD 200

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           F +LR      FGW  +DL+  G +GNA  A+ +KGE  L Y A  FI+LL DI +FD+S
Sbjct: 201 FTWLRTGRPTGFGWMSQDLSASGAMGNAAAASAEKGEPCLDYAATAFIELLQDIAAFDLS 260


>gi|148252832|ref|YP_001237417.1| hypothetical protein BBta_1271 [Bradyrhizobium sp. BTAi1]
 gi|146405005|gb|ABQ33511.1| hypothetical protein BBta_1271 [Bradyrhizobium sp. BTAi1]
          Length = 270

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 135/237 (56%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP+GA EQHGPHLP+  D  I AG+  R   ++PP      +P  P G S EH+   
Sbjct: 25  VAILPVGAIEQHGPHLPVKVDAAINAGILSRALELMPPHSAALVLPPLPYGKSDEHLAFP 84

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL++      W  I +++ + G+RKI+  N+HGG   L+ I+  + R++  ML V+T
Sbjct: 85  GTLTLSHETLGRVWYEIAESVHRAGVRKILFFNSHGGQPQLLDIICRDLRVKLGMLAVNT 144

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           +W +      + +  E  +GIHGG+IETS ML LAP  V+MD AE F S  +   + F  
Sbjct: 145 TWWQLIDISDLFAADEIRLGIHGGQIETSAMLHLAPDDVRMDRAETFISAAAAIEQEFAL 204

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           L    +  FGW  +DL+P GV G+A  A+ + G  ++   A   + L++DI+ + +S
Sbjct: 205 LGPEAAARFGWQAQDLHPAGVCGDARAASAELGRAVVERAAPRLVALVDDISRYPLS 261


>gi|239818090|ref|YP_002947000.1| Creatininase [Variovorax paradoxus S110]
 gi|239804667|gb|ACS21734.1| Creatininase [Variovorax paradoxus S110]
          Length = 273

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 136/241 (56%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R+  I VLP+GA EQHGPHLPM+TDT    G+       LP  LPV  +P    G S EH
Sbjct: 24  RERLIAVLPVGATEQHGPHLPMSTDTATIDGMVRATLPHLPGDLPVLFLPTVAYGKSNEH 83

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT T++    I  W  I   + K G+RK+V+ N+HGG   ++ IV+ + R    M+
Sbjct: 84  SRYPGTLTVSATTLIALWKDIGACVAKAGVRKLVLYNSHGGQMSVMDIVARDLREEHGMM 143

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           VV+ +W    +P+G+ +  E + GIH G++E+S+ML LAP+ V+ D   NF S   +   
Sbjct: 144 VVAANWYTLGLPEGLFTAHEGKHGIHAGDLESSVMLHLAPNDVRPDQFRNFRSMTEDLAA 203

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
             ++L    S   GW M D+NP G  G+A  AT +KG  +L +    F++LL +++ F +
Sbjct: 204 ENQFLSITPSGKLGWQMHDINPAGAAGDATRATAEKGAAVLDHVGRRFVELLQEVDRFPL 263

Query: 259 S 259
           S
Sbjct: 264 S 264


>gi|114705396|ref|ZP_01438304.1| putative creatine amidohydrolase [Fulvimarina pelagi HTCC2506]
 gi|114540181|gb|EAU43301.1| putative creatine amidohydrolase [Fulvimarina pelagi HTCC2506]
          Length = 267

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 94/257 (36%), Positives = 139/257 (54%), Gaps = 3/257 (1%)

Query: 6   IFTDNSLPLCADARKDW---IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
            F D +    A+AR D    + +LPL A E HGPHLP+ TD I+A  +   +        
Sbjct: 4   FFEDWTTEKMAEARADLPGVVPILPLAAMESHGPHLPLGTDAILAREMVYLVDERADDDW 63

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P   +PV+  G S EH +  GT  L +    E   AI  ++ + G  K+ ++NAHGGN+ 
Sbjct: 64  PGVFLPVQNFGVSTEHTHFAGTIDLGWRTMGETIFAIGRSLERAGFTKMALVNAHGGNAA 123

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           ++  +S + R +  +L  + SW RF  P G++   E   GIHGG +ETS+ML   P LV 
Sbjct: 124 MMGQISVDLRAKTGLLAATCSWLRFGFPDGLLPAGEISDGIHGGAVETSLMLHFRPDLVH 183

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
            +    F SRQ+E     +YL AHG   FGW   DLNP GVVG++  A  + G  +  + 
Sbjct: 184 FERMGVFHSRQAEMREENRYLTAHGRLGFGWMSDDLNPAGVVGDSSLAEPEIGRAIAEHQ 243

Query: 243 ANCFIQLLNDINSFDVS 259
           A+ FI  ++++ +FDV+
Sbjct: 244 ADAFITFIDEVAAFDVA 260


>gi|91790093|ref|YP_551045.1| creatininase [Polaromonas sp. JS666]
 gi|91699318|gb|ABE46147.1| Creatininase [Polaromonas sp. JS666]
          Length = 282

 Score =  178 bits (452), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 131/243 (53%), Gaps = 11/243 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP+N D  +  G+       LP  LPV  +P + +G+S EH    
Sbjct: 31  IAVLPVAAIEQHGPHLPLNVDATLVEGVIAAALPQLPADLPVLFLPTQSVGFSPEHTRFA 90

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL     I+ W AI +++   G++K+V+LN+HGG   L+ +V+ + R R  MLV S 
Sbjct: 91  GTLTLKAETIIQLWTAIAESVAATGVQKLVLLNSHGGQVGLLDVVARDLRARLGMLVYSV 150

Query: 143 SWSRFTIP----QG-----IISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           +W  F++P    QG     + S  E   GIH GE+ETSMMLAL P  V M  A++F S  
Sbjct: 151 NW--FSLPLVDEQGASVSDLFSAQEHRFGIHAGEMETSMMLALKPEQVDMAKAQDFHSTS 208

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
            +    F  L    S    W M+D NP+G VGNA  AT  KG  LL        QLL +I
Sbjct: 209 QDRAEKFSILGDGRSAKLAWQMQDYNPQGAVGNAAAATADKGRALLGAAGRSLAQLLEEI 268

Query: 254 NSF 256
              
Sbjct: 269 GQL 271


>gi|300718743|ref|YP_003743546.1| Creatininase [Erwinia billingiae Eb661]
 gi|299064579|emb|CAX61699.1| Creatininase [Erwinia billingiae Eb661]
          Length = 265

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/234 (38%), Positives = 126/234 (53%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+GA EQHGPHLP+  D  I AG+  R   ++P  LPV  +P  P+G S EH+   
Sbjct: 26  IAVLPIGAVEQHGPHLPVRVDAAINAGIIARAVELMPADLPVLILPALPVGKSDEHLNFP 85

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL Y    + W  +  +  + GIRK++  N+HGG   L+ IV  + R+   +  V  
Sbjct: 86  GTLTLPYEVLGKVWFEVAKSAWRAGIRKLIFWNSHGGQPQLMEIVCRQLRIELDLFAVGA 145

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW R      + S  E + GIHGGE ETS+ML L P LV+MD A+NF S           
Sbjct: 146 SWFRTIDSSDLFSAEELQHGIHGGESETSVMLHLHPDLVQMDYAQNFVSASVALAETGGI 205

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           L   G   FGW  +DL+P G  GNA  A  ++G+      A   I+L+ ++ ++
Sbjct: 206 LTPEGGVGFGWMAEDLHPSGTTGNAAAADAERGKIETDRAAEALIRLIEEVQAY 259


>gi|121603309|ref|YP_980638.1| creatininase [Polaromonas naphthalenivorans CJ2]
 gi|120592278|gb|ABM35717.1| Creatininase [Polaromonas naphthalenivorans CJ2]
          Length = 289

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 128/243 (52%), Gaps = 11/243 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP+N D  +  G+       LP  LPV  +P + IG+S EH    
Sbjct: 38  IAVLPVAAIEQHGPHLPLNVDATLVDGVIASALPHLPASLPVLFLPTQSIGFSPEHTRFA 97

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL     +  W  + +++   G++K+V+LN+HGG   L+ +V+ + R R  MLV S 
Sbjct: 98  GTLTLKAETILRLWTELAESVASTGVKKLVLLNSHGGQVGLMDVVARDLRTRLGMLVYSV 157

Query: 143 SWSRFTIP---------QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
             + F +P             S  E   GIH GEIETSMMLAL P  V M  A++F S  
Sbjct: 158 --NSFNLPLVDERGDSVAARFSAHEHRFGIHAGEIETSMMLALRPGQVDMAKAQDFHSTS 215

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
            +    F  L    S   GW M+D NP G VGNA+ AT +KG  LLS       QLL +I
Sbjct: 216 QDRSERFGILGDGRSAKLGWQMQDYNPHGAVGNALAATAEKGHALLSAMGRSLAQLLAEI 275

Query: 254 NSF 256
           +  
Sbjct: 276 DQL 278


>gi|188580367|ref|YP_001923812.1| creatininase [Methylobacterium populi BJ001]
 gi|179343865|gb|ACB79277.1| Creatininase [Methylobacterium populi BJ001]
          Length = 272

 Score =  175 bits (444), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 137/242 (56%), Gaps = 3/242 (1%)

Query: 18  ARKDW---IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           +R DW   + +LP+ A EQHGPHLP+  D  I AG+  R  +++P  LP   +P+ P+G 
Sbjct: 17  SRLDWDSLVAILPVAAVEQHGPHLPVRVDAAINAGILARAVALMPDDLPALVLPMLPVGK 76

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           S EH    GT +L++      W+   +++ + G R+++ILN+HGG   ++ IV+ E R+R
Sbjct: 77  SNEHHAFPGTLSLSHETLARLWIETAESVHRAGCRRLLILNSHGGQPQVMEIVTRELRVR 136

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
             ML V   W   T    + S  E   GIHGGEIETS+MLAL P LV+M+ A++F     
Sbjct: 137 LGMLAVGCGWGGVTAMDDLFSEAERRHGIHGGEIETSLMLALHPDLVRMERADDFVPLTV 196

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
              R    L A G   FGW  +DL+P GV GNA  A  ++G  L+   A   ++L+ +I 
Sbjct: 197 ALERAGGLLTAEGRVGFGWMAQDLHPAGVSGNAAAADARRGAELVERAAAGVVRLVREIA 256

Query: 255 SF 256
            F
Sbjct: 257 DF 258


>gi|254560834|ref|YP_003067929.1| creatininase [Methylobacterium extorquens DM4]
 gi|254268112|emb|CAX23988.1| putative creatininase (creatine amidohydrolase) [Methylobacterium
           extorquens DM4]
          Length = 273

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 136/242 (56%), Gaps = 3/242 (1%)

Query: 18  ARKDW---IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           +R DW   + +LP+ A EQHGPHLP+  D  I AG+  R  +++P  LP   +P+ PIG 
Sbjct: 18  SRLDWGPLVAILPVAAVEQHGPHLPVRVDAAINAGILARAVALMPDDLPALVLPMLPIGK 77

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           S EH    GT +L++      W+   +++ + G R+++ILN+HGG   ++ IV+ E R+R
Sbjct: 78  SNEHHAFPGTLSLSHETLARLWIETAESVHRAGCRRLLILNSHGGQPQVMEIVTRELRVR 137

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
             ML V   W   T    + S  E   GIHGGEIETS MLAL P LV+M+ A++F     
Sbjct: 138 LGMLAVGCGWGGVTPVDDLFSQAERRHGIHGGEIETSAMLALHPDLVRMERADDFVPLSV 197

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           E  R    L   G   FGW  +DL+P GV GNA  A  ++G  L+   A   ++L+ +I 
Sbjct: 198 EMERAGGLLTPEGRVGFGWMAQDLHPSGVSGNAAAADARRGAELVERAAAGVVRLVREIA 257

Query: 255 SF 256
            F
Sbjct: 258 DF 259


>gi|163851139|ref|YP_001639182.1| creatininase [Methylobacterium extorquens PA1]
 gi|163662744|gb|ABY30111.1| Creatininase [Methylobacterium extorquens PA1]
          Length = 273

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 135/242 (55%), Gaps = 3/242 (1%)

Query: 18  ARKDW---IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           +R DW   + +LP+ A EQHGPHLP+  D  I AG+  R  +++P  L    +P+ PIG 
Sbjct: 18  SRLDWGPLVAILPVAAVEQHGPHLPVRVDAAINAGILARAVALMPDDLSALVLPMLPIGK 77

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           S EH    GT +L++      W+   +++ + G R+++ILN+HGG   L+ IV+ E R+R
Sbjct: 78  SNEHHAFPGTLSLSHETLARLWIETAESVHRAGCRRLLILNSHGGQPQLMEIVTRELRVR 137

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
             ML V   W   T    + S  E   GIHGGEIETS MLAL P LV+M+ A++F     
Sbjct: 138 LGMLAVGCGWGGVTPMDDLFSEAERRHGIHGGEIETSAMLALHPDLVRMERADDFVPLSV 197

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           E  R    L   G   FGW  +DL+P GV GNA  A  ++G  L+   A   ++L+ +I 
Sbjct: 198 EMERAGSLLTPEGQVGFGWMAQDLHPSGVSGNAAAADARRGAELVERAAAGVVRLVREIA 257

Query: 255 SF 256
            F
Sbjct: 258 DF 259


>gi|240138292|ref|YP_002962764.1| putative creatininase (creatine amidohydrolase) [Methylobacterium
           extorquens AM1]
 gi|240008261|gb|ACS39487.1| putative creatininase (creatine amidohydrolase) [Methylobacterium
           extorquens AM1]
          Length = 273

 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 136/242 (56%), Gaps = 3/242 (1%)

Query: 18  ARKDW---IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           +R DW   + +LP+ A EQHGPHLP+  D  I AG+  R  +++P  LP   +P+ PIG 
Sbjct: 18  SRLDWGPLVAILPVAAVEQHGPHLPVRVDAAINAGILARAVALMPDDLPALVLPMLPIGK 77

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           S EH    GT +L++      W+   +++ + G R+++ILN+HGG   ++ IV+ E R+R
Sbjct: 78  SNEHHAFPGTLSLSHETLARLWIETAESVHRAGCRRLLILNSHGGQPQVMEIVTRELRVR 137

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
             ML V   W   T    + S  E   GIHGGEIETS MLAL P LV+++ A++F     
Sbjct: 138 LGMLAVGCGWGGVTPMDDLFSQAERRHGIHGGEIETSAMLALHPDLVRIERADDFVPLSV 197

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           E  R    L   G   FGW  +DL+P GV GNA  A  ++G  L+   A   ++L+ +I 
Sbjct: 198 EMERAGGLLTPEGRVGFGWMAQDLHPSGVSGNAAAADARRGAELVERAAAGVVRLVREIA 257

Query: 255 SF 256
            F
Sbjct: 258 DF 259


>gi|153011189|ref|YP_001372403.1| creatininase [Ochrobactrum anthropi ATCC 49188]
 gi|151563077|gb|ABS16574.1| Creatininase [Ochrobactrum anthropi ATCC 49188]
          Length = 266

 Score =  171 bits (434), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 87/244 (35%), Positives = 135/244 (55%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R+  + VLP+GA EQHGPHLP+  D  I  G+ +   + LP       +P + IG S EH
Sbjct: 18  REKLVAVLPVGAIEQHGPHLPLAVDAAIVDGMVKETIARLPETSHALFLPTQAIGKSNEH 77

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT T +    I  W  I   +   G+RK+ +LN+HGG   ++ IV+ E R+R +ML
Sbjct: 78  SRYPGTLTFSAETIIRMWCEIGACVAASGVRKMALLNSHGGQISVMDIVARELRIRHNML 137

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           VVS +W    +P+G+ S  + + GIH G++ETS+ML + P LV M   ++F +    F  
Sbjct: 138 VVSINWFGLGMPEGVYSDHDLKHGIHAGDMETSVMLEMHPDLVDMSKVQDFRTLTETFAS 197

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           +F++L   G     W ++D+NP G  G+A  AT +KG   + + A   +++L +I    +
Sbjct: 198 DFQHLSLSGGAKPAWQIQDINPYGAAGDATLATAEKGRATIDFAAERLVEVLAEIERAPL 257

Query: 259 SIFD 262
           S  D
Sbjct: 258 SWLD 261


>gi|239834158|ref|ZP_04682486.1| creatininase [Ochrobactrum intermedium LMG 3301]
 gi|239822221|gb|EEQ93790.1| creatininase [Ochrobactrum intermedium LMG 3301]
          Length = 266

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 87/244 (35%), Positives = 135/244 (55%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R+  + VLP+GA EQHGPHLP+  D  I  G+ +   + LP       +P + IG S EH
Sbjct: 18  REKLVAVLPVGAIEQHGPHLPLAVDAAIVDGMVKETIARLPETSHALFLPTQAIGKSNEH 77

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT T +    I  W  I   +   G+RK+ +LN+HGG   ++ IV+ E R+R +ML
Sbjct: 78  SRYPGTLTFSAETIIRMWCEIGACVAGSGVRKMALLNSHGGQISVMDIVARELRIRHNML 137

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           VVS +W    +P+G+ S  + + GIH G++ETS+ML + P LV M   ++F +    F  
Sbjct: 138 VVSINWFGLGMPEGVYSDHDLKHGIHAGDMETSVMLEMHPDLVDMSKVQDFRTLTETFAS 197

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           +F++L   G     W ++D+NP G  G+A  AT +KG   + + A   +++L +I    +
Sbjct: 198 DFQHLSLSGGAKPAWQIQDINPYGAAGDATLATAEKGRATIDFAAERLVEVLAEIERAPL 257

Query: 259 SIFD 262
           S  D
Sbjct: 258 SWLD 261


>gi|114327494|ref|YP_744651.1| creatinine amidohydrolase family protein [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315668|gb|ABI61728.1| creatinine amidohydrolase family protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 275

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 148/265 (55%), Gaps = 3/265 (1%)

Query: 2   NPLIIFTDNSLP-LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
            PL  + D S P + A  ++  I VLP+ A EQHGPHLP+  D  I  GL +     +P 
Sbjct: 5   KPLRYWQDMSWPEIAALDKQAAIAVLPVAAVEQHGPHLPLWVDAAINEGLLKLALDRVPD 64

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            + V  +P++ +G+S EH+   GT TL+    +     +  ++ + G R++V LN+HGG 
Sbjct: 65  DMQVLALPMQAVGWSEEHIAFPGTLTLSADTLLAVLRDLGASVARAGFRRLVFLNSHGGQ 124

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
             ++ IV+ E R+RF M V    W++  +P G+ S  E   GIHGG +ETS+M+ L P  
Sbjct: 125 PQILDIVARELRIRFGMFVTVCGWTKLGVPDGLFSPLERSTGIHGGALETSLMMHLRPDQ 184

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           +++   ++F     +   + ++L A G   + W+ +DLNP G  G+A  A+ +KG  L  
Sbjct: 185 LRLSRIDDFVPAHRD--DSHRHLSATGRIPYAWTAQDLNPGGACGDARAASAEKGRILAE 242

Query: 241 YFANCFIQLLNDINSFDVSIFDKDV 265
           + A+ F+ LL+++  FD++   + +
Sbjct: 243 HLASQFVSLLHEVEKFDLARLQETI 267


>gi|264676550|ref|YP_003276456.1| creatininase [Comamonas testosteroni CNB-2]
 gi|262207062|gb|ACY31160.1| Creatininase [Comamonas testosteroni CNB-2]
          Length = 291

 Score =  168 bits (425), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 139/248 (56%), Gaps = 2/248 (0%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           D + VLP+ A EQHGPHLP++ D  +  G+ +   + LP  LPV  +P + IG+S+EH +
Sbjct: 42  DTVAVLPVAAVEQHGPHLPLSVDASLIEGVIDAALAQLPAELPVLFLPAQNIGFSVEHTH 101

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT +L  A  I  W  +   + + GIRK+++LN HGG   ++ IV+ E R++  +LV 
Sbjct: 102 YAGTLSLQPATLIALWTELGACVARAGIRKLLLLNGHGGQVSVMDIVARELRIKHGLLVY 161

Query: 141 STSWSRFTIPQGIISF--PETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           S SW           F   E   GIHGGE+ETSMML LAP  V M+ A+NF+S       
Sbjct: 162 SASWFGLVDDAANQQFCAHEHRFGIHGGEVETSMMLHLAPETVHMERAQNFASSSELRAG 221

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
            + ++    S   GW+++D NP G VGN+  AT ++G  ++   A   ++LL++I+   +
Sbjct: 222 KYHFIGNGRSAKLGWAIEDYNPAGAVGNSAAATAERGAAMVHSSAEGLVRLLSEIHDLPL 281

Query: 259 SIFDKDVQ 266
           S      Q
Sbjct: 282 STVGNQPQ 289


>gi|299531303|ref|ZP_07044713.1| Creatininase [Comamonas testosteroni S44]
 gi|298720710|gb|EFI61657.1| Creatininase [Comamonas testosteroni S44]
          Length = 291

 Score =  168 bits (425), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 139/248 (56%), Gaps = 2/248 (0%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           D + VLP+ A EQHGPHLP++ D  +  G+ +   + LP  LPV  +P + IG+S+EH +
Sbjct: 42  DTVAVLPVAAVEQHGPHLPLSVDASLIEGVIDAALAQLPAELPVLFLPAQNIGFSVEHTH 101

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT +L  A  I  W  +   + + GIRK+++LN HGG   ++ IV+ E R++  +LV 
Sbjct: 102 YAGTLSLQPATLIALWTELGACVARAGIRKLLLLNGHGGQVSVMDIVARELRIKHGLLVY 161

Query: 141 STSWSRFTIPQGIISF--PETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           S SW           F   E   GIHGGE+ETSMML LAP  V M+ A+NF+S       
Sbjct: 162 SASWFGLVDDAANQQFCAHEHRFGIHGGEVETSMMLHLAPETVHMERAQNFASSSELRAG 221

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
            + ++    S   GW+++D NP G VGN+  AT ++G  ++   A   ++LL++I+   +
Sbjct: 222 KYHFIGNGRSAKLGWAIEDYNPAGAVGNSAAATAERGAAMVHSSAEGLVRLLSEIHDLPL 281

Query: 259 SIFDKDVQ 266
           S      Q
Sbjct: 282 STVGNQPQ 289


>gi|221069343|ref|ZP_03545448.1| Creatininase [Comamonas testosteroni KF-1]
 gi|220714366|gb|EED69734.1| Creatininase [Comamonas testosteroni KF-1]
          Length = 291

 Score =  168 bits (425), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 138/248 (55%), Gaps = 2/248 (0%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           D + VLP+ A EQHGPHLP++ D  +  G+ +   + LP  LPV  +P + IG+S+EH +
Sbjct: 42  DTVAVLPVAAVEQHGPHLPLSVDARLIEGVIDAALAQLPAELPVLFLPPQNIGFSVEHTH 101

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT +L  A  I  W  +   + + GIRK+++LN HGG   ++ IV+ E R+R  +LV 
Sbjct: 102 YAGTLSLQPATLIALWTELGACVARAGIRKLLLLNGHGGQVSVMDIVARELRIRHGLLVY 161

Query: 141 STSWSRFTIPQGIISF--PETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           S SW           F   E   GIHGGE+ETSM+L LAP  V M+ A+NF+S   +   
Sbjct: 162 SASWFGLVDDAANQQFCAHEHRFGIHGGEVETSMLLHLAPETVHMERAQNFASSSEQRAG 221

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
            + ++    S   GW+++D NP G VGN+  AT ++G  ++   A   + LL +I+   +
Sbjct: 222 KYHFIGNGRSAKLGWAIEDYNPAGAVGNSAAATAERGAAMVRSSAQGLVGLLGEIHDLPL 281

Query: 259 SIFDKDVQ 266
           S      Q
Sbjct: 282 STVGNQPQ 289


>gi|89053969|ref|YP_509420.1| creatininase [Jannaschia sp. CCS1]
 gi|88863518|gb|ABD54395.1| Creatininase [Jannaschia sp. CCS1]
          Length = 261

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 88/239 (36%), Positives = 137/239 (57%), Gaps = 5/239 (2%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP+ A EQHGPHLP+  DT+I  GL + + +  P  L +  +P++ +G S EH++  
Sbjct: 21  IAILPVAAVEQHGPHLPVGVDTMINQGLCDELVARCPDTLDIRLLPLQAVGKSNEHLWAP 80

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+   A++ W+ I  ++ + G RK++I+N+HGGN  L+SIVS E R+R  M  V  
Sbjct: 81  GTLTLSAETAMKAWVEIGLSVARAGARKMLIVNSHGGNMDLISIVSRELRVRAGMYCVRM 140

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W    +P G+ S  ET  GIHGG+ ETS+ML   P  V M  A++F    ++       
Sbjct: 141 VWGAGGVPDGVFSAQETTQGIHGGDNETSLMLHFRPDAVDMSKAKDFRWTHTQ-----GE 195

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           +   G  + GW   D++P+GV G A  AT +KG    +++ +  I +L+ I +  +  F
Sbjct: 196 IPPVGPIAHGWIASDVHPEGVAGEAHLATAEKGRVTAAHYVDGVIDVLHKIAAQPLDRF 254


>gi|121610089|ref|YP_997896.1| creatininase [Verminephrobacter eiseniae EF01-2]
 gi|121554729|gb|ABM58878.1| Creatininase [Verminephrobacter eiseniae EF01-2]
          Length = 272

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/238 (35%), Positives = 130/238 (54%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R+  I VLPLGA EQHGPHLPM+TDT     +     + LP  LPV  +P    G S EH
Sbjct: 23  RERLIAVLPLGAIEQHGPHLPMSTDTATIDAMVRASLAHLPDALPVLFLPTLAYGKSNEH 82

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT TL+ + +I     I   + + G+RK+V+ N+HGG   ++ IV+ + R   SM+
Sbjct: 83  ARYPGTLTLSASTSIALCKEIGACVARAGVRKLVLYNSHGGQMSVMDIVARDLRQEQSMM 142

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           VV+ +W    +P+G+ +  E   GIH G +E+S+ML + P  V      +F S       
Sbjct: 143 VVAANWFTLGLPEGLFAAQELRHGIHAGALESSVMLQIRPGDVHTGELRDFDSLGQTLAA 202

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
             ++L   G +  GW M+D+NP G  G+A  A+ +KG  +L +      +LL++++ F
Sbjct: 203 QGQWLAITGGNKLGWQMQDINPAGAAGDATCASAEKGAAVLDHVGRRLAELLHEVDRF 260


>gi|120613080|ref|YP_972758.1| creatininase [Acidovorax citrulli AAC00-1]
 gi|120591544|gb|ABM34984.1| Creatininase [Acidovorax citrulli AAC00-1]
          Length = 282

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 121/217 (55%), Gaps = 3/217 (1%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+ A EQHGPHLP+  D  +  G+ +    +LP  LPV  +P + +G+S EH    
Sbjct: 35  VAVLPVAAVEQHGPHLPLGVDATLLRGVIDAALPLLPADLPVLFLPPQDVGFSTEHTSFP 94

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+ A  +  W  +   + + G++K+++LN HGG   ++ IV+ E R R  +LV S 
Sbjct: 95  GTLTLSPATVMALWSELGACVARAGVKKLLLLNGHGGQVSVMDIVARELRQRHGLLVYSA 154

Query: 143 SWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           SW    +P   QG+ S  E   GIH G+IETSMML LAP  V+M  A  F S   +    
Sbjct: 155 SWFSLPLPEAVQGLFSAEEHRFGIHAGQIETSMMLHLAPDTVRMAHAGCFRSTSQDRAER 214

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           +  L    S   GW+++D +P G VG+A  AT  KG 
Sbjct: 215 YAILGNGRSAKMGWAIEDYHPSGAVGDAAGATAGKGR 251


>gi|218678366|ref|ZP_03526263.1| Creatininase [Rhizobium etli CIAT 894]
          Length = 146

 Score =  159 bits (401), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 106/138 (76%)

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           P+++IV+TEAR+RF+ML V+TSW+RF +P G+I   E  IGIHGG+IETS+MLAL P  V
Sbjct: 6   PVMTIVATEARIRFAMLAVATSWTRFGLPDGLIPPEEKAIGIHGGDIETSVMLALHPDKV 65

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
            M  A +F SRQ+EF   FK+LRA+G H+FGW M DLNP+G  GNA+ AT +KG+ L+++
Sbjct: 66  DMAKAADFPSRQTEFTTRFKHLRAYGPHAFGWKMADLNPQGAAGNAVAATAEKGDALIAH 125

Query: 242 FANCFIQLLNDINSFDVS 259
             N  ++LL D+++FDV+
Sbjct: 126 AVNGLVELLKDVDAFDVT 143


>gi|326388096|ref|ZP_08209699.1| creatinine amidohydrolase family protein [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326207262|gb|EGD58076.1| creatinine amidohydrolase family protein [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 270

 Score =  158 bits (400), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 90/239 (37%), Positives = 135/239 (56%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+GA EQHGPHLP+  D+ I   L +R  +  P  L V  +P++ +G S EH+   
Sbjct: 28  VAVLPVGAIEQHGPHLPVYVDSCINQELLDRALATAPADLDVVALPLQAVGKSNEHLAFP 87

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L+ A      L + D++ + G+R++++LN+HGG   ++ +V+ E R+R  ML V+ 
Sbjct: 88  GTLSLSNATLTALLLDLGDSVARAGVRRLILLNSHGGQPQVLDVVARELRIRHGMLAVNA 147

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           +W    +P G+ +  E   GIHGGE+ETS+ML L P LV M  A +F S   +   +F  
Sbjct: 148 AWYSMGMPPGLFAPDELHHGIHGGELETSLMLHLRPDLVDMTKAADFRSLSQDMEGDFTL 207

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           L   G   FGW  +DLNP G VGNA  A  ++G  L       F +L  ++  F +  F
Sbjct: 208 LSPEGKFGFGWQTQDLNPAGAVGNAAGADAERGRILAEAAVARFHELAREVARFPLERF 266


>gi|289208263|ref|YP_003460329.1| creatininase [Thioalkalivibrio sp. K90mix]
 gi|288943894|gb|ADC71593.1| Creatininase [Thioalkalivibrio sp. K90mix]
          Length = 267

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 139/259 (53%), Gaps = 4/259 (1%)

Query: 4   LIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           LI + D +    AD AR+D +VVLP+ A EQHG HLP++TD  I  GL +    +LP  L
Sbjct: 6   LIRWQDLTTEAVADHARRDAVVVLPMAAIEQHGAHLPLDTDLRIGLGLLDAAAPLLPSDL 65

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
               +P   I  S EH +  GT +LT   A+     I  A+   G R++V+ N+HGGN+ 
Sbjct: 66  EPLVLPPMAIATSAEHTHFAGTLSLTPETALALLREIGAAVAHAGFRRLVLANSHGGNTA 125

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEI--GIHGGEIETSMMLALAPHL 180
           ++ + + + R  + +LV    +    +P   +  PE E   G+HGG IET+MM  LAP L
Sbjct: 126 IMELAALDLRRDYGLLVSKHHYFLQYLPD-TLDIPERERRHGLHGGLIETAMMRMLAPTL 184

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+MD A++  S   +     + L   G  +F W   DLNP GVVG A  AT + G+ L+ 
Sbjct: 185 VQMDRAQDARSLGEDLEDTTRRLGPTGETAFAWMADDLNPGGVVGAADRATPELGQVLID 244

Query: 241 YFANCFIQLLNDINSFDVS 259
           ++A    Q + D  +F + 
Sbjct: 245 HYAKGLAQAITDTAAFPIE 263


>gi|99078031|ref|YP_611289.1| creatininase [Ruegeria sp. TM1040]
 gi|99035169|gb|ABF62027.1| Creatininase [Ruegeria sp. TM1040]
          Length = 263

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 85/239 (35%), Positives = 128/239 (53%), Gaps = 1/239 (0%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +D I VLPLGA EQHGPHLP++ DT +    A R+ + L P   V  +P   I  S EH 
Sbjct: 20  QDCIAVLPLGATEQHGPHLPLSVDTDLVQETAARMLANLDPAQSVLVLPALAITKSNEHN 79

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              GT +L+    +     I  ++ + GI ++V+ N HGGN+ ++ + + E R+   ++V
Sbjct: 80  RFSGTLSLSPETLLAVLREIGASVARAGIERLVLFNGHGGNTAILQVAARELRISHDLIV 139

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           V  SWS F    G+       + +H G+ ETS MLA  P LV M  A+ F +   ++   
Sbjct: 140 VVCSWSGFAEADGLFDPAAYAVDLHAGDSETSAMLASHPGLVDMSRAKTFGTAMEDWAGE 199

Query: 200 FKYLRAHGSHSF-GWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
           F+++   G  +  GW   DLNP GV G+A+ AT +KGE +L+     F + L +   FD
Sbjct: 200 FRFIGLTGEPATPGWIADDLNPDGVCGDAVAATAEKGEAMLASAGRNFARFLAEFAHFD 258


>gi|222869508|gb|EEF06639.1| predicted protein [Populus trichocarpa]
          Length = 386

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 134/233 (57%), Gaps = 2/233 (0%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP++ D  +  G+ +    +LPP LPV  +P + IG+S+EH    
Sbjct: 139 IAVLPVAAVEQHGPHLPLSVDARLLQGVIDAALPLLPPELPVLFLPPQNIGFSVEHQSFA 198

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+ A  I  W  +   + + G+R++++LN HGG   ++ IV+ E RMR  +LV S+
Sbjct: 199 GTLTLSPATVIALWTELGACVARAGVRRLLLLNGHGGQVSVMDIVARELRMRHGLLVYSS 258

Query: 143 SWSRFTIPQGIISFP--ETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           SW           F   E   GIHGGE+ETSMML LAP  V+M+ A +F S   +  +  
Sbjct: 259 SWFGLVDDAANAQFSAHEHRFGIHGGEVETSMMLHLAPETVRMEHARDFHSTSQDRAQRH 318

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
             L    S   GW+++D N  G VGNA  AT ++G  ++   A   ++LL+++
Sbjct: 319 ALLGNGRSAKMGWAIEDYNVCGAVGNAAGATAERGALMVEASARGLVRLLSEM 371


>gi|160896038|ref|YP_001561620.1| creatininase [Delftia acidovorans SPH-1]
 gi|160361622|gb|ABX33235.1| Creatininase [Delftia acidovorans SPH-1]
          Length = 287

 Score =  155 bits (392), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 133/233 (57%), Gaps = 2/233 (0%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP++ D  +  G+ +    +LPP LP   +P + IG+S+EH    
Sbjct: 40  IAVLPVAAVEQHGPHLPLSVDARLLQGVIDAALPLLPPELPALFLPPQNIGFSVEHQSFA 99

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+ A  I  W  +   + + G+R++++LN HGG   ++ IV+ E RMR  +LV S+
Sbjct: 100 GTLTLSPATVIALWTELGACVARAGVRRLLLLNGHGGQVSVMDIVARELRMRHGLLVYSS 159

Query: 143 SWSRFTIPQGIISFP--ETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           SW           F   E   GIHGGE+ETSMML LAP  V+M+ A +F S   +  +  
Sbjct: 160 SWFGLVDDAANAHFSAHEHRFGIHGGEVETSMMLHLAPESVRMEHARDFHSTSEDRAQRH 219

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
             L    S   GW+++D N  G VGNA  AT ++G  ++   A   ++LL++I
Sbjct: 220 ALLGNGRSAKMGWAIEDYNVCGAVGNAAGATAERGALMVEASARGLVRLLSEI 272


>gi|222112294|ref|YP_002554558.1| creatininase [Acidovorax ebreus TPSY]
 gi|221731738|gb|ACM34558.1| Creatininase [Acidovorax ebreus TPSY]
          Length = 275

 Score =  155 bits (392), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 92/236 (38%), Positives = 133/236 (56%), Gaps = 2/236 (0%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+ A EQHGPHLP++ D  + AG+ +    +LP  LPV  +P + +G S EH+   
Sbjct: 32  VAVLPVAAVEQHGPHLPLSVDATLLAGVIDAALPLLPADLPVLLLPAQNVGLSTEHLSYP 91

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+ A  I  W  +   I + G++K+++LN HGGN   + IV+ E R R  +LV  +
Sbjct: 92  GTLTLSPATLIALWTELGACIARAGVKKLLLLNGHGGNVAAMDIVARELRQRHGLLVYGS 151

Query: 143 SWSRFTIPQGIISFPETE--IGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           SW           F   E   GIHGGEIETSMML LAP  V+M+ A++F S   +    +
Sbjct: 152 SWFNLVDEATNARFAAQEHRFGIHGGEIETSMMLHLAPATVRMEHAQHFPSTSQDRAARY 211

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
             L    S   GW+++D NP G VGNA  AT  +G+ ++   A    QLL ++++ 
Sbjct: 212 GLLGNGKSAKMGWAIEDYNPAGAVGNAAAATAAQGQAMVQAAARGLAQLLGELHAL 267


>gi|319791446|ref|YP_004153086.1| creatininase [Variovorax paradoxus EPS]
 gi|315593909|gb|ADU34975.1| Creatininase [Variovorax paradoxus EPS]
          Length = 275

 Score =  155 bits (391), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 114/201 (56%), Gaps = 6/201 (2%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLPLGA EQHGPHLP+  D+++A G+      +LP  LPV  +P + IG S EH    
Sbjct: 29  VAVLPLGATEQHGPHLPLGVDSVLADGIVAASLPLLPAALPVLFLPTQQIGLSPEHARFA 88

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+    I  W  I   + + G++K+V+ NAHGG+   + IV+ E R    ++V S 
Sbjct: 89  GTLTLSAETLIRMWREIGAGVARAGVKKLVLFNAHGGHVGAMDIVARELRAAHGLIVYSV 148

Query: 143 SWSRFTIPQG----IISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           SW  F +P G      S  E   G+H GEIETSMMLAL P LV+M  A++F S   +   
Sbjct: 149 SW--FNLPLGDAGAQFSTQEHRFGVHAGEIETSMMLALTPRLVRMGEAKDFRSTSEKRAA 206

Query: 199 NFKYLRAHGSHSFGWSMKDLN 219
           ++  L    S   GW+M+D N
Sbjct: 207 DYAILGNGKSAKLGWAMEDYN 227


>gi|237653126|ref|YP_002889440.1| creatininase [Thauera sp. MZ1T]
 gi|237624373|gb|ACR01063.1| Creatininase [Thauera sp. MZ1T]
          Length = 275

 Score =  155 bits (391), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 85/244 (34%), Positives = 125/244 (51%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           AR D + +LPL A EQHG HLP++TD  IA GL E +   L   LP+  +P   +G S+E
Sbjct: 22  ARADAVALLPLAAIEQHGEHLPLSTDLDIALGLLEAVVPKLRAGLPLCVLPPVAVGCSLE 81

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           H    GT  L    A+   + I   + + G+R++V+ N HGGN  LV + + E R    M
Sbjct: 82  HTGFAGTLALDAKTALASVVQIGACVARAGLRRLVLFNTHGGNKALVDLAALELRAAQRM 141

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
           LVV     RF  P   +   E   G+HGG +ET++M+ LAPH V+ D  + F S      
Sbjct: 142 LVVRAHSFRFPPPPAALPADELRDGLHGGALETALMMHLAPHKVRRDAVDRFESLGVRMA 201

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
              + L   G   F W  +DL+P G  G+   A    G  L+ +FA+   +++ + + FD
Sbjct: 202 AAGRLLGPEGEAGFAWMAQDLHPSGACGDPRLADAALGARLVEHFASRLARIVEEAHDFD 261

Query: 258 VSIF 261
           +   
Sbjct: 262 LEAL 265


>gi|92113298|ref|YP_573226.1| creatininase [Chromohalobacter salexigens DSM 3043]
 gi|91796388|gb|ABE58527.1| Creatininase [Chromohalobacter salexigens DSM 3043]
          Length = 277

 Score =  154 bits (390), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 138/253 (54%), Gaps = 6/253 (2%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +S  L A    + + +LPLGA EQHG HLP++TD  IA GL    ++ +   + +  +P 
Sbjct: 20  SSPELAARVTPESVALLPLGAVEQHGAHLPLSTDVDIADGLVAAARAHVARDIELLVLPT 79

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G S+EH    GT +L    AI H + I  ++ + GIR++V+ N+HGGN  +V + + 
Sbjct: 80  VAVGASMEHGDFAGTLSLAPETAIAHLVEIGASVARAGIRRLVLFNSHGGNKAVVDLAAL 139

Query: 130 EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK---MDLA 186
             R R  +LVV  ++ RF  P   +   E   G+HGG +ET+MM+ LAPH V+   +  A
Sbjct: 140 TLRERHGLLVVKANYFRFAPPDDALPAEELRHGLHGGALETAMMMHLAPHKVRHAHLGEA 199

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
            +  +RQ +       L   G   F W  +DL+P GVVG+A  AT   GE L+++FA   
Sbjct: 200 VSLGARQEQ---TGHGLLPEGDAGFAWLAQDLHPDGVVGDARLATPALGERLVAHFAARL 256

Query: 247 IQLLNDINSFDVS 259
             ++     FD++
Sbjct: 257 AAVVEAAACFDLT 269


>gi|89902506|ref|YP_524977.1| creatininase [Rhodoferax ferrireducens T118]
 gi|89347243|gb|ABD71446.1| Creatininase [Rhodoferax ferrireducens T118]
          Length = 286

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 96/248 (38%), Positives = 133/248 (53%), Gaps = 11/248 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP++ DT++  G+       L   L V  +P + +G S EH    
Sbjct: 32  IAVLPVAATEQHGPHLPLSVDTVLVDGIVTAALPHLAADLNVLFLPTQAVGLSPEHARFP 91

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL     +  W  I +++   GI+K+++ N+HGGN  ++ +V+ + R R  MLV S 
Sbjct: 92  GTLTLKNETILRLWTDIGESVAAAGIQKLLLFNSHGGNVSVMDLVARDLRARLGMLVYSV 151

Query: 143 SWSRFTIP----QG-----IISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           SW  F +P    QG     + S  E   GIH GE+ETSMMLAL P  V M  A+NF S  
Sbjct: 152 SW--FNLPLTDAQGQDVNALFSADEHRFGIHAGEMETSMMLALDPARVNMVQAQNFHSTA 209

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
            +  + F  L    S   GW M+D NP G VGNA  A+ +KG  L++       +LL +I
Sbjct: 210 QDRAQKFAILGNGKSAKLGWQMQDYNPAGAVGNAAAASAEKGRALVAAAGLGLARLLAEI 269

Query: 254 NSFDVSIF 261
           N   +S  
Sbjct: 270 NQLPLSTL 277


>gi|239813746|ref|YP_002942656.1| Creatininase [Variovorax paradoxus S110]
 gi|239800323|gb|ACS17390.1| Creatininase [Variovorax paradoxus S110]
          Length = 275

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 83/199 (41%), Positives = 111/199 (55%), Gaps = 6/199 (3%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLPLGA EQHGPHLP+  DT++A G+      +LP  LPV  +P + IG S EH    
Sbjct: 29  VAVLPLGATEQHGPHLPLGVDTVLADGIVAASLPLLPAALPVLFLPTQQIGLSPEHARFA 88

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+    I  W  I   +   G++K+V+ NAHGG+   + IV+ E R    ++V S 
Sbjct: 89  GTLTLSAETLIRMWKEIGAGVAHAGVKKLVLFNAHGGHVGAMDIVARELRAAHGLIVYSV 148

Query: 143 SWSRFTIPQG----IISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           SW  F +P G         E   G+H GEIETSMMLALAP  V+M  A+NF S   +   
Sbjct: 149 SW--FNLPLGDAGAQFGAGEHRFGVHAGEIETSMMLALAPQQVRMAEAKNFRSTSEQRAA 206

Query: 199 NFKYLRAHGSHSFGWSMKD 217
           ++  L    S   GW+M+D
Sbjct: 207 DYAILGNGKSAKLGWAMED 225


>gi|332531629|ref|ZP_08407526.1| creatininase [Hylemonella gracilis ATCC 19624]
 gi|332038992|gb|EGI75421.1| creatininase [Hylemonella gracilis ATCC 19624]
          Length = 256

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 94/243 (38%), Positives = 131/243 (53%), Gaps = 8/243 (3%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP--PRLPVTCMPVEPIGYSI 76
           R   I VLPLGA EQHGPHLP++ D  +  G+   + + LP    LPV  +P + +G+S 
Sbjct: 6   RARVIAVLPLGATEQHGPHLPLSVDHDLVNGV---VAASLPHLGDLPVLFLPTQDVGFSP 62

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EH    GT TL  +  I  W A+ +++ + G+RK+V+LNAHGG   L+ +V+ + R R  
Sbjct: 63  EHQAYPGTLTLPASLVIGLWTALGESVARAGVRKLVLLNAHGGQVGLLDVVARDLRARLG 122

Query: 137 MLVVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           +LV S +     +P    G+ S  E   GIH G+IET+MMLAL P  V+M  A  F S  
Sbjct: 123 VLVYSVNTFNLPLPPEVDGLFSAQEHRYGIHAGQIETAMMLALTPQRVRMAQARRFDSAS 182

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                 F  L    S    W M+D NP G VG+A  AT ++G  LL         LL++I
Sbjct: 183 QARAARFPILGNGRSAKLAWQMQDYNPAGAVGDAAAATAEQGHALLEAQGRALAALLDEI 242

Query: 254 NSF 256
           +  
Sbjct: 243 DRL 245


>gi|260222498|emb|CBA32121.1| hypothetical protein Csp_D30540 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 908

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 121/225 (53%), Gaps = 11/225 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP+  D+ +  G+       + P +P   +P + +G+S EH    
Sbjct: 659 IAVLPVAATEQHGPHLPLQVDSALVDGVIAHALPHIGPDVPALFLPTQAVGFSPEHAQFS 718

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL     I  W  I + +   G++++V+ N+HGG   L+ +V+ + R R  MLV S 
Sbjct: 719 GTLTLKAETVIRLWTEIGECVAASGVKRLVLFNSHGGQVGLMDVVARDLRARLGMLVYSV 778

Query: 143 SWSRFTIP---------QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           +W  F +P           + S  E   GIH G+IETSMMLAL P LV MD A+NF+S  
Sbjct: 779 NW--FGLPLMAADGSDVNALFSAHEHRFGIHAGDIETSMMLALRPDLVDMDEADNFASTS 836

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            +  + F  L    S   GW M+D NP G VGNA  AT  KG  +
Sbjct: 837 EDRAKAFPILGNGKSAKLGWQMQDYNPAGAVGNAAAATPDKGHAV 881


>gi|121596139|ref|YP_988035.1| creatininase [Acidovorax sp. JS42]
 gi|120608219|gb|ABM43959.1| Creatininase [Acidovorax sp. JS42]
          Length = 289

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/236 (38%), Positives = 132/236 (55%), Gaps = 2/236 (0%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+ A EQHGPHLP++ D  + AG+ +    +L   LPV  +P + +G S EH+   
Sbjct: 46  VAVLPVAAVEQHGPHLPLSVDATLLAGVIDAALPLLSADLPVLLLPPQNVGLSTEHLSYP 105

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+ A  I  W  +   I + G++K+++LN HGGN   + IV+ E R R  +LV  +
Sbjct: 106 GTLTLSPATLIALWTELGACIARAGVKKLLLLNGHGGNVAAMDIVARELRQRHGLLVYGS 165

Query: 143 SWSRFTIPQGIISFPETE--IGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           SW           F   E   GIHGGEIETSMML LAP  V+M+ A++F S   +    +
Sbjct: 166 SWFNLVDEANNARFAAQEHRFGIHGGEIETSMMLHLAPATVRMEHAQHFHSTSQDRAARY 225

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
             L    S   GW+++D NP G VGNA  AT  +G+ ++   A    QLL ++++ 
Sbjct: 226 GLLGNGKSAKMGWAIEDYNPAGAVGNAAAATATQGQAMVQAAARGLAQLLGELHAL 281


>gi|121607369|ref|YP_995176.1| creatininase [Verminephrobacter eiseniae EF01-2]
 gi|121552009|gb|ABM56158.1| Creatininase [Verminephrobacter eiseniae EF01-2]
          Length = 282

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 119/217 (54%), Gaps = 3/217 (1%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+ A EQHGPHLP++ D  +  G+ +     LP  LPV  +P + +G S EH+   
Sbjct: 34  VAVLPVAAIEQHGPHLPLSVDATLLQGVIDAALPQLPAGLPVLFLPPQNLGLSPEHLRFS 93

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+ A  I  W  I + + + G+RK+++ N HGG   ++ IV+ E R R  ++V   
Sbjct: 94  GTLTLSPATVIALWTEIGECVARAGVRKLLLFNGHGGQVSVMDIVARELRTRCDLIVYGA 153

Query: 143 SWSRFTIPQ---GIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           SW    +P    G  S  E   GIH GEIETSMML L+P  V+M+ A +F S        
Sbjct: 154 SWFSLPLPDAVAGQFSAQEHRFGIHAGEIETSMMLHLSPATVQMEQARDFRSSAQHRAGQ 213

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           +  L    +   GW M+D +P G VGNA  AT +KG 
Sbjct: 214 YAILGNGRTAKLGWQMQDYHPAGAVGNAAAATAEKGR 250


>gi|326319116|ref|YP_004236788.1| Creatininase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323375952|gb|ADX48221.1| Creatininase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 307

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 85/220 (38%), Positives = 124/220 (56%), Gaps = 3/220 (1%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+ A EQHGPHLP++ D  +  G+ +    +LPP LPV  +P + +G S EH    
Sbjct: 60  VAVLPVAAIEQHGPHLPLSVDAALLRGVIDAALPLLPPDLPVLFLPPQDVGLSTEHTAFP 119

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+ +  I  W  +   + + G++K+++ N HGG   ++ IV+ E R R  +LV S 
Sbjct: 120 GTLTLSPSTVIALWSELGACVARAGVKKLLLFNGHGGQVSVMDIVARELRQRHGLLVYSA 179

Query: 143 SWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           SW    +P   QG+ S  E   GIH G+IETSMML LAP+ V+M  A  F S   +    
Sbjct: 180 SWFSLPLPEAVQGLFSAEEHRFGIHAGQIETSMMLHLAPNTVRMAHAGRFRSTSQDRAER 239

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           +  L    S   GW+++D +P G VG+A  AT  KG  ++
Sbjct: 240 YAILGNGRSAKMGWAIEDYHPSGAVGDAAGATAGKGRAVV 279


>gi|310816505|ref|YP_003964469.1| creatininase subfamily [Ketogulonicigenium vulgare Y25]
 gi|308755240|gb|ADO43169.1| creatininase subfamily [Ketogulonicigenium vulgare Y25]
          Length = 261

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 132/235 (56%), Gaps = 1/235 (0%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           D + +LP+GA EQHGPHLP+NTD+++A  +A R+ +       V  +P   +  S EH++
Sbjct: 20  DAVALLPVGATEQHGPHLPLNTDSLLAEEMA-RLSAAHAASATVLILPTIAVAKSDEHIH 78

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT TL  A  +     I  ++ + GIR++V +NAHGGN P++ ++    R++  ML V
Sbjct: 79  FPGTLTLDGATLLAVLEQIGASVARAGIRRLVCINAHGGNVPVLQMLVRSLRIKHDMLAV 138

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           +  W     P+G +S  E   GIHGG +ET+ ML   P LV M  A++F    S      
Sbjct: 139 TAGWIGMGFPEGAVSPREQAEGIHGGLVETAAMLHFRPDLVDMTQAQHFVPASSAVAAQN 198

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
             LR  G+ + GW  +DL+P G  G+A  AT   G  L+++ A  F +LL+++ +
Sbjct: 199 TVLRMMGNVTTGWCAEDLHPAGAAGDAASATAALGAELVTHSAQRFGKLLDEVAA 253


>gi|319764563|ref|YP_004128500.1| creatininase [Alicycliphilus denitrificans BC]
 gi|330826779|ref|YP_004390082.1| Creatininase [Alicycliphilus denitrificans K601]
 gi|317119124|gb|ADV01613.1| Creatininase [Alicycliphilus denitrificans BC]
 gi|329312151|gb|AEB86566.1| Creatininase [Alicycliphilus denitrificans K601]
          Length = 285

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/208 (38%), Positives = 115/208 (55%), Gaps = 3/208 (1%)

Query: 32  EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAE 91
           EQHGPHLP++ D  +  G+      +LP  LP   +P + +G S EH+   GT TL+ A 
Sbjct: 46  EQHGPHLPLSVDATLLQGVIAAALPLLPDGLPALFLPPQNVGLSTEHLSYPGTLTLSPAT 105

Query: 92  AIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIP- 150
            I  W  + + + + G+RK+++LN HGGN   + IV+ E R R  +LV S+SW    +P 
Sbjct: 106 LIALWTELGECVARAGVRKLLLLNGHGGNVAPMDIVARELRQRCGLLVYSSSWFSLPLPD 165

Query: 151 --QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGS 208
              G+    E   GIHGG IETSMML LAP  V+M+ A ++ S   E    +  L    S
Sbjct: 166 EVNGLFGAEEHRFGIHGGAIETSMMLHLAPATVRMEHARHWPSSSQERAARYPILGNGRS 225

Query: 209 HSFGWSMKDLNPKGVVGNAMDATVKKGE 236
              GW+++D +P G VG+A  A   KG 
Sbjct: 226 AKLGWAIEDYHPAGAVGDAAGAMADKGR 253


>gi|163794375|ref|ZP_02188347.1| Creatininase [alpha proteobacterium BAL199]
 gi|159180543|gb|EDP65064.1| Creatininase [alpha proteobacterium BAL199]
          Length = 261

 Score =  139 bits (350), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 118/225 (52%)

Query: 32  EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAE 91
           EQHGPHLP+ TD I+  G+ +     LP  + V  +P + IG S EH    GT +     
Sbjct: 32  EQHGPHLPLGTDAILTDGVLDAALQCLPDTVDVLRLPTQRIGLSPEHANFAGTLSFDAET 91

Query: 92  AIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQ 151
            I  W AI  A+ + GIR++V+LN HGG +  V IV+   R  F M VV +++       
Sbjct: 92  LIAQWTAIGRAVARAGIRRLVLLNGHGGQTAPVDIVAMRLRSEFGMTVVRSTYFALIGEH 151

Query: 152 GIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSF 211
             I   E+  G HGG IET++MLA+ P LV++  A +F S   +       LR  G    
Sbjct: 152 PAIDARESAFGWHGGLIETALMLAIRPDLVRVGEAADFRSVAEDIAAEHSALRVEGETGL 211

Query: 212 GWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           GW  +DLN  G  GNA  ATV+ G  LL+  A     LL ++++F
Sbjct: 212 GWMAEDLNLSGATGNAAAATVEIGRTLLNQAAGRLGTLLAELHAF 256


>gi|241767792|ref|ZP_04765390.1| Creatininase [Acidovorax delafieldii 2AN]
 gi|241361169|gb|EER57807.1| Creatininase [Acidovorax delafieldii 2AN]
          Length = 245

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/235 (37%), Positives = 128/235 (54%), Gaps = 3/235 (1%)

Query: 30  AYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTY 89
           A EQHGPHLP++ D  +  G+ +    +LP  LP   +P + +G S EH+   GT TL+ 
Sbjct: 2   AIEQHGPHLPLSVDATLLQGVIDAALPLLPAALPALFLPPQVVGLSPEHIRFPGTLTLSP 61

Query: 90  AEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTI 149
           A  I  W  I + + + G++K+++LN HGG   ++ IV+ E R R  +LV S+SW    +
Sbjct: 62  ATVIALWTEIGECVARAGVKKLLLLNGHGGQVSVMDIVARELRTRSKLLVYSSSWFSLPL 121

Query: 150 PQ---GIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAH 206
           P    G  S  E   GIH GEIETSMML LAP  V MD A +F S   +    F  L   
Sbjct: 122 PDAVAGQFSAEEHRFGIHAGEIETSMMLHLAPATVHMDHARDFRSTSQDRAERFAILGNG 181

Query: 207 GSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
            S   GW M+D +  G VGNA  AT +KG  ++   A   ++LL +++   ++  
Sbjct: 182 KSAKLGWQMQDYHVAGAVGNAAAATAEKGRAVVEGAAQQLVRLLQELHDLSLATL 236


>gi|148242686|ref|YP_001227843.1| creatininase [Synechococcus sp. RCC307]
 gi|147850996|emb|CAK28490.1| Creatininase [Synechococcus sp. RCC307]
          Length = 266

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 125/238 (52%), Gaps = 12/238 (5%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VVLP+GA+EQHGPHLPM TD + A  + +R+ + LP  LP+  +P    G+S EH+   G
Sbjct: 23  VVLPVGAFEQHGPHLPMGTDLLFAEAVVDRVLAQLPAELPLWRLPAVAFGFSPEHLGFPG 82

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    +     I  A+ + G R++V+ N HGG   L+ + + + + +F  L V   
Sbjct: 83  TVSLSAEALLAQLQGIAAALSEAGFRRLVLFNGHGGQIALLQVAARQLQQQFPSLAV-LP 141

Query: 144 WSRFTIPQGI---ISFPETEIGIHGGEIETSMMLALAPHLV-KMDLAENFSSRQSEFLRN 199
           W  ++ P G+   I  PE   G+H G +ETS+MLAL P LV ++   E  +S  +     
Sbjct: 142 WFLWSGPPGVLEQIPEPERSQGLHAGRLETSLMLALHPELVGELPAGEAMASPPA----- 196

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
              L   G+    W  + L+  GVVG+   A+  +GE LL      + +L + +   D
Sbjct: 197 --GLSLEGAVPTAWRTRSLSNSGVVGDPAGASAAEGELLLQGLVGGWCELFDTLMRSD 252


>gi|67921761|ref|ZP_00515278.1| Creatininase [Crocosphaera watsonii WH 8501]
 gi|67856353|gb|EAM51595.1| Creatininase [Crocosphaera watsonii WH 8501]
          Length = 266

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 131/242 (54%), Gaps = 5/242 (2%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           + +++ ++V P+GA EQHGPHLP+  D  I+ G+  +    LPP +P   +P    G S 
Sbjct: 23  EDKENMVIVQPIGAIEQHGPHLPIAVDAAISLGVLGKALEKLPPEIPCYALPCLYYGKSN 82

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EH    GT TL+    I     +  +I + G RK++++N+HGG   ++ IV+ +   ++ 
Sbjct: 83  EHWGFPGTITLSANTLISVISEVAQSIYRSGFRKLILMNSHGGQPQIMDIVARDIHQKYQ 142

Query: 137 --MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
              L    +W    I + +++  E E GIH G+ ETS++LAL P  VKM  A        
Sbjct: 143 DFSLFPFFTWRVPNIAKELLTPQELEYGIHAGDAETSIILALLPDQVKMSQA---VKEYP 199

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           + L     +   G   F W  K+L+  GV+G+A  A+ +KG+ LL+  ++ ++Q++ D+ 
Sbjct: 200 QGLPEDSLVSMEGKLPFAWLTKELSKSGVMGDATVASKEKGDRLLASVSDGWVQVIKDVY 259

Query: 255 SF 256
           SF
Sbjct: 260 SF 261


>gi|332709220|ref|ZP_08429186.1| uncharacterized protein, putative amidase [Lyngbya majuscula 3L]
 gi|332352029|gb|EGJ31603.1| uncharacterized protein, putative amidase [Lyngbya majuscula 3L]
          Length = 269

 Score =  135 bits (339), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 135/257 (52%), Gaps = 10/257 (3%)

Query: 3   PLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + +TD   +P     +++ +++ P+ + EQHGPHLP+  D  I  G+  +    L P 
Sbjct: 12  PYLTWTDIEQMP----DKENVVIIQPVASIEQHGPHLPLIVDAAIGVGVLGKALGCLDPE 67

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P   +P    G S EH +  GT TL+    +   + + D+I + G RK+V++N+HGG  
Sbjct: 68  IPAYALPPLYYGKSNEHWHFPGTITLSAQTLLAVLMEMADSIYRCGFRKLVLMNSHGGQP 127

Query: 122 PLVSIVSTEARMRFSMLVVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
            ++ I + +   +    +V    +W    + + + +  E E+GIHGG++ETS+ML L P 
Sbjct: 128 QVMEIAARDIHHKHEDFMVFPLFTWGVPNMAKELATQKELELGIHGGDLETSLMLCLLPG 187

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            VKMD A        + L     L   G+ SF W  K L   GV+G+A  A+ +KG+ LL
Sbjct: 188 QVKMDRA---VKEYPQGLPEDSLLSMEGNLSFAWLTKGLTQSGVLGDATAASEEKGDRLL 244

Query: 240 SYFANCFIQLLNDINSF 256
           +   + ++ ++ DI  F
Sbjct: 245 ASLCDGWVNVIRDIYRF 261


>gi|110677921|ref|YP_680928.1| creatinine amidohydrolase [Roseobacter denitrificans OCh 114]
 gi|109454037|gb|ABG30242.1| creatinine amidohydrolase [Roseobacter denitrificans OCh 114]
          Length = 259

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 117/235 (49%), Gaps = 3/235 (1%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+GA EQHGPHL ++ D+ +   +  R +  +     V  +P   +  S EH    
Sbjct: 23  IAVLPMGASEQHGPHLAVSVDSDLVEAVLARTQ--VADGCTVLVLPTLRVTKSAEHDRHP 80

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +LT    +     I  ++ + GI ++ + N HGGN+ L+ +   + R+   M+ V  
Sbjct: 81  GTLSLTGDTLLAVLRDIAASVHRAGIDRLCLFNGHGGNTALLEVAVRDMRITHDMIAVHC 140

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W  F   Q         + +HGG+IETS MLA AP  V M  A +F     ++ + +  
Sbjct: 141 GWFGFAQAQAHFDAQALAMDVHGGDIETSAMLAAAPEKVDMAKARDFRPAMQDWPQKWIG 200

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
           L    +   GW + DLN  G  GNA  ATV+KGE LLS  A  F   L ++ +FD
Sbjct: 201 LTGQVARP-GWLIDDLNADGACGNAAAATVEKGEALLSSAARNFSDFLGELAAFD 254


>gi|86606203|ref|YP_474966.1| creatininase [Synechococcus sp. JA-3-3Ab]
 gi|86554745|gb|ABC99703.1| creatininase [Synechococcus sp. JA-3-3Ab]
          Length = 274

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 130/242 (53%), Gaps = 7/242 (2%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +++ +++ P+ + EQHGPHLP+  D  I   +  R    L P +P   +P +  G + EH
Sbjct: 25  KENVVIIQPVASIEQHGPHLPLVVDACIGTAIIGRAMEKLEPEIPAYVLPTQCYGKANEH 84

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS-- 136
            +  GT TL+    +     + ++I + G RK+V LN+HGG   ++ IV+ +   ++   
Sbjct: 85  WHFPGTITLSAQTLMAVLTEVAESIYRAGFRKLVFLNSHGGQPEVLQIVARDLHQKYEDF 144

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD-LAENFSSRQSE 195
           +L   + W      Q +++  E E+GIH G+ ETSM++ L P  V+ D L   + S    
Sbjct: 145 LLFPVSVWRVPHQGQELMTAKEQELGIHAGDGETSMLMYLLPETVRTDRLVCEYPSD--- 201

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
            L     L   G  SF W+ +DL+  GV+G+A  AT +KG+ L+   A+ +++L+ D++ 
Sbjct: 202 -LPQDSLLSLEGRISFAWTTRDLSRSGVLGDATAATPEKGKLLVESMADGWVRLIRDLHK 260

Query: 256 FD 257
           F 
Sbjct: 261 FQ 262


>gi|254414331|ref|ZP_05028098.1| creatininase subfamily [Microcoleus chthonoplastes PCC 7420]
 gi|196179006|gb|EDX74003.1| creatininase subfamily [Microcoleus chthonoplastes PCC 7420]
          Length = 267

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 138/257 (53%), Gaps = 10/257 (3%)

Query: 3   PLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + +TD  ++P     +++ +++ P+GA EQHG HLP+  D+ I  G+  +  + L P 
Sbjct: 12  PYLTWTDIQTIP----DKENVVIIQPVGAIEQHGHHLPLVVDSAIGVGVLGKALAQLEPT 67

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P   +P    G S EH +  GT TL+    +   + + D+I + G RK+V++N+HGG  
Sbjct: 68  IPAYALPNLFYGKSNEHWHFPGTITLSAQTLLAVLMEVADSIYRAGFRKLVLMNSHGGQP 127

Query: 122 PLVSIVSTEARMRFSMLVVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
            ++ I + +   ++   +V    +W    + + +IS  E E+GIH G+ ETS+ML+L P 
Sbjct: 128 QIMEIAARDIHQKYGDFLVFPLFTWRVPNVAKELISAKELELGIHAGDAETSLMLSLLPE 187

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            VKM+ A    +   + L     L   G   F W  ++L+  G +G+   AT +KG+ +L
Sbjct: 188 QVKMERA---VAEYPQGLPEDSLLSMEGKLPFAWLTQELSQSGTLGDPTPATKEKGDRIL 244

Query: 240 SYFANCFIQLLNDINSF 256
               + +++++ DI  F
Sbjct: 245 ESLVSGWVKVIQDIYRF 261


>gi|206576363|ref|YP_002238129.1| creatininase [Klebsiella pneumoniae 342]
 gi|206565421|gb|ACI07197.1| creatininase [Klebsiella pneumoniae 342]
          Length = 293

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 136/257 (52%), Gaps = 16/257 (6%)

Query: 3   PLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + +TD  +LP     + + ++VLP GA EQHGPHLP + D++I++G+A    + LP  
Sbjct: 13  PFLSWTDVAALP----DKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARLPAA 68

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HGG  
Sbjct: 69  IPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTVLEIAESLYRAGFRKLLMINGHGGQP 128

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAP 178
            ++ I   E R+R     ++     F +P   +  +S  E  + +H G  ET++MLALAP
Sbjct: 129 QILQIACREMRLRHGDF-IAIPHDVFNVPNCEKQFLSPHEQRMAMHAGHSETALMLALAP 187

Query: 179 HLVKMDLAENFSSRQSEFLRNFKY-LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
             V M+ A       + F   F     + G  +  W+  D  P GV+G+   AT ++GEG
Sbjct: 188 ECVHMERA------AANFPPEFPCPTLSKGRPAAAWASYDFGPSGVIGDPTPATREQGEG 241

Query: 238 LLSYFANCFIQLLNDIN 254
           LL   A  + Q + +I+
Sbjct: 242 LLDSLAASWAQAIIEIH 258


>gi|255080566|ref|XP_002503863.1| predicted protein [Micromonas sp. RCC299]
 gi|226519130|gb|ACO65121.1| predicted protein [Micromonas sp. RCC299]
          Length = 850

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 84/241 (34%), Positives = 125/241 (51%), Gaps = 8/241 (3%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           D + VLPLGA E HGPHLP+  D++  A L  R   ++   + V  +P   IG S EH  
Sbjct: 590 DAVAVLPLGATEAHGPHLPLGVDSMHNAALLARALELVRHDVRVLALPPLDIGVSCEHGG 649

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM--- 137
             GT  +    A + W  I   + + GIRK+++ N+HGGN  L  +V+   R+R  M   
Sbjct: 650 FAGTVGIAPETAAKQWEEIGACVARAGIRKLILYNSHGGNHALAEVVARRLRLRHRMIAA 709

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
           L ++ +         +    E   GIHGG +ETS+M+ L P LV    A +F+S  ++  
Sbjct: 710 LALNLAMDDDGCAGALFPTDELRFGIHGGSLETSVMMHLRPELVDASKAAHFASSAAQM- 768

Query: 198 RNFKYLRAHG---SHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
              K L+ H        GW+ +DLNP GVVG+A DAT  KG  L+   A    +L+ +++
Sbjct: 769 -GGKTLQRHALGFGVKTGWASQDLNPHGVVGDASDATDSKGAKLVESSARGLARLIEEMH 827

Query: 255 S 255
           +
Sbjct: 828 A 828


>gi|262041751|ref|ZP_06014939.1| creatininase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|259040883|gb|EEW41966.1| creatininase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
          Length = 293

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 137/257 (53%), Gaps = 16/257 (6%)

Query: 3   PLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + +TD  +LP     + + ++VLP GA EQHGPHLP + D++I++G+A    + LP  
Sbjct: 13  PFLSWTDVAALP----DKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARLPAT 68

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HGG  
Sbjct: 69  IPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTLLEIAESLYRAGFRKLLMINGHGGQP 128

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAP 178
            ++ I   E R+R     ++     F +P   +  +S  E  + +H G  ET++MLALAP
Sbjct: 129 QILQIACREMRLRHGDF-IAIPHDVFNVPNCEKQFLSPHEQRMAMHAGHSETALMLALAP 187

Query: 179 HLVKMDLAENFSSRQSEFLRNFKY-LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
             V M+ A       + F   F     + G  +  W+  D  P GV+G+   AT ++GEG
Sbjct: 188 ECVHMERA------VANFPPEFPCPTLSKGRPAAAWASYDFGPSGVIGDPTPATREQGEG 241

Query: 238 LLSYFANCFIQLLNDIN 254
           LL+  A  + Q + +I+
Sbjct: 242 LLNSLAASWAQAIIEIH 258


>gi|330015328|ref|ZP_08308145.1| creatininase [Klebsiella sp. MS 92-3]
 gi|328531813|gb|EGF58638.1| creatininase [Klebsiella sp. MS 92-3]
          Length = 293

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 136/257 (52%), Gaps = 16/257 (6%)

Query: 3   PLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + +TD  +LP     + + ++VLP GA EQHGPHLP + D++I++G+A    + LP  
Sbjct: 13  PFLSWTDVAALP----DKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARLPAT 68

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HGG  
Sbjct: 69  IPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTLLEIAESLYRAGFRKLLMINGHGGQP 128

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAP 178
            ++ I   E R+R     ++     F +P   +  +S  E  + +H G  ET++MLALAP
Sbjct: 129 QILQIACREMRLRHGDF-IAIPHDVFNVPNCEKQFLSPHEQRMAMHAGHSETALMLALAP 187

Query: 179 HLVKMDLAENFSSRQSEFLRNFKY-LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
             V M+ A       + F   F     + G  +  W+  D  P GV+G+   AT ++GEG
Sbjct: 188 ECVHMERA------VANFPPEFPCPTLSKGRPAAAWASYDFGPSGVIGDPTPATREQGEG 241

Query: 238 LLSYFANCFIQLLNDIN 254
           LL   A  + Q + +I+
Sbjct: 242 LLDSLAASWAQAIIEIH 258


>gi|288935107|ref|YP_003439166.1| creatinase [Klebsiella variicola At-22]
 gi|288889816|gb|ADC58134.1| Creatininase [Klebsiella variicola At-22]
          Length = 293

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 136/257 (52%), Gaps = 16/257 (6%)

Query: 3   PLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + +TD  +LP     + + ++VLP GA EQHGPHLP + D++I++G+A    + LP  
Sbjct: 13  PFLSWTDVAALP----DKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARLPAA 68

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HGG  
Sbjct: 69  IPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTLLEIAESLYRAGFRKLLMINGHGGQP 128

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAP 178
            ++ I   E R+R     ++     F +P   +  +S  E  + +H G  ET++MLALAP
Sbjct: 129 QILQIACREMRLRHGDF-IAIPHDVFNVPNCEKQFLSPHEQRMAMHAGHSETALMLALAP 187

Query: 179 HLVKMDLAENFSSRQSEFLRNFKY-LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
             V M+ A       + F   F     + G  +  W+  D  P GV+G+   AT ++GEG
Sbjct: 188 ECVHMERA------VANFPPEFPCPTLSKGRPAAAWASYDFGPSGVIGDPTPATREQGEG 241

Query: 238 LLSYFANCFIQLLNDIN 254
           LL   A  + Q + +I+
Sbjct: 242 LLDSLAASWAQAIIEIH 258


>gi|238895081|ref|YP_002919816.1| putative creatininase [Klebsiella pneumoniae NTUH-K2044]
 gi|238547398|dbj|BAH63749.1| putative creatininase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 292

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 136/257 (52%), Gaps = 16/257 (6%)

Query: 3   PLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + +TD  +LP     + + ++VLP GA EQHGPHLP + D++I++G+A    + LP  
Sbjct: 12  PFLSWTDVAALP----DKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARLPAT 67

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HGG  
Sbjct: 68  IPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTLLEIAESLYRAGFRKLLMINGHGGQP 127

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAP 178
            ++ I   E R+R     ++     F +P   +  +S  E  + +H G  ET++MLALAP
Sbjct: 128 QILQIACREMRLRHGDF-IAIPHDVFNVPNCEKQFLSPHEQRMAMHAGHSETALMLALAP 186

Query: 179 HLVKMDLAENFSSRQSEFLRNFKY-LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
             V M+ A       + F   F     + G  +  W+  D  P GV+G+   AT ++GEG
Sbjct: 187 ECVHMERA------VANFPPEFPCPTLSKGRPAAAWASYDFGPSGVIGDPTPATREQGEG 240

Query: 238 LLSYFANCFIQLLNDIN 254
           LL   A  + Q + +I+
Sbjct: 241 LLDSLAASWAQAIIEIH 257


>gi|152970587|ref|YP_001335696.1| putative creatininase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150955436|gb|ABR77466.1| putative creatininase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
          Length = 293

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 136/257 (52%), Gaps = 16/257 (6%)

Query: 3   PLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + +TD  +LP     + + ++VLP GA EQHGPHLP + D++I++G+A    + LP  
Sbjct: 13  PFLSWTDVAALP----DKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARLPAT 68

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HGG  
Sbjct: 69  IPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTLLEIAESLYRAGFRKLMMINGHGGQP 128

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAP 178
            ++ I   E R+R     ++     F +P   +  +S  E  + +H G  ET++MLALAP
Sbjct: 129 QILQIACREMRLRHGDF-IAIPHDVFNVPNCEKQFLSPHEQRMAMHAGHSETALMLALAP 187

Query: 179 HLVKMDLAENFSSRQSEFLRNFKY-LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
             V M+ A       + F   F     + G  +  W+  D  P GV+G+   AT ++GEG
Sbjct: 188 ECVHMERA------VANFPPEFPCPTLSKGRPAAAWASYDFGPSGVIGDPTPATREQGEG 241

Query: 238 LLSYFANCFIQLLNDIN 254
           LL   A  + Q + +I+
Sbjct: 242 LLDSLAASWAQAIIEIH 258


>gi|290509177|ref|ZP_06548548.1| creatininase [Klebsiella sp. 1_1_55]
 gi|289778571|gb|EFD86568.1| creatininase [Klebsiella sp. 1_1_55]
          Length = 293

 Score =  131 bits (330), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 136/257 (52%), Gaps = 16/257 (6%)

Query: 3   PLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + +TD  +LP     + + ++VLP GA EQHGPHLP + D++I++G+A    + LP  
Sbjct: 13  PFLSWTDVAALP----DKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARLPAA 68

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HGG  
Sbjct: 69  IPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTLLEIAESLYRAGFRKLLMINGHGGQP 128

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAP 178
            ++ I   E R+R     ++     F +P   +  +S  E  + +H G  ET++MLALAP
Sbjct: 129 QILQIACREMRLRHGDF-IAIPHDVFNVPNCEKQFLSPHEQRMTMHAGHSETALMLALAP 187

Query: 179 HLVKMDLAENFSSRQSEFLRNFKY-LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
             V M+ A       + F   F     + G  +  W+  D  P GV+G+   AT ++GEG
Sbjct: 188 ECVHMERA------VANFPPEFPCPTLSKGRPAAAWASYDFGPSGVIGDPTPATREQGEG 241

Query: 238 LLSYFANCFIQLLNDIN 254
           LL   A  + Q + +I+
Sbjct: 242 LLDSLAASWAQAIIEIH 258


>gi|239817718|ref|YP_002946628.1| Creatininase [Variovorax paradoxus S110]
 gi|239804295|gb|ACS21362.1| Creatininase [Variovorax paradoxus S110]
          Length = 287

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 130/250 (52%), Gaps = 26/250 (10%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R++ ++VLP GA EQHGPHLP + D++IA+G+  +    LP  +    +P    G S EH
Sbjct: 26  RENTVIVLPCGAIEQHGPHLPCSVDSVIASGVMGKALEKLPAEVRAFALPTITYGKSEEH 85

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
           ++  GT TLT    +     I +++ + G RK++  N HGG   ++ + + E R+R    
Sbjct: 86  LHFPGTMTLTGTTLLSTVTEIGESVYRAGFRKLLFANGHGGQPQVLEMAARELRLRHGDF 145

Query: 139 VVSTSWSRFTIPQGIISFP----------ETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
           VV        +P G+   P          E ++ +H G  ET++MLALAP  V M+ A  
Sbjct: 146 VV--------VPHGVSRLPNASSRQISEQEKKLSMHAGHSETALMLALAPDTVHMERA-- 195

Query: 189 FSSRQSEFLRNF--KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                + F   F  K L A G  +  W+ +D  P GV+G+   AT ++G+ +L   ++ +
Sbjct: 196 ----AANFPPPFPIKLLSADGRPACAWTARDFGPSGVIGDPTSATREQGQEILDTLSDSW 251

Query: 247 IQLLNDINSF 256
           +Q L ++++ 
Sbjct: 252 VQALTELHAL 261


>gi|119510979|ref|ZP_01630100.1| Creatininase [Nodularia spumigena CCY9414]
 gi|119464324|gb|EAW45240.1| Creatininase [Nodularia spumigena CCY9414]
          Length = 267

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 139/259 (53%), Gaps = 12/259 (4%)

Query: 3   PLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + +TD  ++P     +++ +++ P+GA EQHGPHLP+  D  I  G+       L  R
Sbjct: 12  PYLTWTDIQAMP----DKENVVIIQPVGAIEQHGPHLPLIVDAAIGVGVLGAALKKLDVR 67

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P   +P    G S EH +  GT TL+        + + ++I + G RK+V++N+HGG  
Sbjct: 68  IPAYALPTLYYGKSNEHWHFPGTITLSTQTLTAIIMEMGESIYRAGFRKLVLMNSHGGQP 127

Query: 122 PLVSIVSTEARMRFSMLVVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
            ++ +V+ +  +++   +V    +W    I + +++  E   G+H G+ ETS+MLA+ P 
Sbjct: 128 QVMQMVARDLHIQYDDFLVFPLFTWRVPHITKELLTPKEATQGMHAGDAETSIMLAILPE 187

Query: 180 LVKMDLA-ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            VKMDLA   +   Q +       L   G     W+ +D++  GV+G+A  AT +KG+ +
Sbjct: 188 QVKMDLAVAEYPPEQPQ----SSLLSLEGKLPVSWATRDVSKSGVIGDATTATKEKGDRI 243

Query: 239 LSYFANCFIQLLNDINSFD 257
           L   ++ ++Q + DI +F 
Sbjct: 244 LESVSDGWVQAIQDIYAFQ 262


>gi|257061874|ref|YP_003139762.1| creatininase [Cyanothece sp. PCC 8802]
 gi|256592040|gb|ACV02927.1| Creatininase [Cyanothece sp. PCC 8802]
          Length = 267

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 124/236 (52%), Gaps = 5/236 (2%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +++ P+G+ EQHG HLP+  D+ I  G+  +    L P +P   +P    G S EH +  
Sbjct: 30  VIIQPVGSIEQHGYHLPIIVDSAIGMGVLGKALEKLKPEIPAYSLPCLYYGKSNEHWHFP 89

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+    +   + + D + + G RK+V++N+HGG   ++ I + +   ++   +V  
Sbjct: 90  GTITLSATTLLSILMEVADNLYRSGFRKLVLMNSHGGQPQIMEIAARDIHQKYEDFLVFP 149

Query: 143 --SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
             +W    I   +++  E E GIH G+ ETS++L+L P+ V M+ A        + L   
Sbjct: 150 LFTWRVPNIASELLTEKELEYGIHAGDAETSLLLSLLPNQVNMEKA---VKEYPQGLPEN 206

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
             L   G   F W  K+L   GV+G+A  AT +KG+ LL   ++ ++QL+ +I  F
Sbjct: 207 SLLSMEGKLPFAWLTKELTKSGVMGDATVATKEKGDKLLESLSDSWVQLIENIYQF 262


>gi|218248815|ref|YP_002374186.1| Creatininase [Cyanothece sp. PCC 8801]
 gi|218169293|gb|ACK68030.1| Creatininase [Cyanothece sp. PCC 8801]
          Length = 267

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 125/241 (51%), Gaps = 5/241 (2%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +++ P+G+ EQHG HLP+  D+ I  G+  +    L P +P   +P    G S EH +  
Sbjct: 30  VIIQPVGSIEQHGYHLPIIVDSAIGMGVLGKALEKLKPEIPAYSLPCLYYGKSNEHWHFP 89

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+    +   + + D + + G RK+V++N+HGG   ++ I + +   ++   +V  
Sbjct: 90  GTITLSATTLLTILMEVADNLYRSGFRKLVLMNSHGGQPQIMEIAARDIHQKYEDFLVFP 149

Query: 143 --SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
             +W    I   +++  E E GIH G+ ETS++L+L P+ V M+ A        + L   
Sbjct: 150 LFTWRVPNIASELLTEKELEYGIHAGDAETSLLLSLLPNQVNMEKA---VKEYPQGLPEN 206

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
             L   G   F W  K+L   GV+G+A  AT +KG+ LL   ++ ++QL+ +I  F    
Sbjct: 207 SLLSMEGKLPFAWLTKELTKSGVMGDATVATKEKGDKLLESLSDSWVQLIENIYQFRQPQ 266

Query: 261 F 261
           F
Sbjct: 267 F 267


>gi|113474118|ref|YP_720179.1| creatininase [Trichodesmium erythraeum IMS101]
 gi|110165166|gb|ABG49706.1| Creatininase [Trichodesmium erythraeum IMS101]
          Length = 267

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 127/240 (52%), Gaps = 5/240 (2%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +++ +++ P+G+ EQHG HLP+  D+ IA  +  +    L   +P   +P +  G S EH
Sbjct: 25  KENVVIIQPVGSIEQHGLHLPLIVDSAIATYVTGKALEKLEKNIPAYALPTQYYGKSNEH 84

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS-- 136
            +  GT TL     +       +++ + G RK+V LNAHGG   ++ IV+ +   ++   
Sbjct: 85  WHFPGTITLCAQTLMAILTETGESLYRAGFRKLVFLNAHGGQPQVLKIVARDLHQKYEDF 144

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           +L   ++W      Q +++  E E+GIH G+ ETS+ML++ P +VKMD A        + 
Sbjct: 145 LLFPLSAWRVPNPCQELLTEKEMELGIHAGDAETSVMLSMLPDVVKMDKA---VCEYPQG 201

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           L     L   G  SF W  ++L   GV+G+A  AT +KG+ +L    N + +L+ D+  F
Sbjct: 202 LPEESMLSMEGKLSFAWLTRELTHSGVLGDATVATKEKGDHILDGLTNSWAKLIRDLYKF 261


>gi|291561898|emb|CBL40701.1| Uncharacterized protein, putative amidase [butyrate-producing
           bacterium SS3/4]
          Length = 264

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 84/248 (33%), Positives = 121/248 (48%), Gaps = 13/248 (5%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP---PRLPVTCMPVEPIGYS 75
           + + +V++P+GA EQHG   P+ TD IIA G A RIK  L    P  P+   P+ P+G S
Sbjct: 18  KDETVVMIPVGALEQHGNQCPLGTDEIIAEGTARRIKEALDREIPDYPMLIFPLIPVGLS 77

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            EH+   G+ TL           I   +   G RKI ILN HGGNSP++ ++S E R   
Sbjct: 78  TEHVNFCGSVTLKPDTFYHVLYDICKGLAHHGFRKIAILNCHGGNSPIIQVLSREVRSEL 137

Query: 136 SMLVVSTSWSRFTIPQGI--ISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
            + V   +   F   Q +     P      HGGE+ETSM+LA  P  VK++ +E    R+
Sbjct: 138 GIAVFIINCGAFFGNQAVKDTVTPGNIWDFHGGEMETSMVLAERPETVKLETSEAGIPRK 197

Query: 194 SEFLRNFKYLRAHGSHSFG-----WSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
             F+ N K    +G  + G     W  +D  P G+ G+   AT +KG  +   F    + 
Sbjct: 198 --FMGN-KTFTVYGPITLGWVSEEWETEDGKPIGIGGDPSGATAEKGSQIYDSFVESILS 254

Query: 249 LLNDINSF 256
            L +I  +
Sbjct: 255 GLKEIRKW 262


>gi|86608888|ref|YP_477650.1| creatininase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557430|gb|ABD02387.1| creatininase [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 274

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 124/241 (51%), Gaps = 5/241 (2%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +++ +++ P+ + EQHGPHLP+  D  I   +  R    L P +P   +P +  G + EH
Sbjct: 25  KENVVIIQPVASIEQHGPHLPLVVDACIGTAIIGRAMEKLEPEIPAYVLPTQCYGKANEH 84

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS-- 136
            +  GT TL+    +     + ++I + G RK+V LN+HGG   ++ IV+ +   ++   
Sbjct: 85  WHFPGTITLSAQTLMAVLTEVAESIYRAGFRKLVFLNSHGGQPQVLEIVARDLHQKYEDF 144

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML   + W      + + +  E E+GIH G+ ETSM++ L P  V+ D            
Sbjct: 145 MLFPVSVWRVPHEGRELFTEKERELGIHAGDGETSMLMHLLPDTVRTD---RLVCEYPHD 201

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           L     L   G   F W+ +DL   GV+G+A  AT +KG+ L+   ++ +++L+ D++ F
Sbjct: 202 LPENSLLSMEGRIPFAWATRDLTQSGVLGDATAATPEKGKVLVESMSDGWVRLIRDLHRF 261

Query: 257 D 257
            
Sbjct: 262 Q 262


>gi|319796040|ref|YP_004157680.1| creatininase [Variovorax paradoxus EPS]
 gi|315598503|gb|ADU39569.1| Creatininase [Variovorax paradoxus EPS]
          Length = 287

 Score =  128 bits (322), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 128/250 (51%), Gaps = 26/250 (10%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R++ ++VLP GA EQHGPHLP + D++IA+G+  R    LP  +    +P    G S EH
Sbjct: 26  RENTVIVLPCGAIEQHGPHLPCSVDSVIASGVMGRALEKLPAEVRAFALPTITYGKSEEH 85

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
           ++  GT TLT    +     I +++ + G RK++  N HGG   ++ + + E R+R    
Sbjct: 86  LHFPGTMTLTGTTLLSTVTEIGESVYRAGFRKLLFANGHGGQPQVLEMAARELRLRHGDF 145

Query: 139 VVSTSWSRFTIPQGIISFP----------ETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
           V+        +P G+   P          E  + +H G  ET++MLALAP  V M+ A  
Sbjct: 146 VI--------VPHGVSRLPNASSKQISEQEKRLSMHAGHSETALMLALAPDTVHMERA-- 195

Query: 189 FSSRQSEFLRNF--KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                + F   F  K L A G  +  W+ +D  P GV+G+   AT ++G  +L   ++ +
Sbjct: 196 ----AANFPPPFPIKLLSADGRPACAWTARDFGPSGVIGDPTSATREQGIEILETLSDSW 251

Query: 247 IQLLNDINSF 256
           +Q L ++++ 
Sbjct: 252 VQALTELHAL 261


>gi|221198868|ref|ZP_03571913.1| creatininase [Burkholderia multivorans CGD2M]
 gi|221205128|ref|ZP_03578144.1| creatininase [Burkholderia multivorans CGD2]
 gi|221174919|gb|EEE07350.1| creatininase [Burkholderia multivorans CGD2]
 gi|221181319|gb|EEE13721.1| creatininase [Burkholderia multivorans CGD2M]
          Length = 282

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/262 (30%), Positives = 140/262 (53%), Gaps = 27/262 (10%)

Query: 3   PLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + +TD ++LP     R++ ++VLP GA EQHGPHLP   D+I+AAG+     + + P+
Sbjct: 13  PYLTWTDIDALP----DRENTVIVLPAGAIEQHGPHLPCAVDSIVAAGVVGHALARVDPQ 68

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P   +P    G S EH++  GT TLT    +   + I +++ + G RK+VI+NAHGG  
Sbjct: 69  VPAYALPPITYGKSDEHLHFPGTVTLTGELLLGTAIEIGESVYRAGFRKLVIVNAHGGQP 128

Query: 122 PLVSIVSTEARMRFS--MLVVSTSWSRFTIPQG--IISFPETEIGIHGGEIETSMMLALA 177
             + + + E R+R    +++V ++WS   +P     +S  E  + +H G  E+++++ALA
Sbjct: 129 QPLEMAARELRLRHGDFVIIVRSAWS---VPHEAHFMSDAERRLSMHAGHGESALLMALA 185

Query: 178 PHLVKMDLA-----ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATV 232
           P  V ++ A     E F               + G  +  W  +D  P GV+G+   AT 
Sbjct: 186 PDTVFIERAVANMPEPFPCPTL----------SSGRPAAAWCARDFGPSGVIGDPRGATR 235

Query: 233 KKGEGLLSYFANCFIQLLNDIN 254
           ++GE LL   +  + + + +++
Sbjct: 236 EQGELLLEQLSTSWAKAIGEVH 257


>gi|218438486|ref|YP_002376815.1| creatininase [Cyanothece sp. PCC 7424]
 gi|218171214|gb|ACK69947.1| Creatininase [Cyanothece sp. PCC 7424]
          Length = 270

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 129/240 (53%), Gaps = 5/240 (2%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +++ +++ P+GA EQHGPHLP+  D+ I+ G+  +    L   +P   +P    G S EH
Sbjct: 26  KENVVIIQPVGAIEQHGPHLPIIVDSAISMGVLGKALLKLDSHIPAYALPCLYYGKSNEH 85

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
            +  GT TL+    +     + +++ + G RK+V++N+HGG   ++ I + +    +   
Sbjct: 86  WHFPGTITLSAETLLSVIKEMAESLYRSGFRKLVLMNSHGGQPQIMEIAARDIHQEYQDF 145

Query: 139 VVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           +V    +W    + + +++  E E GIH G+ ETS++L+L P  VKM+ A        + 
Sbjct: 146 LVFPLFTWRVPHVAKELLTPEEIEFGIHAGDAETSIILSLLPDQVKMERA---VKEYPQG 202

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           L +   L   G   F W   +L+  GV+G+A  AT +KGE LL   ++ ++Q++ D+  F
Sbjct: 203 LPSESLLSMEGKLPFAWLTAELSKSGVMGDATTATREKGERLLESVSDGWVQVIKDVYKF 262


>gi|166368413|ref|YP_001660686.1| creatininase [Microcystis aeruginosa NIES-843]
 gi|166090786|dbj|BAG05494.1| creatininase [Microcystis aeruginosa NIES-843]
          Length = 268

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/261 (30%), Positives = 140/261 (53%), Gaps = 18/261 (6%)

Query: 3   PLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + +TD +S+P     +++ +++ P+GA EQHGPHLP+  D  I+ G+  +    L   
Sbjct: 13  PYLTWTDIDSMP----DKENVVIIQPIGAIEQHGPHLPIAVDAAISLGVLGKAFEKLDTN 68

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +    +P    G S EH    GT TL+ A  +     I +++ + G RK+V++N+HGG  
Sbjct: 69  IAAFALPCLYYGKSNEHWSFPGTITLSAATLLTLIQEIAESLYRSGFRKLVLMNSHGGQP 128

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQG---IISFPETEIGIHGGEIETSMMLALAP 178
            ++ I + +   ++   +V   ++ + +P     + S  E E GIH G++ETS+ML+L P
Sbjct: 129 QVMEIAARDIHQQYPDFLVFPFFT-WRVPHNAAELFSEYELEYGIHAGDVETSIMLSLLP 187

Query: 179 HLVKMDLAENFSSRQSEFLRNF---KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
             VK++ A        E+ + +     L   G   F W  K+L   GV+G+A +A+ +KG
Sbjct: 188 EQVKIERAVR------EYPQGWPENSLLTMEGKLPFAWLTKELTKSGVMGDATNASKEKG 241

Query: 236 EGLLSYFANCFIQLLNDINSF 256
           + LL   AN ++Q++ D+  F
Sbjct: 242 DRLLESVANGWVQVIADVYQF 262


>gi|159027358|emb|CAO90544.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 267

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 129/241 (53%), Gaps = 7/241 (2%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +++ +++ P+GA EQHGPHLP+  D  I+ G+  +    L   +P   +P    G S EH
Sbjct: 25  KENVVIIQPIGAIEQHGPHLPIAVDAAISLGVLGKAFEKLNTNVPAFALPCLYYGKSNEH 84

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT TL+ A  +     I +++ + G RK+V++N+HGG   ++ I + +   ++   
Sbjct: 85  WSFPGTITLSGATLLTLIQEIAESLYRSGFRKLVLMNSHGGQPQVMEIAARDIHQQYPDF 144

Query: 139 VVSTSWSRFTIPQG---IISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
           +V   ++ + +P     + S  E E GIH G++ETS+ML+L P  VK++ A        +
Sbjct: 145 LVFPFFT-WRVPHNAAELFSEYELEYGIHAGDVETSIMLSLLPEQVKIERA---VREYPQ 200

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
            L     L   G   F W  K+L   GV+G+A +A+ +KG+ LL   AN ++Q + D+  
Sbjct: 201 GLPENSLLTMEGKLPFAWLTKELTKSGVMGDATNASKEKGDRLLESVANGWVQAIIDVYR 260

Query: 256 F 256
           F
Sbjct: 261 F 261


>gi|209523828|ref|ZP_03272381.1| Creatininase [Arthrospira maxima CS-328]
 gi|209495860|gb|EDZ96162.1| Creatininase [Arthrospira maxima CS-328]
          Length = 272

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 123/243 (50%), Gaps = 19/243 (7%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +++ P+GA EQHGPHLP+  D  IA  +       L   +P   +     G S EH +  
Sbjct: 29  VIIQPIGAIEQHGPHLPLIVDAAIATAVTGLALEKLDRTIPAYALSTLYYGKSNEHWHFP 88

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST------EARMRFS 136
           GT TLT    I   + + ++I + G RK+V LNAHGG   ++ +V+       E  M F 
Sbjct: 89  GTITLTSETLISVLMEVGESIYRAGFRKLVFLNAHGGQPQILDMVARDLHQQHEDFMVFP 148

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           + V    W    I + + S  E E+GIH G+IETS+ML++ P +V+ D A        EF
Sbjct: 149 LFV----WRVPHIAKELFSPEELELGIHAGDIETSVMLSILPDVVRRDKAVR------EF 198

Query: 197 ---LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
              L +   L   G   F W  +DL+  GV+G+A  AT +KG  LL    + +++ + DI
Sbjct: 199 PHGLPSDSLLSMEGKLPFAWVTRDLSASGVLGDATAATEEKGSRLLESVVDSWVKAIADI 258

Query: 254 NSF 256
             F
Sbjct: 259 YKF 261


>gi|307154149|ref|YP_003889533.1| Creatininase [Cyanothece sp. PCC 7822]
 gi|306984377|gb|ADN16258.1| Creatininase [Cyanothece sp. PCC 7822]
          Length = 270

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 135/257 (52%), Gaps = 10/257 (3%)

Query: 3   PLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + +TD  ++P     +++ +++ P+GA EQHGPHLP+  D+ I+ G+  +    L   
Sbjct: 13  PYLTWTDIQAMP----DKENVVIIQPVGAIEQHGPHLPIIVDSAISMGVLGKALLKLDAE 68

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P   +P    G S EH +  GT TL+    +     +  ++ + G RK+V++N+HGG  
Sbjct: 69  IPAYALPCLYYGKSNEHWHFPGTITLSAQTLLSVIQEMAQSLYRSGFRKLVLMNSHGGQP 128

Query: 122 PLVSIVSTEARMRFSMLVVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
            ++ I + +   ++    V    +W    I + +++  E E GIH G+ ETS++L+L P 
Sbjct: 129 QIMEIAARDLHQQYPDFSVFPLFTWRVPHIAKELLTPQELEYGIHAGDAETSILLSLLPE 188

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            VKMD A        + L     L   G   F W   +L+  GV+G+A  A+ +KG+ LL
Sbjct: 189 QVKMDQA---VKEYPQGLPADSLLSMEGKLPFAWLTAELSQSGVMGDATAASREKGDRLL 245

Query: 240 SYFANCFIQLLNDINSF 256
              +N ++Q++ D+  F
Sbjct: 246 ESVSNGWVQVIKDVYQF 262


>gi|284052490|ref|ZP_06382700.1| Creatininase [Arthrospira platensis str. Paraca]
 gi|291569639|dbj|BAI91911.1| creatininase [Arthrospira platensis NIES-39]
          Length = 272

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 126/252 (50%), Gaps = 27/252 (10%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R++ +++ P+GA EQHGPHLP+  D  IA  +  +    L   +P   +     G S EH
Sbjct: 25  RENTVIIQPIGAIEQHGPHLPLIVDAAIATAVTGKALEKLDRTIPAYALSTLYYGKSNEH 84

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST------EAR 132
            +  GT TLT    +   + + ++I + G RK+V +NAHGG   ++ +V+       E  
Sbjct: 85  WHFPGTITLTSETLMSVLMEVGESIYRAGFRKLVFVNAHGGQPQILEMVARDLHQQHEDF 144

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
           M F + V    W    I + + S  E E+GIH G+IETS+ML++ P +V          R
Sbjct: 145 MVFPLFV----WRVPHIAKELFSPEELELGIHAGDIETSVMLSILPDVV----------R 190

Query: 193 QSEFLRNFKY-------LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
           + + +R F +       L   G   F W  +DL+  GV+G+A  AT  KG  LL    + 
Sbjct: 191 REKVVREFPHGLPSDSLLSMEGKLPFAWVTRDLSASGVLGDATAATEDKGTRLLESVVDS 250

Query: 246 FIQLLNDINSFD 257
           +++ + DI  F 
Sbjct: 251 WVKAIADIYKFQ 262


>gi|75910216|ref|YP_324512.1| creatininase [Anabaena variabilis ATCC 29413]
 gi|75703941|gb|ABA23617.1| Creatininase [Anabaena variabilis ATCC 29413]
          Length = 262

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 130/241 (53%), Gaps = 7/241 (2%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +++ +++ P+GA EQHGPHLP+  D  I  G+  +  S L   +P   +P    G S EH
Sbjct: 25  KENVVIIQPVGAIEQHGPHLPLIVDAAIGVGVLGKALSKLDASIPAYALPTLYYGKSNEH 84

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
            +  GT TL+        + + ++I + G RK+V++N+HGG   ++ +V+ +  +++   
Sbjct: 85  WHFPGTITLSTETLTAIIMEVGESIYRAGFRKLVLMNSHGGQPQVMQMVARDLHVKYGDF 144

Query: 139 VVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA-ENFSSRQSE 195
            V    +W    I + +++  E   G+H G+ ETS+MLA+ P  V++D A   +   Q E
Sbjct: 145 AVFPLFTWRVPHITKELLTPKEATQGMHAGDAETSIMLAILPDQVQLDKAVAEYPPEQPE 204

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
                  L   G     W  KD++  GV+G+A  AT +KG+ +L   ++ ++Q++ +I +
Sbjct: 205 ----GSLLSWEGKLPVAWVTKDISKSGVIGDATTATREKGDRILESVSDGWVQVIKEIYA 260

Query: 256 F 256
           F
Sbjct: 261 F 261


>gi|126658335|ref|ZP_01729485.1| Creatininase [Cyanothece sp. CCY0110]
 gi|126620484|gb|EAZ91203.1| Creatininase [Cyanothece sp. CCY0110]
          Length = 270

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 125/242 (51%), Gaps = 5/242 (2%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           + +++ ++V P+GA EQHGPHLP+  D+ I+ G+  +    L   +P   +P    G S 
Sbjct: 24  EDKENVVIVQPIGAIEQHGPHLPIAVDSAISLGVLGKTLEKLDLEIPAYSLPCLYYGKSN 83

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EH    GT TL+    +     +  ++   G RK++++N+HGG   ++ I + +    + 
Sbjct: 84  EHSGFPGTITLSATTLLSVITEVAQSVYNSGFRKLILMNSHGGQPQIMEIAARDIHQHYQ 143

Query: 137 MLVVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
              V    +W    I + +++  E E GIH G+ ETS++L+L P  VKM  A        
Sbjct: 144 NFSVFPFFTWRVPHIAKELLTSQELEYGIHAGDAETSIILSLLPDQVKMSQA---VKEYP 200

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           + L     +   G   F W  K+L   GV+G+A  AT +KG+ LL+  ++ ++Q++ D+ 
Sbjct: 201 QGLPEDSLVSMEGKLPFAWLTKELTKSGVMGDATAATKEKGDRLLASVSDGWVQVIKDVY 260

Query: 255 SF 256
            F
Sbjct: 261 RF 262


>gi|111223656|ref|YP_714450.1| putative creatinine amidohydrolase [Frankia alni ACN14a]
 gi|111151188|emb|CAJ62899.1| Putative creatinine amidohydrolase (creatininase) [Frankia alni
           ACN14a]
          Length = 257

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 119/255 (46%), Gaps = 11/255 (4%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
           F D   P  A    D + VLP+G+ EQHGPHLP++TD ++A  LA            +  
Sbjct: 5   FADLRAPEAAGLSPDAVAVLPVGSIEQHGPHLPLSTDLVVAESLARDAVDAFGDACDLWL 64

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRK----MGIRKIVILNAHGGNSP 122
           +P      S EH +  GT  L+        LA++D + +      +R++V LN HGGNS 
Sbjct: 65  LPALAYSKSNEHAWSPGTMWLSATT----LLAVLDDLARCLATTPVRRLVFLNGHGGNSA 120

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           L+ + S + R+   +       S      G     E  +GIH G  ETS++L L P LV+
Sbjct: 121 LLQVASRDVRLAHGLRTFVMHPSLPADHGGTSPAAELGMGIHAGIDETSLLLHLRPDLVR 180

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           +DL       Q   L +F  +R  G+ SFGW   D    G +G+   AT ++G+ L    
Sbjct: 181 LDLGVRSVPEQ---LASFDRVRFGGAVSFGWLSDDFGTDGTIGDPTGATAERGKRLYEAM 237

Query: 243 ANCFIQLLNDINSFD 257
                Q L +I  FD
Sbjct: 238 VVAAGQSLAEIARFD 252


>gi|254421444|ref|ZP_05035162.1| creatininase subfamily [Synechococcus sp. PCC 7335]
 gi|196188933|gb|EDX83897.1| creatininase subfamily [Synechococcus sp. PCC 7335]
          Length = 281

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 78/244 (31%), Positives = 126/244 (51%), Gaps = 11/244 (4%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           + + +++ P+GA EQHGPHLP+  DT+IA  +  +    L   +    +P    G S EH
Sbjct: 38  KANTLIIQPVGAIEQHGPHLPIIVDTVIATSIIGKALHQLDDAIAAYALPPLYYGKSNEH 97

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT  L+        +   ++I   G RK++++N HGG   ++ IV+ + R++   L
Sbjct: 98  SQFPGTIALSAQTLTAVLMETAESIYHAGFRKLLLVNGHGGQPQILEIVARDLRVQHDDL 157

Query: 139 VVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ++     W        I+   E + GIH G+IETS++LAL P  VKM  A        EF
Sbjct: 158 MIFPLFVWGVPHRVAEIVGQTEYDEGIHAGDIETSVLLALLPEQVKMAAAVR------EF 211

Query: 197 LRNF---KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
            + F     L   G+    W+MKDL+  GVVG+A  AT +KGE +L+  +  ++++  +I
Sbjct: 212 PKAFPPGSLLSLEGNLPMAWTMKDLSRSGVVGDATAATSEKGEAILNSVSAGWVKVFEEI 271

Query: 254 NSFD 257
             F+
Sbjct: 272 YRFE 275


>gi|172036274|ref|YP_001802775.1| putative creatininase [Cyanothece sp. ATCC 51142]
 gi|171697728|gb|ACB50709.1| putative creatininase [Cyanothece sp. ATCC 51142]
          Length = 269

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 124/242 (51%), Gaps = 5/242 (2%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           + +++ ++V P+GA EQHGPHLP+  D+ I+ G+  +    L   +P   +P    G S 
Sbjct: 24  EDKENVVIVQPIGAIEQHGPHLPIAVDSAISLGVLGKALEKLDLEIPAYSLPCLYYGKSN 83

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EH    GT TL+    +     +  ++   G RK++++N+HGG   ++ I + +    + 
Sbjct: 84  EHSGFPGTITLSATTLLSVITEVAQSVYNSGFRKLILMNSHGGQPQIMEIAARDIHQHYQ 143

Query: 137 MLVVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
              V    +W    I   +++  E E GIH G+ ETS++L+L P  VKM  A        
Sbjct: 144 DFSVFPFFTWRVPHIAGELLTPQELEYGIHAGDAETSIILSLLPDQVKMSQA---VKEYP 200

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           + L     +   G   F W  K+L   GV+G+A  AT +KG+ LL+  ++ ++Q++ D+ 
Sbjct: 201 QGLPEDSLVSMEGKLPFAWLTKELTKSGVMGDATAATKEKGDRLLASVSDGWVQVIKDVY 260

Query: 255 SF 256
            F
Sbjct: 261 RF 262


>gi|119485478|ref|ZP_01619806.1| Creatininase [Lyngbya sp. PCC 8106]
 gi|119457234|gb|EAW38360.1| Creatininase [Lyngbya sp. PCC 8106]
          Length = 271

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 119/240 (49%), Gaps = 5/240 (2%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +++ +++ P+G+ EQHGPHLP+  D+ IA  +     + L   +P   +P    G S EH
Sbjct: 25  KENIVIIQPIGSIEQHGPHLPLIVDSAIATAVTGEALAKLNTEIPAYALPTLYYGKSNEH 84

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS-- 136
            +  GT TL         +   ++I + G RK+V +NAHGG   ++ +V+ +   ++   
Sbjct: 85  WHFPGTITLNSNTLSSVLIETGESIYRAGFRKLVFINAHGGQPQILEMVARDLHQKYEDF 144

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML     W        +++  E E GIH G+ ETS+ML++ P  V+ +            
Sbjct: 145 MLFPLFVWRVPNAATELLTPKELEYGIHAGDAETSVMLSILPEQVRKN---QVVCEYPHD 201

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           L     L   G   F W  +DL   GV+G+A  AT +KG+ +L   A  +++++ DI  F
Sbjct: 202 LPKNSMLSMEGKLPFAWVTRDLTKSGVLGDATVATKEKGDKILESLAESWVKVITDIYKF 261


>gi|17228869|ref|NP_485417.1| hypothetical protein alr1374 [Nostoc sp. PCC 7120]
 gi|17130721|dbj|BAB73331.1| alr1374 [Nostoc sp. PCC 7120]
          Length = 262

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 129/241 (53%), Gaps = 7/241 (2%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +++ +++ P+GA EQHG HLP+  D  I  G+  +  S L   +P   +P    G S EH
Sbjct: 25  KENVVIIQPVGAIEQHGLHLPLIVDAAIGVGVLGKALSKLDASIPAYALPTLYYGKSNEH 84

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
            +  GT TL+        + + ++I + G RK+V++N+HGG   ++ +V+ +  +++   
Sbjct: 85  WHFPGTITLSTETLTATIMEVAESIYRAGFRKLVLMNSHGGQPQVMQMVARDLHVKYGDF 144

Query: 139 VVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA-ENFSSRQSE 195
            V    +W    I + ++S  E   G+H G+ ETS+MLA+ P  V++D A   +   + E
Sbjct: 145 AVFPLFTWRVPHITKELLSPKEAIQGMHAGDAETSIMLAILPDQVQLDKAVAEYPPEKPE 204

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
                  L   G     W  KD++  GV+G+A  AT +KG+ +L   ++ +++++ +I +
Sbjct: 205 ----GSLLSWEGRLPVAWVTKDISKSGVIGDATTATKEKGDRILESVSDGWVEVIKEIYA 260

Query: 256 F 256
           F
Sbjct: 261 F 261


>gi|251800096|ref|YP_003014827.1| creatininase [Paenibacillus sp. JDR-2]
 gi|247547722|gb|ACT04741.1| Creatininase [Paenibacillus sp. JDR-2]
          Length = 268

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 118/241 (48%), Gaps = 5/241 (2%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           + D ++VLP+GA EQHGPH+P+ TDT++   +  +    LP    +  +P    G S EH
Sbjct: 28  KDDVLLVLPIGAVEQHGPHMPVFTDTLLGEAMLTKAFEHLPEDSSIWLLPSVSYGKSTEH 87

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT TL+    +     I  ++ + G RK+++ N HGGN+ L+ +++ E R+   + 
Sbjct: 88  AGHPGTITLSAKTLMAVLEDISSSLARSGFRKLLLFNTHGGNADLLGMMAREIRIATGLE 147

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           V                  E   GIH G++ETS+++A  P  V  +LA     R+     
Sbjct: 148 VYRLDPGAVGYSDSFTDEAEKACGIHAGDVETSLVMATCPGWVHAELA----PREMPRFP 203

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           + +Y  +  S SF W M D++  GV G+A  AT  +G  +L        + L  I SF +
Sbjct: 204 DSRYF-SFRSRSFAWVMDDISGSGVAGDATKATADRGTAMLETAGPLLAEALLHIASFGM 262

Query: 259 S 259
           +
Sbjct: 263 A 263


>gi|221070039|ref|ZP_03546144.1| Creatininase [Comamonas testosteroni KF-1]
 gi|220715062|gb|EED70430.1| Creatininase [Comamonas testosteroni KF-1]
          Length = 285

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 127/248 (51%), Gaps = 8/248 (3%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           + + ++VLP+GA EQHGPHLP + D  IAAG+     + LP  +P   M     G S EH
Sbjct: 26  KANTVIVLPVGAMEQHGPHLPCSVDATIAAGVVGAAMAQLPAAVPAFAMAPIVYGKSEEH 85

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
           ++  GT TL+    +     I +++ + G RK++ +N HGG   ++ I + E R+R    
Sbjct: 86  LHFPGTVTLSGETLLATINEIGESVYRAGFRKLLFVNGHGGQPQVLEIAARELRLRHGDF 145

Query: 139 VV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE-NFSSRQSE 195
           +V  S +W    +    +S  E ++ +H G  ET++MLALAP  V M+ A  N+      
Sbjct: 146 IVVPSFTWRVPHVAGQYLSNLEKKLAMHAGHAETALMLALAPQTVHMERAVINYPPVFPS 205

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
            L     L   G  +  W+ +D  P GV+G+   AT ++G+ +L   A  +   + +++ 
Sbjct: 206 SL-----LSPDGRPACAWTARDFGPSGVIGDPTPATAEQGQEILQSLARSWAAAIAELHE 260

Query: 256 FDVSIFDK 263
              +  D+
Sbjct: 261 LQWASRDE 268


>gi|323485314|ref|ZP_08090663.1| hypothetical protein HMPREF9474_02414 [Clostridium symbiosum
           WAL-14163]
 gi|323694073|ref|ZP_08108253.1| creatinine amidohydrolase [Clostridium symbiosum WAL-14673]
 gi|323401350|gb|EGA93699.1| hypothetical protein HMPREF9474_02414 [Clostridium symbiosum
           WAL-14163]
 gi|323501875|gb|EGB17757.1| creatinine amidohydrolase [Clostridium symbiosum WAL-14673]
          Length = 264

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 124/248 (50%), Gaps = 13/248 (5%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR----LPVTCMPVEPIGY 74
           +++ IV++PLGA EQHG   P+ TD IIA  + + I+  L        P+   PV P+G 
Sbjct: 18  KEETIVLIPLGALEQHGSQAPLGTDDIIAEAMTKEIQKALEEEGEDDFPMLVFPVIPVGL 77

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           S EH    G+ T+           I  ++   G +K+  L  HGGN+P+V ++S E R  
Sbjct: 78  STEHKNFCGSITVKPDTYYHMLYDISISLAHHGFKKLAFLICHGGNAPIVQVLSRELRSE 137

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEI-GIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
             +     +   FT P    +  E  I   HGGE+ETSM++A+   LVK++L+E  +   
Sbjct: 138 LGISPFILTSGAFTHPDVTATISEGNIWDFHGGEMETSMVMAVDESLVKLELSE--AGIP 195

Query: 194 SEFLRNFKYLRAHGSHSFG-----WSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
           S F  N K L+ +G+ S G     W  KD  P G+ G+   AT +KG  +L   A   + 
Sbjct: 196 SAFEHN-KALKPYGNVSIGWVSEDWKTKDGKPIGIGGDPSGATAEKGRIILETSARVLVP 254

Query: 249 LLNDINSF 256
            L +I  +
Sbjct: 255 GLKEIREW 262


>gi|300717288|ref|YP_003742091.1| Creatininase [Erwinia billingiae Eb661]
 gi|299063124|emb|CAX60244.1| Creatininase [Erwinia billingiae Eb661]
          Length = 293

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 129/243 (53%), Gaps = 11/243 (4%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           + + ++VLP GA EQHGPHLP + D++I++G+A    + LP  +P   +P    G S EH
Sbjct: 26  KANTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARLPKAIPAFAIPPITYGKSDEH 85

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
           +   GT TLT    ++  L I +++ + G RK++++N HGG   ++ + S E R+R   +
Sbjct: 86  LNFPGTLTLTGDTLLQTILEIAESVYRAGFRKLLMINGHGGQPQVLQMASREMRLRHGDM 145

Query: 139 VVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
           ++      F +P      +S  E ++ +H G  ET++MLALAP  V M+ A    +   E
Sbjct: 146 IM-IPHDVFRVPNVENQYLSAQEQKMAMHAGHSETAVMLALAPECVHMEHA--VVNYPPE 202

Query: 196 F-LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           F        R     +  W+  D  P GV+G+   ATV++G  +L   A  + Q + +I+
Sbjct: 203 FPCPTLSSSRP----AAAWASYDFGPSGVIGDPTQATVEQGHAILDSLAASWAQAITEIH 258

Query: 255 SFD 257
             +
Sbjct: 259 QME 261


>gi|160940015|ref|ZP_02087360.1| hypothetical protein CLOBOL_04904 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436595|gb|EDP14362.1| hypothetical protein CLOBOL_04904 [Clostridium bolteae ATCC
           BAA-613]
          Length = 281

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 124/251 (49%), Gaps = 16/251 (6%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-------LPVTCMPVEP 71
           + + IV++PLGA EQHG   P+ TD IIA  + + I+  L           P+   PV P
Sbjct: 32  KDETIVLIPLGALEQHGNQAPLGTDDIIAEAMTDYIRRELEGEPSSEDSDFPMLVFPVIP 91

Query: 72  IGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
           +G S EH    G+ TL           I  ++   G +K+  L  HGGN+P+V ++S E 
Sbjct: 92  VGLSTEHRNFCGSITLKPDTYYHMLYDISTSLVHHGFKKLAFLVCHGGNAPIVQVLSREL 151

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEI-GIHGGEIETSMMLALAPHLVKMDLAENFS 190
           R  F +     S   F+ P    +  E  I   HGGE+ETSM++A+ P LVK+D +E   
Sbjct: 152 RSEFGISPFILSSGAFSHPDVTATISEGNIWDFHGGEMETSMVMAVDPSLVKLDTSE--- 208

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDL-----NPKGVVGNAMDATVKKGEGLLSYFANC 245
           +      ++ + LR +G+ S GW  +D       P G+ G+   AT +KG  +L   A  
Sbjct: 209 AGIPIAFKDNQALRPYGNVSIGWVSEDWKTADGKPIGIGGDPSGATAEKGRIILETSAKV 268

Query: 246 FIQLLNDINSF 256
            +  L +I ++
Sbjct: 269 LVPGLREIRAW 279


>gi|302337723|ref|YP_003802929.1| creatininase [Spirochaeta smaragdinae DSM 11293]
 gi|301634908|gb|ADK80335.1| Creatininase [Spirochaeta smaragdinae DSM 11293]
          Length = 257

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 123/238 (51%), Gaps = 8/238 (3%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL-PPRLPVTCMPVEPIGYSIEHMYV 81
           I + P+G+ EQHG HLP+ TD++IA  +++ +K I+     P   +P+ P G S EH   
Sbjct: 22  IAIQPIGSTEQHGSHLPVGTDSLIAEAISKGLKEIMRTANYPAVFLPLIPYGKSNEHNSF 81

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT  +     I     I  ++++ G RK+V LN HGGN  ++  +  E R++  +    
Sbjct: 82  PGTVCMQVETLIRILSDIGASLQRSGFRKLVFLNGHGGNHEVLDFMCREIRIQTGIKTFV 141

Query: 142 TSWSRFTIPQ----GIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
                  +P+    G  S  E + GIH G +ETS++L + P LV+    +   +   EFL
Sbjct: 142 LHPFLKIMPENFDFGEYSESERKFGIHAGRMETSIILYIDPELVR---KKEIKASIPEFL 198

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           +  +++       FGW  +D++  GV+G+   AT  +GE LL+  A    +++ +I +
Sbjct: 199 QQKEFINFSECVPFGWITEDVSENGVIGDPSQATQVEGEKLLTGIAQTLFKVMEEIRA 256


>gi|317046649|ref|YP_004114297.1| Creatininase [Pantoea sp. At-9b]
 gi|316948266|gb|ADU67741.1| Creatininase [Pantoea sp. At-9b]
          Length = 292

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 129/245 (52%), Gaps = 13/245 (5%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D + + ++VLP GA EQHGPHLP   D++I++G+     + LP  +P   +P    G S 
Sbjct: 24  DDKANTVIVLPTGAIEQHGPHLPCAVDSVISSGVVGHALARLPAAIPAYAIPPITYGKSD 83

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EH++  GT TLT    +   L I +++ + G RK +++N HGG    + +   E R+R  
Sbjct: 84  EHLHFPGTLTLTGETLLHTILEIGESLYRAGFRKFLMVNGHGGQPQPLQMAMRELRLRHG 143

Query: 137 MLVVSTSWSRFTIPQGIISF---PETEIGIHGGEIETSMMLALAPHLVKMDLA-ENF-SS 191
            +++      F +P    SF    E ++ +H G  ET++MLALAP  V+MD A  N+  +
Sbjct: 144 DMIIIMQ-DTFKVPNCAESFMDEQERQMAMHAGHAETALMLALAPDTVQMDKAVANYPPA 202

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                L + + + A       W+  D  P GV+G+ + +T  +GE +L   A  + Q++ 
Sbjct: 203 FPCPTLSSTRPMAA-------WASYDFGPSGVIGDPLPSTKAQGEAILESLAISWAQVIT 255

Query: 252 DINSF 256
           +++  
Sbjct: 256 EVHQM 260


>gi|322832605|ref|YP_004212632.1| Creatininase [Rahnella sp. Y9602]
 gi|321167806|gb|ADW73505.1| Creatininase [Rahnella sp. Y9602]
          Length = 293

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 129/239 (53%), Gaps = 9/239 (3%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           + + ++VLP GA EQHGPHLP + D++I++G+A    + LP  +P   +P    G S EH
Sbjct: 26  KANTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARLPEAIPAYAIPPITYGKSDEH 85

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
           +   GT TLT    ++  L I +++ + G RK++++N HGG   ++ + S E R+R   +
Sbjct: 86  LNFPGTLTLTGDTLLQTILEIAESLYRAGFRKLLMINGHGGQPQVLQMASREMRLRHGDM 145

Query: 139 VVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
           ++      F +P      +S  E ++ +H G  ET++MLALAP  V ++ A   ++   E
Sbjct: 146 IM-IPHDVFRVPNVENQFLSAQEQKMAMHAGHSETAVMLALAPECVHIEHA--VANYPPE 202

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           F        + G  +  W+  D  P GV+G+   AT ++G  +L   A  + Q + +I+
Sbjct: 203 FPCP---TLSSGRPAAAWASYDFGPSGVIGDPTGATAEQGHAILDSLAASWAQAITEIH 258


>gi|304397341|ref|ZP_07379219.1| Creatininase [Pantoea sp. aB]
 gi|304354959|gb|EFM19328.1| Creatininase [Pantoea sp. aB]
          Length = 293

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 131/246 (53%), Gaps = 11/246 (4%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           + + ++VLP GA EQHGPHLP + D++I++G+A    + LP  +P   +P    G S EH
Sbjct: 26  KANTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARLPEEIPAFAIPPITYGKSDEH 85

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
           +   GT TLT    ++  L I +++ + G RK++++N HGG   ++ + S E R+R   +
Sbjct: 86  LNFPGTLTLTGDTLLQTVLEIAESLYRAGFRKLLMINGHGGQPQVLQMASREMRLRHGDM 145

Query: 139 VVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
           ++      F +P      +S  E ++ +H G  ET++MLALAP  V M+ A       + 
Sbjct: 146 IMIPH-DVFRVPNVENQFLSAQEQKMAMHAGHSETAVMLALAPECVHMEHA------VAN 198

Query: 196 FLRNFKY-LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           +   F     + G     W+  D  P GV+G+ + AT ++G  +L   A  + Q + +I+
Sbjct: 199 YPPAFPCPTLSSGRPVAAWASYDFGPSGVIGDPIGATAEQGHAILDSLAASWAQAITEIH 258

Query: 255 SFDVSI 260
             + ++
Sbjct: 259 LMEWTV 264


>gi|317969605|ref|ZP_07970995.1| creatininase [Synechococcus sp. CB0205]
          Length = 277

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 116/237 (48%), Gaps = 8/237 (3%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV P GA+EQHGPHLP+ TD + A  + +++   LP   P+  +P++ IG+S EH+   G
Sbjct: 33  VVWPFGAFEQHGPHLPLGTDALFAEQILDQVLESLPQEAPIWRLPLQSIGFSPEHLGFPG 92

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L     I     +   +   G  ++V+ N HGG   L+ + + + R     L V   
Sbjct: 93  TLSLPAELLISSIETVGGQLAAAGFERLVLFNGHGGQIALLQVAARQLRAAHPSLGVLPC 152

Query: 144 WSRFTIPQGI---ISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           +  ++ P+GI   I  PE   G+H G++ETS+ML L P LV    AE+    Q    +  
Sbjct: 153 F-LWSGPKGIGELIEEPERSDGLHAGQVETSLMLQLNPELVGPKRAEDGLGAQ----QPP 207

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
           +     G+    W  +DL+  GV+G+   A   +GE L       + +L   +   D
Sbjct: 208 QGWSLEGAVPNAWLTQDLSSSGVIGDPSQANGAQGEALRHRLVQGWSELFGSLLGSD 264


>gi|239624807|ref|ZP_04667838.1| creatinine amidohydrolase family protein [Clostridiales bacterium
           1_7_47_FAA]
 gi|239521193|gb|EEQ61059.1| creatinine amidohydrolase family protein [Clostridiales bacterium
           1_7_47FAA]
          Length = 263

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 124/248 (50%), Gaps = 12/248 (4%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP---PRLPVTCMPVEPIGYS 75
           +++ IV++PLGA EQHG   P+ TD IIA  + E +   L    P  P+   PV P+G S
Sbjct: 18  KEETIVLIPLGALEQHGNQAPLGTDDIIAQAMTEYLTQALEAEDPDFPMLIFPVIPVGLS 77

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            EH    G+ TL           I  ++   G +K+ +L  HGGN+P+  ++S E R   
Sbjct: 78  TEHKNFCGSITLKPDTYYHLLYDICASLAHHGFKKLALLICHGGNAPIAQVLSRELRSEL 137

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEI-GIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
            +     S   F+ P    +  E  I   HGGE+ETSM++A+ P LVK++ +E  +   +
Sbjct: 138 GISPFLLSSGAFSHPDVKATVSEGNIWDFHGGEMETSMVMAVDPSLVKLETSE--AGIPA 195

Query: 195 EFLRNFKYLRAHGSHSFG-----WSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
            F  N + L+ +G  S G     W  +D  P G+ G+   AT +KG  +L   A   +  
Sbjct: 196 AFKDN-QALQPYGPVSIGWVSEDWKTEDGKPIGIGGDPSGATAEKGRIILKTSAEALVPG 254

Query: 250 LNDINSFD 257
           L +I  ++
Sbjct: 255 LLEIKKWN 262


>gi|329297689|ref|ZP_08255025.1| Creatininase [Plautia stali symbiont]
          Length = 292

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/245 (30%), Positives = 128/245 (52%), Gaps = 13/245 (5%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D + + ++VLP GA EQHGPHLP   D++I++G+     + LP  +P   +P    G S 
Sbjct: 24  DNKANTVIVLPTGAIEQHGPHLPCAVDSVISSGVVGHALARLPANIPAYAIPPITYGKSD 83

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EH++  GT TLT    +   L I +++ + G RK +++N HGG    + + + E R+R  
Sbjct: 84  EHLHFPGTLTLTGETLLHTILEIGESLYRAGFRKFLMVNGHGGQPQPLQMAARELRLRHG 143

Query: 137 MLVVSTSWSRFTIPQGIISF---PETEIGIHGGEIETSMMLALAPHLVKMDLA-ENF-SS 191
            +++      F +P    SF    E ++ +H G  ET++MLALAP  V+M  A  N+  +
Sbjct: 144 DIIIIMQ-DTFKVPNCAESFMDDKEHQMAMHAGHAETALMLALAPDTVQMSKAVANYPPA 202

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                L   K + A       W+  D  P GV+G+ + +T ++G  +L   A  + Q++ 
Sbjct: 203 FPCPTLSTSKPMAA-------WASYDFGPSGVIGDPLPSTPEQGAAILDSLAESWAQVIT 255

Query: 252 DINSF 256
           +++  
Sbjct: 256 EVHQM 260


>gi|113953826|ref|YP_731194.1| creatininase [Synechococcus sp. CC9311]
 gi|113881177|gb|ABI46135.1| creatininase [Synechococcus sp. CC9311]
          Length = 275

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 116/237 (48%), Gaps = 3/237 (1%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV P+GA+EQHGPHLP+ TD + +  +   + S L P  P+  +P + IG+S EH    G
Sbjct: 28  VVWPMGAFEQHGPHLPLATDALFSERILSSVLSELAPNAPIWSLPSQSIGFSPEHSGFPG 87

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+     +  L +   +   G++++V+ NAHGG   L+   + E R++   + +   
Sbjct: 88  TLSLSSGLLTQLILEVGKQLCTQGVKRLVLFNAHGGQIGLLQAAARELRVQSPSMAILPC 147

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ-SEFLRNF 200
             WS       +I   E   G+H  + ETS+MLAL P LV      +   RQ S      
Sbjct: 148 FMWSGVPGLDALIPGDELTGGLHAAQAETSLMLALEPELVGEARPVDGDHRQPSSLATPP 207

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
                 G+    W   DL+  GV+G++  A+++ GE L S     ++ L   + + D
Sbjct: 208 PGWSLEGAAPTAWLTTDLSNSGVIGDSRAASIECGEALESCLVRHWVHLFGSLLASD 264


>gi|90655435|gb|ABD96276.1| creatininase [uncultured marine type-A Synechococcus GOM 3M9]
          Length = 273

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 119/233 (51%), Gaps = 11/233 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV P GA EQHGP LP+ TD + A  + + +   L P LP+  +PV+ IG+S EH    G
Sbjct: 29  VVWPFGACEQHGPQLPLATDALFAERILDAVLLGLDPLLPIWRLPVQAIGFSPEHASFPG 88

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L     I     + + +   G+R++V+ NAHGG   L+ + + + R+R   + V   
Sbjct: 89  TLSLPADLLIALVDRVGEQLADQGVRRLVLFNAHGGQIALLQVAARQLRVRCPQMAVLPC 148

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
             WS      G+IS  E E G+H  E ETS+ML LAP LV  +   +     +    + +
Sbjct: 149 FLWSGVDGLSGLISEAELEQGLHAAEAETSLMLRLAPELVGPERPVDGLPPAAPGDWSLE 208

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG----EGLLSYFANCFIQLL 250
                G+    W  +DL+  GV+G++  A+V+ G    E L+ ++   F  LL
Sbjct: 209 -----GAAPCAWLARDLSASGVIGDSRSASVELGGRLEERLVEHWLRQFKALL 256


>gi|159903075|ref|YP_001550419.1| creatininase [Prochlorococcus marinus str. MIT 9211]
 gi|159888251|gb|ABX08465.1| Creatininase [Prochlorococcus marinus str. MIT 9211]
          Length = 301

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 121/246 (49%), Gaps = 13/246 (5%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A A+    +V P GA EQHGPHLP+ TD + A  +   +   +P   P+  +PV+ IG+S
Sbjct: 51  AAAKDGSTLVWPFGACEQHGPHLPLVTDALFAEEILTEVLDQMPKETPIWMLPVQKIGFS 110

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            EH+   GT +++    ++    I   +  +GI+++V+ NAHGG   L+  V+ + R   
Sbjct: 111 PEHLGFPGTLSISADLMLQLVSEIGRQLADLGIKRLVLFNAHGGQIGLLQAVARQLRAEC 170

Query: 136 SMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM----DLAENF 189
             + V     WS     + +I   E E G+H    ETS+ML++ P LV +    D  ENF
Sbjct: 171 PSMAVLPCFLWSGIESLKDLIPHREVEEGLHAALAETSLMLSIKPELVGIQRPFDGDENF 230

Query: 190 SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE----GLLSYFANC 245
                     +      G+    W  KDL+  GV+G++  A    G+     L+ ++ + 
Sbjct: 231 PKNNISIPEGWSL---EGAAPCAWLTKDLSITGVIGDSRGANPDLGDRLKNALVEHWTSL 287

Query: 246 FIQLLN 251
           FI L+N
Sbjct: 288 FINLMN 293


>gi|225165847|ref|ZP_03727624.1| creatininase [Opitutaceae bacterium TAV2]
 gi|224799906|gb|EEG18358.1| creatininase [Opitutaceae bacterium TAV2]
          Length = 233

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 115/219 (52%), Gaps = 11/219 (5%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           +LP+ A EQHGPHLP+ TD II  GL     + LP   PV   P    G S EH    GT
Sbjct: 1   ILPIAAIEQHGPHLPVGTDAIIGHGLLAAALARLPDDAPVWIAPPLTYGKSTEHETYAGT 60

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSW 144
            +LT         A  + + ++G R + ILN HGGNS +++    E +  F   + +   
Sbjct: 61  LSLTTPTLRALLRAQAEQLHRLGFRTLAILNTHGGNSAVLTYTLRELQTAFDPPLRAGML 120

Query: 145 SRFTIPQ---GIISFPETE--IGIHGGEIETSMMLALAPHLVKMDLA-ENFSSRQSEFLR 198
           +   +P+   G   F   E   G H G+ ETS+MLALAP  V+MD A   + +R    L 
Sbjct: 121 THGFVPELKPGPDEFTAQERAYGFHAGDWETSLMLALAPDTVRMDRAICAWPAR----LD 176

Query: 199 NFKYLRAHG-SHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           +   LR  G S +F W+ +D++P GV+G+A  AT +KG+
Sbjct: 177 DPGELRPEGPSLTFAWATEDISPSGVMGDATRATREKGD 215


>gi|16332320|ref|NP_443048.1| creatinine amidohydrolase [Synechocystis sp. PCC 6803]
 gi|1653950|dbj|BAA18860.1| creatinine amidohydrolase [Synechocystis sp. PCC 6803]
          Length = 273

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 121/244 (49%), Gaps = 6/244 (2%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I++ PLG+ EQHGPHLP+  D  I+ G+  +    L P +P   +P    G S EHM   
Sbjct: 31  IIIQPLGSIEQHGPHLPLVVDAAISEGVLGKALQTLAPEIPAYVLPTLYYGKSNEHMGFP 90

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           G  TL+    +     +  ++ + G RK ++LN+HGG   ++ I + +    +  L +  
Sbjct: 91  GVITLSAETLLVILKEVAASLYQSGFRKWILLNSHGGQIQVLEIAARDLHQIYPDLQIFP 150

Query: 143 --SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD-LAENFSSRQSEFLRN 199
             +W        +++  E   GIH G+ ETS+M+AL P LV+ D L + F         +
Sbjct: 151 FFTWRMPHCAADLLTPKEMTHGIHAGDGETSLMMALWPELVREDRLVKEFPQG---IPAD 207

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
            + L   GS  F W  K+++  GV+G+A  AT +KGE LL   A+   Q +  +  F   
Sbjct: 208 DELLSMEGSLPFAWLTKEVSRSGVMGDATVATKEKGEVLLDCLADGCRQAIEAVYHFQPP 267

Query: 260 IFDK 263
             D+
Sbjct: 268 SLDR 271


>gi|72383698|ref|YP_293053.1| creatininase [Prochlorococcus marinus str. NATL2A]
 gi|72003548|gb|AAZ59350.1| creatinine amidohydrolase related enzyme [Prochlorococcus marinus
           str. NATL2A]
          Length = 265

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 113/236 (47%), Gaps = 2/236 (0%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +V P GA EQHGPHLP+ TDT  A  +  +  + LP  +P+  MP + IG+S EH    G
Sbjct: 17  LVWPFGACEQHGPHLPLITDTFFAENILIKTLNRLPENMPIWMMPSQSIGFSPEHQAFPG 76

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    I     +   I  MG  ++V  NAHGG   L+  VS + R++   + V   
Sbjct: 77  TLSLSADVLISMVTDVGQQIASMGFNRLVFFNAHGGQIGLLQAVSRQLRIQCPSIAVLPC 136

Query: 144 WSRFTIPQGIISFPETEI--GIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           +    +P      PE E+  G+H    ETS+ML +A  LV+ D      +   + +   K
Sbjct: 137 FLWSGVPGLDQLLPEKEVEEGLHAALAETSLMLHMARDLVRNDSYLEIKNVDKQIVTTPK 196

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
                G+    W  +DL+  GV+G+A  +  + G  L +   + +I L   +   D
Sbjct: 197 GWSLEGASPCAWLTEDLSSSGVIGDASSSNSELGAALENALVDHWIALFTSLLESD 252


>gi|124025298|ref|YP_001014414.1| creatininase [Prochlorococcus marinus str. NATL1A]
 gi|123960366|gb|ABM75149.1| Creatininase [Prochlorococcus marinus str. NATL1A]
          Length = 265

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 113/234 (48%), Gaps = 6/234 (2%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +V P GA EQHGPHLP+ TDT  A  +  +    LP  +P+  MP + IG+S EH    G
Sbjct: 17  LVWPFGACEQHGPHLPLITDTFFAENILIKTLDRLPENMPIWMMPSQSIGFSPEHQAFPG 76

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    +     +   I  MG  ++V  NAHGG   L+  VS + R++   + V   
Sbjct: 77  TLSLSADVLLSMVTDVGQQIASMGFNRLVFFNAHGGQIGLLQAVSRQLRIQCPSIAVLPC 136

Query: 144 WSRFTIPQGIISFPETEI--GIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           +    +P+     PE E+  G+H    ETS+ML +A  LV+ D      +   + +   K
Sbjct: 137 FLWSGVPELDQLLPEKEVEEGLHAALAETSLMLHMAEDLVRNDSYLEIKNVDKQIVTTPK 196

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG----EGLLSYFANCFIQLLN 251
                G+    W  +DL+  GV+G+A  +  + G      L+ ++ + F  LL 
Sbjct: 197 GWSLEGASPCAWLTEDLSSSGVIGDASSSNSELGAALENALVDHWKSLFTSLLE 250


>gi|33863500|ref|NP_895060.1| creatininase [Prochlorococcus marinus str. MIT 9313]
 gi|33640949|emb|CAE21407.1| Creatininase [Prochlorococcus marinus str. MIT 9313]
          Length = 273

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 117/232 (50%), Gaps = 7/232 (3%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +V P GA EQHGPHLP+ TD   A  +   +   LP  LP+  +P + +G+S EH    G
Sbjct: 27  LVWPFGACEQHGPHLPLITDAFFAERMLVEVLERLPADLPIWMLPAQSLGFSPEHEAFPG 86

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+     +  + +   +  MG+R++++ NAHGG   L+ + + + R +   + V   
Sbjct: 87  TLSLSANLMFQLVIEVGQQLAAMGVRRLLLFNAHGGQIGLLHVAARQLRAQCPAMAVLPC 146

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL---AENFSSRQSEFLR 198
             WS     + ++   E E+G+H G  ETS+ML++AP LV +D     ++++   S    
Sbjct: 147 FLWSGVGALKDLLPESEREVGLHAGLAETSLMLSMAPELVGLDRPVDGDHYTPGLSTTPP 206

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
               L  H   +  W   D +  GV+G++ +A    G+ L     + ++ LL
Sbjct: 207 MGWSLEGHAPCA--WLTDDFSESGVIGDSREANAALGKALEQALVDHWVNLL 256


>gi|87302522|ref|ZP_01085339.1| creatininase [Synechococcus sp. WH 5701]
 gi|87282866|gb|EAQ74823.1| creatininase [Synechococcus sp. WH 5701]
          Length = 264

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 117/242 (48%), Gaps = 6/242 (2%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A +R    V+ P GA EQHGPHLP+ TD I A  + + +   LP  LP+  +P+  +G+S
Sbjct: 20  AASRPGSTVIWPFGAVEQHGPHLPLGTDAIFAERVLQAVLERLPAELPIWRLPLFQLGFS 79

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            EH    GT +L     ++  +A+   + + G +++V+ NAHGG   L+ + + + R   
Sbjct: 80  PEHGAFPGTLSLPAEVLLQVVMAVGADLARAGFQRLVLFNAHGGQIALLQVAARQLRAAH 139

Query: 136 SMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
             L V     WS       ++  PE   G+H    ETS+ML LAP LV     +     Q
Sbjct: 140 PRLAVMPCFLWSGPPGVAALLPEPERSEGLHAALAETSLMLHLAPELVG---PQRPREGQ 196

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
            +      +    G+    W   DL+  GVVG+A  A    G+ L +   + ++ LL D+
Sbjct: 197 PDPAPPAGW-SLEGAVPTAWLTADLSASGVVGDARGADAALGKALCTALVDGWVTLLGDL 255

Query: 254 NS 255
            S
Sbjct: 256 LS 257


>gi|33866271|ref|NP_897830.1| creatininase [Synechococcus sp. WH 8102]
 gi|33639246|emb|CAE08254.1| Creatininase [Synechococcus sp. WH 8102]
          Length = 276

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/217 (32%), Positives = 110/217 (50%), Gaps = 2/217 (0%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           ++ P GA EQHGPHLP+ TD + A  +AE + + L P LP+  +P + IG+S EH    G
Sbjct: 27  LIWPFGACEQHGPHLPLVTDALFAERIAEAVLAELNPELPIWRLPTQVIGFSPEHQSFPG 86

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    I   + + + +  MG R++V+ NAHGG   L+ + + E R R   + V   
Sbjct: 87  TLSLSSDLLIALVVQLGEQLAGMGWRRLVLFNAHGGQIALLQVAARELRQRCPAMAVLPC 146

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
             WS       ++   E E G+H G  ETS+ML  AP LV     ++             
Sbjct: 147 FLWSGVEGLADLLPADELENGLHAGLAETSLMLHQAPELVGDQRPKDGLPGVDGCPVPPS 206

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
                G+    W M+DL+  GV+G++  A+ + G+ L
Sbjct: 207 GWSLEGAAPSAWLMQDLSRSGVIGDSGAASAELGQAL 243


>gi|319443188|ref|ZP_07992344.1| putative creatinine amidohydrolase (creatininase) [Corynebacterium
           variabile DSM 44702]
          Length = 259

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 118/242 (48%), Gaps = 19/242 (7%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS-ILPPRLPVTCMPVEPIGYSIEHMYV 81
           + V+P+GA E HGPHLPM+TD ++A  +A  + S  +     +  +P   +  S EH  +
Sbjct: 25  LAVVPVGAVEPHGPHLPMSTDLVMAEAVASAVVSRAVDAGHDLWLLPALSVTKSDEHAAL 84

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT  L  +      + +  ++   G+R+++ +N HGGNS L+ +   E R RF +    
Sbjct: 85  PGTLWLKASTLFATLVDLGRSLAAAGVRRVLFVNGHGGNSALLEVALRELRRRFDLRTF- 143

Query: 142 TSWSRFTIPQGIISFP----ETE--IGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
                      ++S P    ETE  +GIH G  ETSMML +AP LV MD A     + + 
Sbjct: 144 -----------LVSSPPTPGETECGMGIHAGWSETSMMLHVAPELVDMDAAAELGPKVAS 192

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
            +    ++    +  FGW   D +  GVVG+   A+   GE L   +    +  L ++ +
Sbjct: 193 SVAACDHVGFGKTVKFGWLSTDFDASGVVGDPTGASASAGERLFEDYVTSVLDALPEVLT 252

Query: 256 FD 257
           F+
Sbjct: 253 FN 254


>gi|90655538|gb|ABD96377.1| creatininase [uncultured marine type-A Synechococcus GOM 3O12]
          Length = 276

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 72/219 (32%), Positives = 110/219 (50%), Gaps = 10/219 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           ++ P GA EQHGPHLP+ TD + A  + E + + L P+LP+  +P + IG+S EH    G
Sbjct: 27  LIWPFGACEQHGPHLPLVTDALFAERITEAVVADLNPQLPIWSLPTQVIGFSPEHRSFPG 86

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    I   + + + +  MG R++V+ NAHGG   L+ + + E R R   + V   
Sbjct: 87  TLSLSSDLLIAVVVQLGEQLAAMGWRRLVLFNAHGGQIALLQVAARELRQRCPAMAVLPC 146

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV----KMDLAENFSSRQSEFL 197
             WS       ++   E E G+H G  ETS+ML  AP LV     +D       R     
Sbjct: 147 FLWSGVEGLADLLPAHELENGLHAGMAETSLMLHQAPELVGEQRPVDGLPGLEGRPCP-- 204

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
                    G+  F W M+DL+  GV+G++  A+   G+
Sbjct: 205 --PSGWSLEGAAPFAWLMQDLSHSGVIGDSSAASADLGK 241


>gi|78212275|ref|YP_381054.1| creatininase [Synechococcus sp. CC9605]
 gi|78196734|gb|ABB34499.1| creatininase [Synechococcus sp. CC9605]
          Length = 280

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 111/226 (49%), Gaps = 8/226 (3%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V+ P GA EQHGP LP++TD + A G+ + +   L P LP+  +P + IG+S EH    G
Sbjct: 27  VIWPFGACEQHGPQLPLSTDAVFADGILDYVLCGLEPALPIWRLPCQSIGFSPEHKNFPG 86

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    ++    +   +  MG++++V+ NAHGG   L+ + + + R R   L V   
Sbjct: 87  TISLSAPLLLDLVDQVGTQLAAMGVQRLVLFNAHGGQIGLLQVAARQLRARCPSLAVLPC 146

Query: 144 --WSRFTIPQGIIS-FPETEI--GIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
             WS     +G+    PE E+  G+H G+ ETS+ML +AP LV      +          
Sbjct: 147 FLWSGV---EGLADLLPEQELLHGLHAGQAETSLMLQMAPDLVGSARPVDGRPAPGSAPE 203

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             +     G+    W   DL+  GV+G+A  A+   G  L     N
Sbjct: 204 PPEGWSLEGAAPCAWLTDDLSATGVIGDARQASADLGRCLEDRLIN 249


>gi|124022487|ref|YP_001016794.1| creatininase [Prochlorococcus marinus str. MIT 9303]
 gi|123962773|gb|ABM77529.1| Creatininase [Prochlorococcus marinus str. MIT 9303]
          Length = 273

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 118/232 (50%), Gaps = 7/232 (3%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +V P GA EQHGPHLP+ TD   A  +   +   LP  LP+  +P + +G+S EH    G
Sbjct: 27  LVWPFGACEQHGPHLPLITDAFFAERMLVEVLERLPADLPIWMLPAQSLGFSPEHEAFPG 86

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+     +  + +   +  MG+R++++ NAHGG   L+ + + + R +   + V   
Sbjct: 87  TLSLSANLMFQLVIEVGQQLAAMGVRRLLLFNAHGGQIGLLHVAARQLRAQCPAMAVLPC 146

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL---AENFSSRQSEFLR 198
             WS     + ++   E E+G+H G  ETS+ML++AP LV ++     ++++   S    
Sbjct: 147 FLWSGVGALKDLLPESEREVGLHAGLAETSLMLSMAPELVGLERPVDGDHYTPGLSTTPP 206

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
               L  H   +  W   D +  GV+G++ +A    G+ L    A+ ++ LL
Sbjct: 207 MGWSLEGHAPCA--WLTDDFSESGVIGDSREANAALGKALEQALADHWVNLL 256


>gi|87123921|ref|ZP_01079771.1| creatininase [Synechococcus sp. RS9917]
 gi|86168490|gb|EAQ69747.1| creatininase [Synechococcus sp. RS9917]
          Length = 277

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 115/242 (47%), Gaps = 3/242 (1%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R+   +V P GA EQHGP LP+ TD + A  +   +   LP  LPV  +PV+PIG+S EH
Sbjct: 22  REGATLVWPFGACEQHGPQLPLATDALFAERILAAVLERLPDALPVWSLPVQPIGFSPEH 81

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
           +   GT +L+    +     +   +   G++++V+LNAHGG   L+   +   R     L
Sbjct: 82  LGFAGTLSLSAELLMRLVEEVGCQLADAGVQRLVLLNAHGGQIALLQTAARSLRASRPAL 141

Query: 139 VVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL-AENFSSRQSE 195
            V     W+       +I  PE + G+H G  ETS+ML LAP LV  +   +    R   
Sbjct: 142 AVLPCFLWAGVDGIGDLIPAPELQTGLHAGLAETSLMLQLAPDLVGSERPVDGEHQRVDA 201

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
            +         G   + W  +DL+  GV+G++  A+   G  L +   N +   L  + +
Sbjct: 202 AVTPPAGWSLEGDAPWAWMSRDLSDSGVIGDSRGASRLLGAALETALVNHWCDRLERLLA 261

Query: 256 FD 257
            D
Sbjct: 262 SD 263


>gi|90655489|gb|ABD96329.1| creatininase [uncultured marine type-A Synechococcus GOM 3O6]
          Length = 276

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 112/224 (50%), Gaps = 16/224 (7%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           ++ P GA EQHGPHLP+ TD + A  +A+ + + L P LP+  +P + IG+S EH    G
Sbjct: 27  LIWPFGACEQHGPHLPLVTDALFAERIADAVLAELKPELPIWRLPTQVIGFSPEHQSFPG 86

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    I   + + + +  MG R++V+ NAHGG   L+ + + E R R  ++ V   
Sbjct: 87  TLSLSSDLLIALVVQLGEQLAAMGWRRLVLFNAHGGQIALLQVAARELRQRCPVMAVLPC 146

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
             WS       ++   E   G+H G  ETS+ML  AP LV          R  + L    
Sbjct: 147 FLWSGVEGLADLLPADELVNGLHAGLAETSLMLHQAPELVG-------DQRPKDGLPGLD 199

Query: 202 YLRA-------HGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
              A        G+    W M+DL+  GV+G++  A+ + G+ L
Sbjct: 200 SCPAPPSGWSLEGAAPSAWLMQDLSRSGVIGDSGTASAELGQAL 243


>gi|33239982|ref|NP_874924.1| creatininase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
 gi|33237508|gb|AAP99576.1| Creatinine amidohydrolase related enzyme [Prochlorococcus marinus
           subsp. marinus str. CCMP1375]
          Length = 277

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 126/258 (48%), Gaps = 10/258 (3%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A +++   +V P GA EQHGPHLP+ TDT+ A  + + +   LP  LP+  +P + IG+S
Sbjct: 24  AASKEGSTLVWPFGACEQHGPHLPLITDTLFAESILKEVFDCLPNDLPIWSLPSQSIGFS 83

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            EH+   GT +L+    ++    +   + +MG +++V  NAHGG   L+  ++ E R++ 
Sbjct: 84  PEHLSFPGTLSLSGDLMLKMISEVGKQLSEMGFQRLVFFNAHGGQIGLLQAIARELRVQC 143

Query: 136 SMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
             + V     WS     + +I   E E G+H    ETS+ML+L   LV    A  F    
Sbjct: 144 PSMAVLPCFLWSGIDSLKDLIPHKEVEQGLHAALAETSLMLSLNSDLVGE--ARPFDGDM 201

Query: 194 SEFLRNF----KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
             F +      +     G+    W  +DL+  GVVG++  +T + G  L       +I+L
Sbjct: 202 DVFDKKRILPPEGWSLEGAAPCAWLTQDLSKTGVVGDSRGSTPELGNQLRKKLVEHWIKL 261

Query: 250 LNDINSFDVSIFDKDVQK 267
              +N  D +    D QK
Sbjct: 262 F--LNLLDSNWPPIDHQK 277


>gi|260435750|ref|ZP_05789720.1| creatininase [Synechococcus sp. WH 8109]
 gi|260413624|gb|EEX06920.1| creatininase [Synechococcus sp. WH 8109]
          Length = 280

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/220 (31%), Positives = 109/220 (49%), Gaps = 8/220 (3%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V+ P GA EQHGP LP++TD + A G+ + +   L P LP+  +P + IG+S EH    G
Sbjct: 27  VIWPFGACEQHGPQLPLSTDAVFAEGILDSVLRGLEPALPIWRLPCQAIGFSPEHQNFPG 86

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    ++    +   +  MG++++V+ NAHGG   L+ + + + R     L V   
Sbjct: 87  TLSLSAPLLLDLVDQVGTQLAAMGLQRLVLFNAHGGQIGLLQVAARQLRACCPSLAVLPC 146

Query: 144 --WSRFTIPQGIIS-FPETEI--GIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
             WS     +G+    PE E+  G+H G+ ETS+ML +AP LV      +    Q     
Sbjct: 147 FLWSGV---EGVADLLPEQELAHGLHAGQAETSLMLQMAPELVGSARPVDGRPAQGSAQD 203

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
                   G+    W   DL+  GV+G+A  A+   G  L
Sbjct: 204 PPAGWSLEGAAPCAWLTDDLSATGVIGDARQASADLGRCL 243


>gi|312198439|ref|YP_004018500.1| creatininase [Frankia sp. EuI1c]
 gi|311229775|gb|ADP82630.1| Creatininase [Frankia sp. EuI1c]
          Length = 257

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 122/256 (47%), Gaps = 11/256 (4%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
           IF D   P  AD     I VLP+G+ EQHGPHLP++TD ++A  L   + +     + + 
Sbjct: 4   IFADLRAPEIADLSPGAIAVLPVGSVEQHGPHLPLSTDLVVADTLGRDVVATYGDEIDLL 63

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
            +P      S EH +  GT  L+    +     +   +    I+++V LN HGGNS L+ 
Sbjct: 64  LLPTLAYSKSNEHAWSAGTMWLSATTMLAMLDDLGRCLATTPIQRLVFLNGHGGNSALLQ 123

Query: 126 IVSTEARMRFSMLVVSTSWSRFTIP--QGIISFPETEI--GIHGGEIETSMMLALAPHLV 181
           + S + R+   +    T     ++P  QG  S P TE+  GIH G  ETS+M+ L P LV
Sbjct: 124 VASRDLRLAHGL---RTFVMHPSVPPDQGGTS-PATELGMGIHAGIEETSVMMHLRPELV 179

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           +++L    +    E L +++ +    S SFGW   D    G +G+   AT + G+     
Sbjct: 180 RLELG---TRSVPEHLASYERVGFGRSVSFGWLSDDFGTDGTIGDPTGATAEHGKQRYEA 236

Query: 242 FANCFIQLLNDINSFD 257
                   L +I  FD
Sbjct: 237 MVETAAASLREIARFD 252


>gi|218283133|ref|ZP_03489212.1| hypothetical protein EUBIFOR_01798 [Eubacterium biforme DSM 3989]
 gi|218216082|gb|EEC89620.1| hypothetical protein EUBIFOR_01798 [Eubacterium biforme DSM 3989]
          Length = 253

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 121/241 (50%), Gaps = 10/241 (4%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI-KSILPPRLPVTCMPVEPIGYSIE 77
           R++ IV++PLGA EQHG   P+ TDT+IA  + + I K +    + +   PV P+G S E
Sbjct: 18  RENTIVLIPLGALEQHGNQAPLGTDTLIAGAMCDYIEKELKDEDINLVLFPVIPVGLSTE 77

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           H    G+ T            I +++   G +K+  L  HGGN+P+ +++S E R  F +
Sbjct: 78  HKDFCGSITFKPMTYYHMLYDICESLAHHGFKKLAFLVCHGGNTPIANLISREVRSDFKV 137

Query: 138 LVVSTSWSRFTIP--QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
                +   F  P  +  IS   T    HGGE+ETSM++A+   LVK++ +E    + + 
Sbjct: 138 YPFVLNSGAFDHPDVKATISKGNT-FDFHGGEMETSMVMAIDESLVKLETSEKGILKNTA 196

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
              +  +L +       W  ++  P G+ GN   AT +KGE +L+  A   ++ L  I  
Sbjct: 197 MKAHLSWLASD------WVTEEGKPIGIGGNPSGATKEKGEIILTISAKEIVKDLILIRD 250

Query: 256 F 256
           F
Sbjct: 251 F 251


>gi|270262664|ref|ZP_06190935.1| putative creatininase [Serratia odorifera 4Rx13]
 gi|270043348|gb|EFA16441.1| putative creatininase [Serratia odorifera 4Rx13]
          Length = 293

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 127/240 (52%), Gaps = 11/240 (4%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           + + ++VLP GA EQHGPHLP + D++I++G+A    + L   +P   +P    G S EH
Sbjct: 26  KANTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARLSKDIPAYGIPPITYGKSDEH 85

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
           +   GT TLT    ++  L I +++ + G RK++++N HGG   ++ + S E R+R   +
Sbjct: 86  LNFPGTLTLTGDTLLQTVLEIAESLYRAGFRKLLMINGHGGQPQVLQMASREMRLRHGDM 145

Query: 139 VVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
           ++      F +P      +S  E ++ +H G  ET++MLALAP  V ++ A   ++   E
Sbjct: 146 IM-IPHDVFRVPNVENQFLSAQEQKMAMHAGHSETAVMLALAPECVHIEHA--VANYPPE 202

Query: 196 F-LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           F        R     +  W+  D  P GV+G+   AT ++G  +L   A  + Q + +I+
Sbjct: 203 FPCPTLSSSRP----AAAWASYDFGPSGVIGDPTGATAEQGHAILDSLAASWAQAITEIH 258


>gi|116075333|ref|ZP_01472593.1| creatininase [Synechococcus sp. RS9916]
 gi|116067530|gb|EAU73284.1| creatininase [Synechococcus sp. RS9916]
          Length = 297

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 77/251 (30%), Positives = 120/251 (47%), Gaps = 9/251 (3%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R    VV P GA EQHGPHLP+ TD + A  + +R+ + LP  LP+  +PV+ +G+S EH
Sbjct: 46  RPGSTVVWPFGAIEQHGPHLPLATDALFADRMLDRVLAQLPSDLPIWRLPVQALGFSPEH 105

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT +L     I     +   +  +G+R++V+ NAHGG   L+   + E R +   +
Sbjct: 106 AGFPGTLSLPADLLIRLVETVGLQLAALGVRRLVLFNAHGGQIGLLQAAARELRAQAPGM 165

Query: 139 VVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV----KMDLAENFSSR 192
            V     WS  +  + ++  PE   G+H G  ETS+MLAL P LV     +D      S 
Sbjct: 166 AVLPCFLWSGVSGLRELLPSPELANGLHAGLAETSLMLALEPSLVGPQRPVDGEHGNPSV 225

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
            +     +      G+    W   DL+  GVVG++  A  + G+ L     + + +L   
Sbjct: 226 AATPPEGWSL---EGAAPCAWLTSDLSVSGVVGDSRAANAELGQQLEHRVVDHWQRLFRS 282

Query: 253 INSFDVSIFDK 263
           + + D    D 
Sbjct: 283 LLASDWPPVDS 293


>gi|116072200|ref|ZP_01469467.1| creatininase [Synechococcus sp. BL107]
 gi|116064722|gb|EAU70481.1| creatininase [Synechococcus sp. BL107]
          Length = 281

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 118/246 (47%), Gaps = 6/246 (2%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V+ P GA EQHGP LP+ TD + A  +   +   L    P+  +P++ IG+S EH    G
Sbjct: 35  VIWPFGACEQHGPQLPLATDALFADRILNSVLQHLDGEWPIWRLPLQSIGFSPEHQPFPG 94

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    ++    +   +  MG+ ++V+LNAHGG   L+ + + + R+R   + V   
Sbjct: 95  TLSLSAELMLQLVDQVGGQLAAMGVERLVLLNAHGGQIGLLQVAARQLRLRCPSMGVLPC 154

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
             WS       ++   E   G+H G+ ETS+ML +AP LV      +     S  L    
Sbjct: 155 FLWSGVDGLSSLLPPEELAQGLHAGQAETSLMLHMAPELVGPSRPVDGDHGPSSPLAPPD 214

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG----EGLLSYFANCFIQLLNDINSFD 257
                G+    W   DL+  GV+G+A  A+ + G    + L+S++   F  LL+      
Sbjct: 215 GWSLEGAAPCAWLTSDLSQSGVIGDARLASAELGLELEQALISHWTQLFKSLLSSDWPPT 274

Query: 258 VSIFDK 263
            S+ D+
Sbjct: 275 ESVMDR 280


>gi|82799325|gb|ABB92251.1| creatininase [uncultured marine type-A Synechococcus 5B2]
          Length = 268

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 120/241 (49%), Gaps = 20/241 (8%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +V P GA EQHGPHLP+ TD + A  + + + + L   LP+  +P + IG+S EH    G
Sbjct: 27  LVWPFGACEQHGPHLPLATDALFAERILDVVLADLDRALPIWRLPAQAIGFSPEHQSFPG 86

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    I   + +   +  MG +++V+ NAHGG   L+ + + E R +   + V   
Sbjct: 87  TLSLSSELLIGIVVQLGAQLAGMGWQRLVLFNAHGGQIGLLQVAARELRQKCPDMAVLPC 146

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
             WS       +I   E   G+H G  ET++ML LAP LV        SSR  + L +  
Sbjct: 147 FLWSGVAGLDTLIPDVELVDGLHAGLGETALMLQLAPDLVG-------SSRPVDGLSSGD 199

Query: 202 YLRA-------HGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG----LLSYFANCFIQLL 250
             ++        G+  + W   DL+P GV+G++ DA+V  G      L+ +++  F  LL
Sbjct: 200 PTQSPPPGWSLEGAAPYTWLTDDLSPSGVIGDSRDASVALGSALEKRLVQHWSRLFDALL 259

Query: 251 N 251
            
Sbjct: 260 R 260


>gi|300783911|ref|YP_003764202.1| creatinine amidohydrolase [Amycolatopsis mediterranei U32]
 gi|299793425|gb|ADJ43800.1| creatinine amidohydrolase [Amycolatopsis mediterranei U32]
          Length = 263

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 117/238 (49%), Gaps = 7/238 (2%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS-ILPPRLPVTCMPVEPIGYSIEHMYV 81
           IVVLP GA E HGPHLP++TD +IA  +A+      +   + V  +P      S EH + 
Sbjct: 22  IVVLPTGAIEHHGPHLPLSTDALIAEAVADAAVERAVAAGVDVWQLPTLTYTKSDEHSWA 81

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM-LVV 140
            GT  L         + I  A+  MG   +V +N HGGN  L+ +   E R RF +   +
Sbjct: 82  PGTVWLDTETLFRTVVEIGRAVELMGAGTLVFVNGHGGNVALLQVALREIRKRFGLKTFL 141

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
             S +R   P G     E ++GIHGG  ETS++L L P LV +  AE +     E L +F
Sbjct: 142 MPSLARTDPPAG-EGLDERDLGIHGGAAETSLVLHLRPDLVDLSRAERWV---PEHLADF 197

Query: 201 KYLRAHGSH-SFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
           +++  +    SFGW   D    GVVG+   AT   GE L     +  ++ L +I  F+
Sbjct: 198 RHIGFNTRPVSFGWLSNDFGTPGVVGDPTQATPAYGEVLWEASVHQAVESLLEITRFE 255


>gi|318041060|ref|ZP_07973016.1| creatininase [Synechococcus sp. CB0101]
          Length = 275

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 118/234 (50%), Gaps = 10/234 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV P GA+EQHGP LP+ TD + A  L +R+   LP  LP+  +PV+ +G+S EH+   G
Sbjct: 31  VVWPFGAFEQHGPQLPLGTDALFADRLLDRVLEGLPEALPIWRLPVQNLGFSPEHLGFQG 90

Query: 84  TKTLTYAEAIEHWLAIIDA-IRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           T +L  AE +   + +I A +   G +++V+ N HGG   L+ + + + R +   L V  
Sbjct: 91  TLSLP-AELLIRQIEVIGAQLADAGFQRLVLFNGHGGQIALLQVGARQLRAQRPELAVLP 149

Query: 143 SWSRFTIPQGI---ISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
            +  ++ P GI   +  PE   G+H G  ETS+ML LAP LV  +         SE    
Sbjct: 150 CF-LWSGPDGIGELLEEPERSQGLHAGLAETSLMLQLAPELVGPE--RPVDGLLSEAPPP 206

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
              L   G+    W   DL+  GVVG++  A+ + G  L       +  LL  +
Sbjct: 207 GWSL--EGAVPEAWLTTDLSRTGVVGDSRGASAELGAALEERLVAGWRGLLEAL 258


>gi|157412947|ref|YP_001483813.1| creatininase [Prochlorococcus marinus str. MIT 9215]
 gi|157387522|gb|ABV50227.1| Creatininase [Prochlorococcus marinus str. MIT 9215]
          Length = 262

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 113/238 (47%), Gaps = 11/238 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V+ P GA EQHGPHLP+ TD+I    +   +  + PP +P+  +P + IG+S EH    G
Sbjct: 29  VIWPFGAVEQHGPHLPLATDSIFVDEIISEVFKLFPPDIPIKKLPTQYIGFSPEHKGFAG 88

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    I     +   + +MG ++++++N HGG   L++  S E R     + V   
Sbjct: 89  TISLSSNLIISMIKEVGGQLSEMGFKRLILINGHGGQISLLNTASRELRSFAPNIAVFPC 148

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF- 200
             WS       +++  E E G+H    ETS+MLAL P LV          R +E ++   
Sbjct: 149 FLWSGVDGVSELLTKTEIENGLHASLAETSLMLALKPELVG-------DERPNEIIKGQI 201

Query: 201 -KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
            +     G+    W   D +  GV+G++  A    G  L +     + +L+ ++   D
Sbjct: 202 PEGWSLEGNAPTAWLTDDFSKSGVIGDSRGANANLGNDLKNLLIGHWYKLIMNLMKSD 259


>gi|313126737|ref|YP_004037007.1| hypothetical protein Hbor_19960 [Halogeometricum borinquense DSM
           11551]
 gi|312293102|gb|ADQ67562.1| uncharacterized protein, putative amidase [Halogeometricum
           borinquense DSM 11551]
          Length = 265

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 112/239 (46%), Gaps = 19/239 (7%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH---- 78
           + V+PLG+ EQHGPHLP+ TD +IA  LA         R  V C P   +G S  H    
Sbjct: 20  LAVVPLGSTEQHGPHLPLATDHLIAEALAREAAD----RTDVLCTPTVNVGVSPHHRQFH 75

Query: 79  --MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
             M+VD  +   Y E++   LA        GI ++V +NAHGGN+  +  V    R   +
Sbjct: 76  GTMWVDAPQFRDYVESMTRNLAY------HGIDRVVYVNAHGGNAQHLREVGRRLRDDGT 129

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           M  +   W   +IP  +    E   G HGG  ET+M++ +AP LV+ D  E+        
Sbjct: 130 MYAIEWMWDE-SIPDLVNEVFEHN-GPHGGPKETAMIMHIAPELVREDRLEDARDGGLVD 187

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           L +      HG+ +F +   + +  GV G+  DAT + GE L        + L+  +N 
Sbjct: 188 LDDSDRYMKHGARTF-YDAIENSENGVFGDQTDATPETGERLFEAATEQLVHLIEWLND 245


>gi|296532243|ref|ZP_06894988.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296267428|gb|EFH13308.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 270

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 123/241 (51%), Gaps = 12/241 (4%)

Query: 14  LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG 73
           L A A +D +V+LP+ + EQHGPHLP+ TD++I      R  ++    LPV  +P   +G
Sbjct: 17  LRALAARDALVLLPVASLEQHGPHLPVWTDSLIGHAACLRAAALAS-DLPVVVLPPMWLG 75

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
            S  H+   GT +L Y         +  +++  G  ++ ++N+HGGN   +++ + E   
Sbjct: 76  LSEHHLPFGGTISLDYDAMHRVLRGVCRSLKAQGFGRLFLVNSHGGNIDPLAVAARELCA 135

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGI-HGGEIETSMMLALAPHLVKMDLAENFSSR 192
            F+M VV+ +  R  +P GI +  +T+ G+ H  E ETS+++ LAP LV+     N    
Sbjct: 136 EFAMPVVAGTVFRLDMP-GIAALLDTQPGVQHACEAETSLVMHLAPELVRRKEIAN---- 190

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPK-GVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
               L         G H F WS  +  P  GV+G+   AT +KGE LL+  A   +  + 
Sbjct: 191 ---ALSGPAVPAPEGLHRF-WSFAERAPDTGVIGDPRAATAEKGEKLLAVMAASLVAAMR 246

Query: 252 D 252
           D
Sbjct: 247 D 247


>gi|81300401|ref|YP_400609.1| creatinine amidohydrolase [Synechococcus elongatus PCC 7942]
 gi|2570206|gb|AAB82046.1| ORF271 [Synechococcus elongatus PCC 7942]
 gi|22002497|gb|AAM82649.1| creatininase [Synechococcus elongatus PCC 7942]
 gi|81169282|gb|ABB57622.1| creatinine amidohydrolase [Synechococcus elongatus PCC 7942]
          Length = 271

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 117/246 (47%), Gaps = 11/246 (4%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R   +++ P+GA EQHGPHLP+  DT IA  +       LP  +    +P    G S EH
Sbjct: 26  RDRVLIIQPIGAIEQHGPHLPLVVDTAIATAVTGEALRRLPAEIAAYALPTLCYGKSNEH 85

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT +L     +   +    ++   G R+++ LN HGG   ++ + + + R +F   
Sbjct: 86  CQFPGTISLRTETLLAVLIDSAHSLYAAGFRRLIWLNGHGGQPQVLQLAARDLREQFPGF 145

Query: 139 VVSTSWSRFTIPQGI---ISFPETEIGIHGGEIETSMMLALAPHLVKMD--LAENFSSRQ 193
            V   +  + +P  I   ++  E  +G+H G+ ETS+ML L P  V+MD  +AE      
Sbjct: 146 EVLPLFV-WNVPNQIGELLTPREQTLGLHAGDAETSLMLHLLPDQVRMDQAIAEYPPDLD 204

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
           +E L +++     G+    W   DL+  GV+G+   AT  KG  +       ++Q+L  I
Sbjct: 205 AEGLLSWE-----GNLPIAWLTHDLSQSGVIGDPTPATAAKGAEIFEQLVQGWVQVLTVI 259

Query: 254 NSFDVS 259
             +  S
Sbjct: 260 AHWQRS 265


>gi|254526539|ref|ZP_05138591.1| creatininase [Prochlorococcus marinus str. MIT 9202]
 gi|221537963|gb|EEE40416.1| creatininase [Prochlorococcus marinus str. MIT 9202]
          Length = 262

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 113/247 (45%), Gaps = 11/247 (4%)

Query: 15  CADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           C    K   V+ P GA EQHGPHLP+ TD+I    +   +  +     P+  +P + IG+
Sbjct: 20  CVAKNKRSTVIWPFGAVEQHGPHLPLATDSIFVDEIIGEVLKLFSADFPLKKLPTQYIGF 79

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           S EH    GT +L+          +   + +MG ++++++N HGG   L++  + E R  
Sbjct: 80  SPEHKGFAGTISLSSNLITSMIKEVGGQLSEMGFKRLILINGHGGQISLLNTAARELRSV 139

Query: 135 FSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
              + V     WS       +++  E E G+H    ETS+MLAL P LV          R
Sbjct: 140 VPEMTVFPCFLWSGVDGLSELLTKTEIEYGLHASLAETSLMLALKPELVG-------DER 192

Query: 193 QSEFLRNF--KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
            +E ++    +     GS    W   DL+  GV+G++  A    G+ L     N + +L+
Sbjct: 193 PNEVIKGQIPEGWSLEGSAPTAWLTDDLSKSGVIGDSRGANESLGKNLKELLINHWFKLI 252

Query: 251 NDINSFD 257
            ++   D
Sbjct: 253 MNLMQSD 259


>gi|322370445|ref|ZP_08045003.1| creatininase [Haladaptatus paucihalophilus DX253]
 gi|320549862|gb|EFW91518.1| creatininase [Haladaptatus paucihalophilus DX253]
          Length = 264

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 118/249 (47%), Gaps = 11/249 (4%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   D + P   D   ++ + V+PLG+ EQHGPHLP+ TD +IA  LA         R  
Sbjct: 1   MYLADQTWPELGDYVAEESVAVVPLGSTEQHGPHLPLATDHLIAEALAREAAD----RAG 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
             C P   +G S  HM   GT ++   +  ++  +    +   GI +IV +NAHGGN   
Sbjct: 57  YLCTPTINVGVSTHHMQFHGTMSVDPPQFRDYVESFSRNLTYHGIDRIVYVNAHGGNMQH 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V    R   +   V   W   +IP+ +    E   G HGG  ET+M++ +AP LV+ 
Sbjct: 117 LREVGRRLREDEAAFAVEWMWDE-SIPELVSDIFEHN-GPHGGPKETAMIMHIAPELVRE 174

Query: 184 DLAENFSSRQSEFLRNFK-YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           D  E  ++R    +         HG+ ++ +   D +  GV G+  DAT +KGE +    
Sbjct: 175 DKLE--AARDGGVVNLLDGNPTIHGARNY-YDAIDNSENGVFGDQTDATPEKGEEIFEAA 231

Query: 243 ANCFIQLLN 251
               +QLL+
Sbjct: 232 TEQLVQLLD 240


>gi|56750058|ref|YP_170759.1| creatinine amidohydrolase [Synechococcus elongatus PCC 6301]
 gi|56685017|dbj|BAD78239.1| creatinine amidohydrolase [Synechococcus elongatus PCC 6301]
          Length = 271

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 115/242 (47%), Gaps = 11/242 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +++ P+GA EQHGPHLP+  DT IA  +       LP  +    +P    G S EH    
Sbjct: 30  LIIQPIGAIEQHGPHLPLVVDTAIATAVTGEALRRLPAEIAAYALPTLCYGKSNEHCQFP 89

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  L     +   +    ++   G R+++ LN HGG   ++ + + + R +F    V  
Sbjct: 90  GTIRLRTETLLAVLIDSAHSLYAAGFRRLIWLNGHGGQPQVLQLAARDLREQFPGFEVLP 149

Query: 143 SWSRFTIPQGI---ISFPETEIGIHGGEIETSMMLALAPHLVKMD--LAENFSSRQSEFL 197
            +  + +P  I   ++  E  +G+H G+ ETS+ML L P  V+MD  +AE      +E L
Sbjct: 150 LFV-WNVPNQIGELLTPREQTLGLHAGDAETSLMLHLLPDQVRMDQAIAEYPPDLDAEGL 208

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
            +++     G+    W   DL+  GV+G+   AT  KG  +       ++Q+L  I  + 
Sbjct: 209 LSWE-----GNLPIAWLTHDLSQSGVIGDPTPATAAKGAEIFEQLVQGWVQVLTVIAHWQ 263

Query: 258 VS 259
            S
Sbjct: 264 RS 265


>gi|78185203|ref|YP_377638.1| creatininase [Synechococcus sp. CC9902]
 gi|78169497|gb|ABB26594.1| creatininase [Synechococcus sp. CC9902]
          Length = 284

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 116/245 (47%), Gaps = 6/245 (2%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV P GA EQHGP LP+ TD + A  +   +   L    P+  +P++ IG+S EH    G
Sbjct: 35  VVWPFGACEQHGPQLPLATDALFADRILNSVLEHLDGEWPIWRLPLQSIGFSPEHQPFPG 94

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    ++    +   +  MG+ ++V+LNAHGG   L+ + + + R+R   + V   
Sbjct: 95  TLSLSAELMLQLVDQVGGQLAAMGVERLVLLNAHGGQIGLLQVAARQLRLRCPSMGVLPC 154

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
             WS       ++   E   G+H G+ ETS+ML +AP LV      + +      L    
Sbjct: 155 FIWSGVDGLSSLLPPEELAHGLHAGQAETSLMLHMAPELVGPSRPVDGAHGPRSALAPPD 214

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG----EGLLSYFANCFIQLLNDINSFD 257
                G+    W   DL+  GV+G+A  A+ + G    + L+ ++   F  LL+      
Sbjct: 215 GWSLEGAAPCAWLTSDLSQSGVIGDARLASAELGLELEQALILHWTQRFKSLLSSDWPPT 274

Query: 258 VSIFD 262
            S+ D
Sbjct: 275 ESVVD 279


>gi|123968122|ref|YP_001008980.1| creatininase [Prochlorococcus marinus str. AS9601]
 gi|123198232|gb|ABM69873.1| Creatininase [Prochlorococcus marinus str. AS9601]
          Length = 264

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 114/238 (47%), Gaps = 11/238 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V+ P GA EQHGPHLP+ TD+I    +   +  +LP  +P+  +P + IG+S EH    G
Sbjct: 29  VIWPFGAVEQHGPHLPLATDSIFVDDIISEVFKLLPADIPLKKLPTQYIGFSPEHKGFAG 88

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+          +   + +MG ++++++N HGG   L++  + E R     + V   
Sbjct: 89  TISLSSNLITSMIKEVGGQLSEMGFKRLILINGHGGQISLLNTAARELRSFSPEMAVFPC 148

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF- 200
             WS       +++  E E G+H    ETS+MLAL P LV        + R +E ++   
Sbjct: 149 FLWSGVNGLSQLLTKTEIENGLHASLAETSLMLALKPELVG-------NERPNEGIKGQI 201

Query: 201 -KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
            +     G+    W   D +  GV+G++  A    G+ L     N + +L+ ++   D
Sbjct: 202 PEGWSLEGNAPTAWLTDDFSKSGVIGDSRGANESLGKNLKELLINHWFKLIMNLMQSD 259


>gi|167768706|ref|ZP_02440759.1| hypothetical protein ANACOL_00022 [Anaerotruncus colihominis DSM
           17241]
 gi|167669104|gb|EDS13234.1| hypothetical protein ANACOL_00022 [Anaerotruncus colihominis DSM
           17241]
          Length = 273

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 118/247 (47%), Gaps = 16/247 (6%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R     VLP+G+ EQHG HLP+ TD +I     + ++  L        +P    G S EH
Sbjct: 37  RSRLAYVLPVGSTEQHGRHLPVGTDDLILQTSLDGLEKHLKTENTFLRLPTLHYGNSFEH 96

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
           +   GT TL  A  +     ++  +++  ++ +VI+N+HGGN+P+   ++ E   RF + 
Sbjct: 97  LDFPGTVTLRTATMLAFVEDLMMCMQRHQVKYLVIVNSHGGNAPVFHAMAQEWGQRFGIR 156

Query: 139 VVSTSWSRFTIPQGIISFPETEIG--IHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           V +  +      Q      +T I   IHGGEIET+ +    P  VK D     +    E 
Sbjct: 157 VFNIDYFGSNFFQDAQPLLQTAINQDIHGGEIETAYLQYALPQTVKADFIRPENDVFVE- 215

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNP-KGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           L+N+ Y         GW  +DL P  G++G A  +T++ GE L  Y  +   +L    ++
Sbjct: 216 LKNYYY---------GWLTRDLAPGSGLLGGASRSTLETGEKLFRYVQD---KLAGYFHA 263

Query: 256 FDVSIFD 262
           FD  + D
Sbjct: 264 FDKELND 270


>gi|160935546|ref|ZP_02082921.1| hypothetical protein CLOBOL_00436 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441290|gb|EDP19000.1| hypothetical protein CLOBOL_00436 [Clostridium bolteae ATCC
           BAA-613]
          Length = 255

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 75/254 (29%), Positives = 119/254 (46%), Gaps = 28/254 (11%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAER-IKSILPPRLPVTCMPVEPIGYSI 76
           A K+ +V++P+GA EQHGPHLP+ TDTI+A  +AER  K +    +PV   P   I  S+
Sbjct: 19  AEKNAVVMIPMGAVEQHGPHLPVATDTILAQWIAERAAKEMWDKGIPVVIAPAFVIANSM 78

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
            HM+  G+ +LT    I+       AI   G RKI I+N HGGN+  + +   +      
Sbjct: 79  HHMHFSGSLSLTPGTFIQVLKEQCRAIAVQGFRKIAIINGHGGNTAPIDVALIDINQELG 138

Query: 137 MLVVSTSWSRFTIPQGIISFP---ETEIGIHGGEIETSMMLALAPHLVK---MDLAENFS 190
             V +  ++      G+   P   +    IH GE+ETS++LA    LV     +L+ N  
Sbjct: 139 FPVYNVPYT-----AGVDESPFLDKQNYMIHSGEVETSLILAYDESLVDPSYTNLSGNPG 193

Query: 191 S----RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                     L  F Y+ +H               G++G +  A+ +KG  L   +    
Sbjct: 194 GCSDYEDCGALSTFHYMESH------------TENGIMGESCAASKEKGIALADAYCKRL 241

Query: 247 IQLLNDINSFDVSI 260
           +++L+D   + V +
Sbjct: 242 VEVLSDERLWSVPV 255


>gi|126695895|ref|YP_001090781.1| creatininase [Prochlorococcus marinus str. MIT 9301]
 gi|126542938|gb|ABO17180.1| Creatininase [Prochlorococcus marinus str. MIT 9301]
          Length = 264

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 111/245 (45%), Gaps = 7/245 (2%)

Query: 15  CADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           C    K   V+ P GA EQHGPHLP+ TD+I    +   +  +    +P+  +P + IG+
Sbjct: 20  CVAKNKRSTVIWPFGAVEQHGPHLPLATDSIFVDEIISEVFKLFSADIPLKKLPTQYIGF 79

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           S EH    GT +L+          +   + +MG ++++++N HGG   L++  + E R  
Sbjct: 80  SPEHKGFAGTISLSSNLITSMIKEVGSQLSEMGFKRLILINGHGGQISLLNTAARELRSV 139

Query: 135 FSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
              + V     WS       +++  E E G+H    ETS+MLAL P LV  D        
Sbjct: 140 APGMAVFPCFLWSGVNGLSELLTKTEIEDGLHASLAETSLMLALKPELVGDD-----RPN 194

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           +   +   K     G+    W   D +  GV+G++  A    G+ L     N + +L+ +
Sbjct: 195 EGNKVEIPKGWSLEGNAPTAWLTDDFSKSGVIGDSRGANESLGKNLKELLINHWSELIMN 254

Query: 253 INSFD 257
           +   D
Sbjct: 255 LMQSD 259


>gi|148238989|ref|YP_001224376.1| creatininase [Synechococcus sp. WH 7803]
 gi|147847528|emb|CAK23079.1| Creatininase [Synechococcus sp. WH 7803]
          Length = 281

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 70/236 (29%), Positives = 109/236 (46%), Gaps = 5/236 (2%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +V P GA EQHGP LP+ TD + A  +   +   LP   P+  +P + IG S EH    G
Sbjct: 31  LVWPFGALEQHGPQLPLATDALFAERILSLVLESLPDAWPIWALPPQSIGLSPEHRGFPG 90

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    I   + + + +   G++++V+ NAHGG   L+   + E   R   + V   
Sbjct: 91  TLSLSADLLIRLVVEVGEQMADQGVKRLVLFNAHGGQIGLLQTAARELAARAPSMAVLPC 150

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
             WS     + +I   E + G+H G  ETS+MLALAP LV  +   +           + 
Sbjct: 151 FLWSGVPGLKDLIPSMELQNGLHAGLAETSLMLALAPELVGPERPCDGLDSAIPIPEGWS 210

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
                G+  + W   D++  GVVG+   A    GE L +     +I L + +   D
Sbjct: 211 L---EGAAPYAWFTADISSSGVVGDTRGADDSLGERLKTTLMAHWISLFSSLMRSD 263


>gi|323357701|ref|YP_004224097.1| amidase [Microbacterium testaceum StLB037]
 gi|323274072|dbj|BAJ74217.1| uncharacterized protein, putative amidase [Microbacterium testaceum
           StLB037]
          Length = 236

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 112/238 (47%), Gaps = 6/238 (2%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVTCMPVEPIGYSIEHMYVDG 83
           +LP GA E HGPHLP+ TD I+A   A    +      L V  +P   I  S EH +  G
Sbjct: 1   MLPTGAIEHHGPHLPLATDAIVAEASATAAVARAAAMGLDVWQLPTLSITKSDEHSWAPG 60

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T  LT    ++  + I  +I     R +V LN HGGN  L+++ + E R RF +      
Sbjct: 61  TLWLTPETMLQTVVDIGRSILTTRARTLVFLNGHGGNVALLNVANRELRRRFGLRTFFMP 120

Query: 144 WSRFTIPQGIISFP-ETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            +R     G    P E   GIH G  ETSM++ L P LV       F +     + +F++
Sbjct: 121 AARVPSFDGTDGTPDEHGTGIHAGYGETSMIMHLRPELVD---PSTFHATVPAHIGDFRH 177

Query: 203 LRAHGSH-SFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           +  +G   +FGW   D  P GV+G+   A  + G  +     +  ++ L +I+ FD +
Sbjct: 178 IGFNGKPVTFGWLSNDFGPTGVLGDPTGANAEAGARMFEDSVSFVVEALEEISRFDYT 235


>gi|269928761|ref|YP_003321082.1| Creatininase [Sphaerobacter thermophilus DSM 20745]
 gi|269788118|gb|ACZ40260.1| Creatininase [Sphaerobacter thermophilus DSM 20745]
          Length = 274

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 73/254 (28%), Positives = 121/254 (47%), Gaps = 28/254 (11%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R+D +VV+P  A E+HG HLP++TD +IA+ +A   ++ L    P   MP   IGY   H
Sbjct: 20  RRDAVVVIPTAAVEEHGHHLPLDTDVLIASHIA--TQAALRASHPCLVMPTIWIGYEGHH 77

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM-RFSM 137
           M   GT    +   I + L +  ++   G R++++LN HG N PL+ +++ +  + R   
Sbjct: 78  MDFPGTIDADWDLFIRYGLTVTRSLAHHGFRRMIVLNGHGSNRPLIEVIARQTVIERPDT 137

Query: 138 LVVSTSWSRFTIPQGIIS-FPETEIGIHGGEIETSMMLALAPHLVKMDLA---------- 186
           L  + SW   +  Q + +   E+E+  H  E+ETS  LA+ P  V+MD A          
Sbjct: 138 LCAAISWWELSDAQRVFNEMRESEVTSHACELETSAYLAIEPESVQMDKAVRDMHYDMST 197

Query: 187 ---ENFSSRQSE--FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
               +   R+ +  F    K +         WS   ++  G  G+   AT +KG  +L  
Sbjct: 198 HVWSDLMGRKPDPAFKNPVKMMEI-------WST--MSETGTRGDLTTATAEKGRLVLEA 248

Query: 242 FANCFIQLLNDINS 255
               F  L++++ S
Sbjct: 249 AIAEFAALIDELGS 262


>gi|123965830|ref|YP_001010911.1| creatininase [Prochlorococcus marinus str. MIT 9515]
 gi|123200196|gb|ABM71804.1| Creatininase [Prochlorococcus marinus str. MIT 9515]
          Length = 262

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 113/236 (47%), Gaps = 7/236 (2%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           ++ P GA EQHGPHLP+ TD+I    +   +  ++P   P+  +P + IG+S EH   DG
Sbjct: 29  IIWPFGAVEQHGPHLPLATDSIFVDEIICEVLKLIPSETPIKKLPTQYIGFSPEHKGFDG 88

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+          +   +  MG +++V++NAHGG   L++  + E R     L V   
Sbjct: 89  TISLSSNLITLMIKEVGSQLADMGFKRLVLINAHGGQISLLNTAARELRSIAPKLSVFPC 148

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
             WS       +++  E E G+H    ETS+M+AL   LV  +    F   + +    + 
Sbjct: 149 FLWSGVDGLSELLTKKEIENGLHASLAETSLMMALKSDLVGEE--RPFEEIEKQIPEGWS 206

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
                G+    W   DL+  GV+G++  +  + G  L +   N +  ++N++   D
Sbjct: 207 L---EGNAPTAWFTDDLSKSGVIGDSRGSNKELGITLKTLLTNHWYNMINNLMQSD 259


>gi|88807701|ref|ZP_01123213.1| creatininase [Synechococcus sp. WH 7805]
 gi|88788915|gb|EAR20070.1| creatininase [Synechococcus sp. WH 7805]
          Length = 281

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 113/239 (47%), Gaps = 11/239 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +V P GA EQHGP LP+ TD + A  +  R+   LP + P+  +P + IG S EH    G
Sbjct: 31  LVWPFGALEQHGPQLPLATDALFAEQILNRVLESLPAQWPIWSLPPQSIGLSPEHRGFPG 90

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+    I   + + + +    ++++V+ NAHGG   L+   + E  +R   + V   
Sbjct: 91  TLSLSADLLIRLVVEVGEQLADQEVKRLVLFNAHGGQIGLLQTAARELAVRAPSMAVLPC 150

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN---FSSRQSEFLR 198
             WS     + +I   E + G+H G  ETS+MLALAP LV ++   +   FS+   +   
Sbjct: 151 FLWSGVPGLEALIPRQELQNGLHAGLAETSLMLALAPDLVGVERPCDGLQFSTPPPD--- 207

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
                   G+    W   D++  GVVG++  A    G+ L       +  L   + + D
Sbjct: 208 ---GWSLEGAAPCAWFTADISHSGVVGDSRGADAFLGQRLREVLIEHWTGLFKSLMTSD 263


>gi|269795037|ref|YP_003314492.1| hypothetical protein Sked_17310 [Sanguibacter keddieii DSM 10542]
 gi|269097222|gb|ACZ21658.1| uncharacterized protein, putative amidase [Sanguibacter keddieii
           DSM 10542]
          Length = 266

 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 124/239 (51%), Gaps = 20/239 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY--SIEHMY 80
           + VLPLGA EQHG HLP++TD ++A+ +AE   + +        + +  + Y  S EH +
Sbjct: 28  VAVLPLGAIEQHGAHLPVSTDHLVASSVAEAAVATVAESGAAHALLLPGLAYTKSDEHHW 87

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT  L +   +   + I  ++    + +++ +N HGGNS L  +   E   RF +   
Sbjct: 88  APGTIWLGWETLMATLVDIGRSLAVSPVERLMFVNGHGGNSALGQVACRELHRRFGL--- 144

Query: 141 STSWSRFTIPQ---GIIS---FPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ- 193
            T ++  ++P+   G ++    PE   G+HGG  ETSM+L L P LV MDLA    +RQ 
Sbjct: 145 KTFFAHSSMPRDQGGGLAPDVDPENGFGVHGGRGETSMVLHLRPDLVHMDLA----TRQV 200

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG----EGLLSYFANCFIQ 248
            E +  ++++    + SFGW+  D  P GV+G+   AT   G    EG +S  A   ++
Sbjct: 201 PERMAQYEHIGFGKAVSFGWTSDDFGPGGVIGDPTGATADHGKVLFEGAVSKVAAAIVE 259


>gi|33861088|ref|NP_892649.1| creatininase [Prochlorococcus marinus subsp. pastoris str.
           CCMP1986]
 gi|33639820|emb|CAE18990.1| Creatininase [Prochlorococcus marinus subsp. pastoris str.
           CCMP1986]
          Length = 265

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 113/238 (47%), Gaps = 11/238 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           ++ P GA EQHGPHLP+ TD+I    +   +  ++P   P+  +P + IG+S EH   DG
Sbjct: 29  IIWPFGAVEQHGPHLPLGTDSIFVDEIICEVFKLIPSDTPIKKLPTQYIGFSPEHKGFDG 88

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+          +   +  MG ++++++NAHGG   L++  + E R     L +   
Sbjct: 89  TISLSSNLITLLIKEVGIQLADMGFKRLILINAHGGQISLLNTAARELRSVAPKLSIFPC 148

Query: 144 --WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF- 200
             W        +++  E E G+H    ETS+M+AL   LV          R  E ++   
Sbjct: 149 FLWKGVDGLSELLTKDEIENGLHASLAETSLMMALKSKLVG-------DERPCEGIKMQI 201

Query: 201 -KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
            K     G+    W  +DL+  GV+GN+  +  + G  L S   N + +L+ ++   D
Sbjct: 202 PKGWSLEGNAPTAWFTEDLSKSGVIGNSKGSNKELGNSLKSLLVNHWFKLIMNLMKSD 259


>gi|326331115|ref|ZP_08197412.1| creatininase [Nocardioidaceae bacterium Broad-1]
 gi|325951081|gb|EGD43124.1| creatininase [Nocardioidaceae bacterium Broad-1]
          Length = 261

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 130/259 (50%), Gaps = 12/259 (4%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
           F D + P  A+   D + VL LGA EQHGPHLP++TD +IAA  A    + +      + 
Sbjct: 8   FADLTAPEIAELPPDTVAVLGLGAIEQHGPHLPVSTDYVIAAEAASAAVAAVAEAGSASV 67

Query: 67  MPVEPIGY--SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
           + +EP+ Y  S EH +  GT  L++   +   + I  ++   GI +++ +N HGGNS L 
Sbjct: 68  VLLEPLAYTKSDEHSWSPGTIWLSWDTLMRVLVDIGRSLSASGITRLLFVNGHGGNSALG 127

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIP--QGIIS--FPETEIGIHGGEIETSMMLALAPHL 180
            + S E R +F +   +T ++  ++P  QG  S    E  +GIHGG  ETSMML L P L
Sbjct: 128 QVASRELRKQFGL---ATFFAHLSVPPDQGGTSSRADELGLGIHGGHGETSMMLHLRPEL 184

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V  +  E    +  E L  ++++      SFGW   D    G +G+   AT + G+    
Sbjct: 185 VHQERGER---KVPEQLAGYRHIGFGKPVSFGWLSDDFGTDGYLGDPTTATAEDGKARFE 241

Query: 241 YFANCFIQLLNDINSFDVS 259
                  +++ + + F  S
Sbjct: 242 AGVATLAEVIVEASRFTPS 260


>gi|292655389|ref|YP_003535286.1| creatininase [Haloferax volcanii DS2]
 gi|291371925|gb|ADE04152.1| creatininase [Haloferax volcanii DS2]
          Length = 264

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 114/236 (48%), Gaps = 22/236 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH---- 78
           + V+PLG+ EQHGPHLP+ TD +IA  LA         R    C P   +G S  H    
Sbjct: 20  LAVVPLGSTEQHGPHLPLATDHLIAEALAREAAD----RTGYLCTPTVNVGVSPHHRQFH 75

Query: 79  --MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
             M+VD  +   Y E++   LA        GI ++V +NAHGGN   +  V    R   +
Sbjct: 76  GTMWVDPPQFRDYVESLTRNLAY------HGIDRVVFVNAHGGNVQHLREVGRRLRDDGT 129

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           M  +   W   +IP  +    +   G HGG  ETSM++ +A  LV+    E  S+R    
Sbjct: 130 MYAIEWMWDE-SIPDLVTDLFD-HPGPHGGPKETSMIMHIARDLVRE--GELDSARDGGV 185

Query: 197 LR-NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
           +     +LR HG+ +F +   + +  GV G+  DA+ + GE L    A+  ++LL+
Sbjct: 186 VDLGDDHLREHGARTF-YDAIENSGNGVFGDQTDASPEAGEELFEAAADQLVRLLS 240


>gi|78778916|ref|YP_397028.1| creatininase [Prochlorococcus marinus str. MIT 9312]
 gi|78712415|gb|ABB49592.1| creatininase [Prochlorococcus marinus str. MIT 9312]
          Length = 262

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 116/248 (46%), Gaps = 13/248 (5%)

Query: 14  LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG 73
           +  D R    V+ P GA EQHGPHLP+ TD+I    +   +  +    +P+  +P + IG
Sbjct: 21  IAKDKRS--TVIWPFGAVEQHGPHLPLATDSIFVDEIISEVFKLFSSDIPLKKLPTQYIG 78

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           +S EH    GT +L+          +   + +MG ++++++N HGG   L++  + E R 
Sbjct: 79  FSPEHKGFAGTISLSSYLITSMIKEVGGQLSEMGFKRLILINGHGGQISLLNTAARELRS 138

Query: 134 RFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSS 191
               + V     WS       +++  E E G+H    ETS+MLA+ P LV          
Sbjct: 139 FAPGMAVFPCFLWSGVNGLSELLTKTEIENGLHASLAETSLMLAIKPELVG-------DE 191

Query: 192 RQSEFLRNF--KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
           R +E ++    +     G+    W  KDL+  GV+G++  A    G+ L     N + +L
Sbjct: 192 RPNEGIKGQIPEGWSLEGNAPTAWLTKDLSKSGVIGDSRGANESLGKDLKELLINHWFKL 251

Query: 250 LNDINSFD 257
           + ++   D
Sbjct: 252 IMNLMESD 259


>gi|194477335|ref|YP_002049514.1| creatininase [Paulinella chromatophora]
 gi|171192342|gb|ACB43304.1| creatininase [Paulinella chromatophora]
          Length = 268

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/227 (29%), Positives = 115/227 (50%), Gaps = 5/227 (2%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V+ P GA+EQHGPHLP+ TD+  A  + E I + +    P+  +P++ IG+S EH    G
Sbjct: 25  VIWPFGAFEQHGPHLPVCTDSCFAEMVLESIMARISSDRPIWRLPLQTIGFSPEHEEFPG 84

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +++    +     +   + K G +++++ NAHGG   L+ + + + R R+  L V   
Sbjct: 85  TLSISAELVLMLVEQVGRQLAKAGFKRLILFNAHGGQIGLLQVAARQLRARYPSLGVLPC 144

Query: 144 WSRFTIPQGIISF---PETEIGIHGGEIETSMMLALAPHLV-KMDLAENFSSRQSEFLRN 199
           +  ++ P+G+I     PE   G+H G  ETS+ML L  + V K    +   +  +  L+ 
Sbjct: 145 F-LWSGPEGLIPLLPEPERHEGLHAGLAETSLMLYLQQNKVGKSRPWDGIKNCPNPPLQP 203

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                  G+    W   DL+  GV+G++ D+    GE L +   N +
Sbjct: 204 PIGWTLEGNVPNAWLSSDLSFTGVIGDSRDSNSVLGEQLFTLLVNGW 250


>gi|284164199|ref|YP_003402478.1| creatininase [Haloterrigena turkmenica DSM 5511]
 gi|284013854|gb|ADB59805.1| Creatininase [Haloterrigena turkmenica DSM 5511]
          Length = 263

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 114/248 (45%), Gaps = 10/248 (4%)

Query: 5   IIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   + S P   D   D  + V+PLG+ EQHGPHLP  TD +IA  LA         R  
Sbjct: 1   MYLANRSWPELGDYVADESLAVVPLGSTEQHGPHLPEGTDHMIAEALAREATD----RTG 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
             C P  PIG S  H    GT  +      ++  ++   +   GI +IV +NAHGGN   
Sbjct: 57  YLCTPPIPIGVSSHHRQFPGTMWVEAPVFRDYVESLSRNLTYHGIDRIVYVNAHGGNVAH 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V        +   +   W   +IP+ I    ET  G HGG  ET+M++ +A  LV  
Sbjct: 117 LREVGRRLHDDGTAYAIEWMWDE-SIPELIEEVFETP-GPHGGPKETAMIMHIANELVHA 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D  E   +R    + ++   R HG+ +F +   + +P G+ G+  DAT + GE L     
Sbjct: 175 DRLE--EARDGGAVFDYDAERVHGATTF-YDCIENSPNGIFGDQTDATPEIGEELFEAAT 231

Query: 244 NCFIQLLN 251
           +  + LL 
Sbjct: 232 DQLVALLE 239


>gi|297155045|gb|ADI04757.1| hypothetical protein SBI_01636 [Streptomyces bingchenggensis BCW-1]
          Length = 249

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 119/241 (49%), Gaps = 30/241 (12%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS-----ILPPRLPVTCMPVEPI 72
           ARK  I VLP+G++EQHG  LP+ TDT+IA  +A+ I +     +LPP L ++C      
Sbjct: 24  ARKAGIAVLPIGSFEQHGTFLPLVTDTVIACTIAQEIAATYAVHLLPP-LTISC------ 76

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
             S EH    GT +++ A        I +++R+ GI  ++++NAHGGN  L ++V   A 
Sbjct: 77  --SHEHETWPGTVSISAATLHAVVRDIAESLRRSGIDVLILVNAHGGNYVLRNVVQESAS 134

Query: 133 M--RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
              R ++   S  W       G+ +  ++++  H GE+ETS++L   P LV+        
Sbjct: 135 TGTRMALFPGSADWDTARTGAGVQTSSQSDM--HAGEVETSILLHAHPELVRPGY----- 187

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
              S+FL   +       H     M      GV+G    AT +KG+ +L+   + F +  
Sbjct: 188 -ETSDFLAGDR------RHLLTLGMAAYTESGVIGRPSLATAEKGKEILTALVDSFAEYF 240

Query: 251 N 251
           +
Sbjct: 241 S 241


>gi|307329732|ref|ZP_07608888.1| Creatininase [Streptomyces violaceusniger Tu 4113]
 gi|306884572|gb|EFN15602.1| Creatininase [Streptomyces violaceusniger Tu 4113]
          Length = 249

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 76/254 (29%), Positives = 124/254 (48%), Gaps = 22/254 (8%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +++ T  +  + AD R D + VLP+G++EQHG  LP+ TDT+IA  +A  I +  P    
Sbjct: 12  MVLPTQTTEEVRAD-RAD-VAVLPIGSFEQHGAFLPLVTDTVIAGTIAGEIAAAYP---- 65

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V  +P   I  S EH    GT +L+ A        I D++R+ GIR ++++N HGGN  L
Sbjct: 66  VLHLPPVTISCSHEHAAWPGTVSLSAATLYAVVRDIADSLRRSGIRGLILVNGHGGNYVL 125

Query: 124 VSIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            +IV   A   F M +   S  W       G+ +   ++  +H GE+ETS++L   P LV
Sbjct: 126 RNIVQESAGGDFGMALFPGSADWDAARTRAGVRTPSNSD--MHAGELETSILLHAHPELV 183

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           +           S+++ + +       H     M      GV+G    A+  KG+ LL+ 
Sbjct: 184 RP------GHETSDWISDDR------KHLLTLGMPAYTESGVIGRPSRASAHKGKELLAG 231

Query: 242 FANCFIQLLNDINS 255
             + F + L+ + +
Sbjct: 232 LVDSFAEYLSLVGA 245


>gi|110667759|ref|YP_657570.1| creatinine amidohydrolase [Haloquadratum walsbyi DSM 16790]
 gi|109625506|emb|CAJ51933.1| creatinine amidohydrolase [Haloquadratum walsbyi DSM 16790]
          Length = 256

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 113/234 (48%), Gaps = 22/234 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH---- 78
           + V+PLG+ EQHGPHLP++TD +IA   A         R    C P   IG S  H    
Sbjct: 20  LAVVPLGSTEQHGPHLPLSTDHLIAEAFAREATD----RTGYLCTPPINIGVSPHHRQFH 75

Query: 79  --MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
             M+VD      Y E++   LA        GI +++ +NAHGGN   +  V    R   +
Sbjct: 76  GTMWVDAPVFRDYVESLTRNLAY------HGIDRVIYVNAHGGNVEHLREVGRRLRDDET 129

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD-LAENFSSRQSE 195
           +  +   W+  +IP+ + +  E + G HGG  ET+M+  L P LV  D LA+       E
Sbjct: 130 LYAIEWMWNE-SIPELVDTLFE-QNGPHGGPKETAMIQYLQPELVSTDRLADARDEGLIE 187

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
           F  +    R  GS +F  ++ + N  GV+G+  DAT +KGE +        ++L
Sbjct: 188 FTDD--NTRRFGSRTFYDAIDNTN-NGVLGDQTDATPEKGEKMFESATEQLVKL 238


>gi|269837530|ref|YP_003319758.1| Creatininase [Sphaerobacter thermophilus DSM 20745]
 gi|269786793|gb|ACZ38936.1| Creatininase [Sphaerobacter thermophilus DSM 20745]
          Length = 260

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 114/251 (45%), Gaps = 6/251 (2%)

Query: 5   IIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++  D S P   D R    +V+LP+G+ EQHGP+L +  D   +     R  + + PR+ 
Sbjct: 8   LMLADLSWPEIRDIRNQVELVLLPVGSNEQHGPNLAVKMDIAASTEFCRRASARMAPRVA 67

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G S  HM   GT TL+    ++  + +I ++   G  + +I+N HGGN P 
Sbjct: 68  VA--PPVPWGVSFHHMNFPGTITLSTETFVQVLVEVIASLHHHGFERFLIVNGHGGNIPA 125

Query: 124 VSIVSTEARMRFSM-LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           + +    AR    +  V + S+  F  P+       +E+  H  E+E +  + L P +VK
Sbjct: 126 MGVAVVRAREELDVPFVGACSYFSFPDPEIAKRHVTSEVTGHACEVEVATAMELVPDVVK 185

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
            D         +E  R F+      + S  +    +   G +G+A  AT + G  L+   
Sbjct: 186 RDALA--PGELTELAREFRREAQKYNVSIPYRFDQITRNGALGDATKATPEFGRELVESA 243

Query: 243 ANCFIQLLNDI 253
            + F++   ++
Sbjct: 244 LDNFVRFCENL 254


>gi|106364382|dbj|BAE95208.1| hypothetical conserved protein [unclutured Candidatus Nitrosocaldus
           sp.]
          Length = 273

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 124/256 (48%), Gaps = 33/256 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH--MYV 81
            +LP+G+ EQHG HLP+ TD+IIA  +A R+      RL    +P    G S EH  ++ 
Sbjct: 23  AILPIGSLEQHGKHLPLGTDSIIAEHIAARV----AERLSAILLPCIGYGISYEHEPLFN 78

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS-PLVSIVSTEAR--MRFSML 138
                 T    +E    +  ++ + G+R+I+ILNAH GN   L+S V   A+      +L
Sbjct: 79  VSISAQTLCMLVED---LCRSLAENGVRRIIILNAHYGNEYALLSCVKELAKKYKDKGIL 135

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           + S ++S F      +  P+     H GE ETS+MLA+ P LV+MD+       + E  R
Sbjct: 136 ICSITYSLF------LEEPD-----HAGESETSLMLAIRPDLVRMDVLGKGDEVRQEGYR 184

Query: 199 NFKYLRAHGSHSFGWSMKDLNP--------KGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
                R   S S   S   L P         G++G+ M A+  KG+ LL   ++  I+++
Sbjct: 185 GKGRGRDSKSDSIILSRITLLPGSIAGIARDGIIGDPMMASKDKGDALLEEISSKVIKMI 244

Query: 251 NDINSF--DVSIFDKD 264
            ++      +S  DKD
Sbjct: 245 EEVEHAYEQMSRQDKD 260


>gi|301062815|ref|ZP_07203413.1| creatininase [delta proteobacterium NaphS2]
 gi|300443077|gb|EFK07244.1| creatininase [delta proteobacterium NaphS2]
          Length = 778

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 68/216 (31%), Positives = 102/216 (47%), Gaps = 10/216 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP+GA EQHGPHLP++ D   A  LA+ +     P  P+  +P+   G S  H    
Sbjct: 541 VALLPVGAIEQHGPHLPLDCDAYDADYLAKAVAEYCDPPRPLV-LPLVSYGVSYHHEDFS 599

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT ++      +    I  +  + GI K+VI+N HGGNSP +   + +   R + +    
Sbjct: 600 GTLSVNPETLSQMVYDIGMSAVRHGITKLVIINGHGGNSPALHFAA-QMINRDAHIFTCV 658

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
                + P  I +  ET   +H GEIETS  +A  PH+V+      F  R S      +Y
Sbjct: 659 DTGESSDPD-IYAMAETPNDVHAGEIETSTTMATRPHMVRSGKIRKFVPRFSS-----RY 712

Query: 203 LRAHGSHSFGW--SMKDLNPKGVVGNAMDATVKKGE 236
           L      S GW      ++  GV+G+    +V KGE
Sbjct: 713 LDFTSRRSVGWYAHTSKISSSGVMGDPTKGSVLKGE 748


>gi|254430633|ref|ZP_05044336.1| creatininase [Cyanobium sp. PCC 7001]
 gi|197625086|gb|EDY37645.1| creatininase [Cyanobium sp. PCC 7001]
          Length = 295

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 113/236 (47%), Gaps = 14/236 (5%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V+ P GA EQHGP LP+ TD + A  +   +   LP   P+  +P++ +G+S EH    G
Sbjct: 36  VIWPWGALEQHGPQLPLGTDALFADRVVNAVLERLPQERPIWRLPLQSLGFSPEHQGFCG 95

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+ A+ I+  +A+   +   G  ++++LNAHGG   L+   + + R     + V   
Sbjct: 96  TLSLSAAQVIDLVMAVGSQLAGAGFSRLLLLNAHGGQIGLLQAAARQLRASAPQMAVLPC 155

Query: 144 WSRFTIPQGIIS-FPETEI--GIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           +  ++ P+G+    P +E   G+H    ETS+ML LA  +V          R  + L   
Sbjct: 156 F-LWSGPEGVADLLPASERAHGLHAALAETSLMLHLAAEMV-------LPERPCDGLAGP 207

Query: 201 KYLRA---HGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                    G+    W   DL+  GV+G++  A+ + G  L     + +++  + +
Sbjct: 208 APPEGWSLEGAAPCAWLSSDLSRSGVIGDSTAASAELGARLFERLVDGWVRRCDSL 263


>gi|302546633|ref|ZP_07298975.1| putative creatinine amidohydrolase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302464251|gb|EFL27344.1| putative creatinine amidohydrolase [Streptomyces himastatinicus
           ATCC 53653]
          Length = 261

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 113/233 (48%), Gaps = 24/233 (10%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+G++EQHG +LP+ TDT+IA  +A  I +  P +L      + P+  S  H + D
Sbjct: 30  VAVLPIGSFEQHGAYLPLVTDTVIACTIAREIAAAYPVQL------LPPVTVSCSHEHAD 83

Query: 83  --GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA--RMRFSML 138
             GT +++ A        I  ++R+ G+  ++++N HGGN  L +IV   A    R ++ 
Sbjct: 84  WPGTVSISAATLYSVVRDIAGSLRRSGVGSLILVNGHGGNYVLRNIVQESAGTGTRMALF 143

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
             S  W       G+ +   ++  +HGGE+ETS++L   P LV+           S+ L 
Sbjct: 144 PGSADWDTARTRAGVQTPSYSD--MHGGEVETSILLHAHPELVRPGY------ETSDCLA 195

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
           + +       H     M +    GV+G    A+  KG+ LL+     F + L+
Sbjct: 196 DDR------KHLLTLGMAEYTESGVIGRPSLASAAKGKELLAALTESFAEYLS 242


>gi|325001927|ref|ZP_08123039.1| creatinine amidohydrolase [Pseudonocardia sp. P1]
          Length = 254

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 107/224 (47%), Gaps = 6/224 (2%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +V++P GA+EQHGP LP+ TD + A  + +R+   L  R      P  P+G S  H+   
Sbjct: 23  VVLVPAGAFEQHGPGLPLATDLVRAEAVTDRVAQRLGGR--AVIGPSLPVGVSPHHLAFA 80

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L+ A         +D + + G R+I+++  HGGN   +  V+ +  +  +   +  
Sbjct: 81  GTVSLSTATFAAVLGDYVDGLYRHGWRRILVVTGHGGNDATLGTVAQD--LLVTRPDLQF 138

Query: 143 SWSRFT--IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           +WS  T      + +    E+  H G+ ET+ MLA+APHLV  D     ++R SE     
Sbjct: 139 AWSPLTPLAADVVAASGPPEVSGHSGQAETAQMLAVAPHLVHTDRLVAGTTRLSELDALG 198

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
              R  G          L+  GV+G+   A  + GE +++   +
Sbjct: 199 GLARWRGGPKLTVGYDRLSGSGVLGDPRRADPEHGEAIVTAIVD 242


>gi|292653840|ref|YP_003533738.1| creatininase [Haloferax volcanii DS2]
 gi|291369998|gb|ADE02226.1| creatininase [Haloferax volcanii DS2]
          Length = 266

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 116/243 (47%), Gaps = 12/243 (4%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A+   I+V+P+G+ EQHG HLP+ TD+++   + +         LPV   P    G+S  
Sbjct: 26  AKPGSILVIPVGSIEQHGEHLPVVTDSLLVEAMVDSAVE-QTDGLPVVVSPTVWSGFSPH 84

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRK----IVILNAHGGNSPLVSIVSTEARM 133
           H+   GT +L +    E   A ++ I   G++     ++ +N HGGN PL+  V +   +
Sbjct: 85  HLTFGGTLSLDF----ETIRATLEDIAHTGLQNDFDAVLFVNGHGGNGPLIGSVVSTVGV 140

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIG--IHGGEIETSMMLALAPHLVKMDLAENFSS 191
                V+ T++      + I +  +TE G   HGGE ETS+MLA+ P LV      N   
Sbjct: 141 ETDAEVLGTTYFELATDR-IEALRDTETGGMAHGGEFETSLMLAVRPDLVGDSSTRNGEP 199

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
               +  + + L   GS S   S    +  G +G   +A+ +KGE + S  A     LL+
Sbjct: 200 LNESYRWSGQDLLDGGSVSVYRSFDTYSETGAIGLPEEASAEKGERIRSIIAEELASLLD 259

Query: 252 DIN 254
            ++
Sbjct: 260 AVH 262


>gi|289706068|ref|ZP_06502441.1| creatininase [Micrococcus luteus SK58]
 gi|289557270|gb|EFD50588.1| creatininase [Micrococcus luteus SK58]
          Length = 251

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 113/236 (47%), Gaps = 6/236 (2%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+GA EQHG  LP+ TDT+ A G+ +R+    P    VT  P+ P G S  H  + 
Sbjct: 20  VPVLPIGALEQHGRALPVGTDTLRAEGVVDRLAQRCPEGSVVTLPPL-PYGVSPHHTRLP 78

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT T+      +  +++ +++   G + ++I+  HGGN P +++   E   R        
Sbjct: 79  GTVTVPARLYCDLLISLAESLADAGWQSLLIVTGHGGNRPALTLAQQELLSRRPDFRF-- 136

Query: 143 SWSRFT--IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           +W+  T        +   TE+  H GE ET+ +LAL P LV+ +  +  ++R  E     
Sbjct: 137 AWAPVTGLAANATRALDTTEVSGHSGEAETAQVLALRPDLVRSEDLKPGATRLDELAPAP 196

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           +  R   S S   +    +P GV+G+    T + GE +L+   +   + +  + + 
Sbjct: 197 RLSRVT-SPSLAVTFDQYHPTGVLGDPTAVTAEDGEAILAEVLDRLEEYVQSLRAL 251


>gi|331698972|ref|YP_004335211.1| Creatininase [Pseudonocardia dioxanivorans CB1190]
 gi|326953661|gb|AEA27358.1| Creatininase [Pseudonocardia dioxanivorans CB1190]
          Length = 235

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 110/231 (47%), Gaps = 20/231 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+G++EQHG HLP+ TD +IA  +AER+ +       +  +P    G S EH    
Sbjct: 17  VAVLPVGSFEQHGGHLPLTTDALIATAIAERVAT----EHGLLLLPAITFGCSHEHADFA 72

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV--STEARMRFSMLVV 140
           GT ++           + +++R  G+ K+V++NAHGGN  L ++V  +    +R ++   
Sbjct: 73  GTVSVRATTLYAIVNDVAESLRAAGVGKLVVVNAHGGNYVLGNVVQEANAGEIRMALFPQ 132

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           S  W+      G+ +    +  +HGGE ETS++LA  P +V+            +  R  
Sbjct: 133 SADWADARKHAGLTTSNHED--MHGGEAETSILLARWPEVVR------------DSYRTA 178

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
            +L     H     ++  +  GV+G    AT  KG  LL  F+      L+
Sbjct: 179 DHLADDRRHLNMLGVRGYSEDGVIGLPSLATADKGTLLLDAFSTSVAAALD 229


>gi|294632321|ref|ZP_06710881.1| creatinine amidohydrolase [Streptomyces sp. e14]
 gi|292835654|gb|EFF94003.1| creatinine amidohydrolase [Streptomyces sp. e14]
          Length = 257

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 113/232 (48%), Gaps = 24/232 (10%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R   + VLP+G++EQHG HLP+ TDT++A  +A  I +  P        P+ P+  S  H
Sbjct: 32  RARQVAVLPVGSFEQHGAHLPLATDTLVACAIAGEIAAAYP------VHPLPPVTISCSH 85

Query: 79  MYVDGTKTLTYAEAIEHWLA--IIDAIRKMGIRKIVILNAHGGNSPLVSIV--STEARMR 134
            +     T++ +    H +   I D++R+ G+  +V++N HGGN  L ++V  S+     
Sbjct: 86  EHAAWPGTVSISAVTLHAVVRDIADSLRRSGVDALVVVNGHGGNYVLGNVVQESSARGEH 145

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
            ++   +  W       G+ +   T+  +H GEIETS++L   P LVK    E +   ++
Sbjct: 146 IALFPAAEDWETARERAGVRTSLLTD--MHAGEIETSILLHAHPELVK----EGY--EKA 197

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
           +F+ + +       H     M      GV+G       +KG+ LL+  A+ F
Sbjct: 198 DFVADDRR------HLLTVGMSAYTESGVIGRPSLGDAEKGKELLASLADSF 243


>gi|220919634|ref|YP_002494937.1| Creatininase [Methylobacterium nodulans ORS 2060]
 gi|219952054|gb|ACL62445.1| Creatininase [Methylobacterium nodulans ORS 2060]
          Length = 260

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/226 (30%), Positives = 107/226 (47%), Gaps = 19/226 (8%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           AR+D IV+LP+ + EQHGPHLP   D  +   +  R   ++ P  P+   P    G +  
Sbjct: 26  ARRDAIVLLPVASTEQHGPHLPTGVDDFLGTAVCRRTAELVAPDRPIVVAPTVWCGLADH 85

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           H+   GT TL+ A        +  +I   G RK+V++N+HGGN   +S ++ E       
Sbjct: 86  HVAFGGTFTLSLATYHALLRDLCRSILAAGFRKVVLVNSHGGNITALSSLAVELTRELDA 145

Query: 138 LVVSTSWSRFTIPQGIISFPETEIG--IHGGEIETSMMLALAPHLVKMD-LAE----NFS 190
            + + ++  F      +S    + G  +H  E ETSMM+AL   LV    LAE     F 
Sbjct: 146 PIATATY--FMEAADAVSGILEDQGNVMHACEAETSMMMALDSDLVDATRLAEAHGPGFD 203

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
              S  +   K +R       GW  ++++  GV G+A  A+  KGE
Sbjct: 204 IADS-LMPTLKRVR-------GW--QEVSRGGVAGDARRASAAKGE 239


>gi|291436032|ref|ZP_06575422.1| creatininase [Streptomyces ghanaensis ATCC 14672]
 gi|291338927|gb|EFE65883.1| creatininase [Streptomyces ghanaensis ATCC 14672]
          Length = 270

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/226 (29%), Positives = 105/226 (46%), Gaps = 20/226 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+G+YEQHGP LP+ TDT++A  +A  I        PV  +P   I  S EH    
Sbjct: 37  VAVLPVGSYEQHGPFLPLATDTLVACAVAREIADA----YPVHLLPPVTISCSHEHAAWP 92

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV--STEARMRFSMLVV 140
           GT +L+          I D++R+ G+  +V++N HGGN  L ++V  S+    R ++   
Sbjct: 93  GTVSLSSVTLHAVVRDIADSLRRSGVEALVLVNGHGGNYVLGNVVQESSARGERTALFPA 152

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
              W       G+++   T+  +H GEIETS++L   P L++     + S          
Sbjct: 153 PEDWETARRRAGVVTSLLTD--MHAGEIETSILLHTHPELLRPGYETSDSVADDR----- 205

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                   H     M      GV+G     + +KG+ LL+  A+ F
Sbjct: 206 -------RHLLSLGMAAYTDSGVIGRPSLGSAEKGKKLLASLADSF 244


>gi|289582751|ref|YP_003481217.1| creatininase [Natrialba magadii ATCC 43099]
 gi|289532304|gb|ADD06655.1| Creatininase [Natrialba magadii ATCC 43099]
          Length = 273

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 107/241 (44%), Gaps = 21/241 (8%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           ++  + + V+PLG+ EQHGPHLP  TD +IA  LA         +    C P   IG S 
Sbjct: 21  ESESESLAVVPLGSTEQHGPHLPEGTDHMIAEALARAATE----QTGYLCTPPISIGVSS 76

Query: 77  EH------MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
            H      M+VD      Y E +   L         GI +IV +NAHGGN   +  V   
Sbjct: 77  HHRQFHGTMWVDAPVFRDYVENLSRNLTY------HGIDRIVYVNAHGGNVAHLREVGRR 130

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
                +   +   W   +IP  I    ET  G HGG  ET+M++ +A  LV+ D  E   
Sbjct: 131 LHQDETAYAIEWMWDE-SIPNLIEEVFETP-GPHGGPKETAMIMHIANELVREDRLEEAR 188

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
               +F  +    R HG+ +F +   + +P GV G+  DAT + GE L        + LL
Sbjct: 189 DGGVDF--DGDAARVHGATTF-YDAIENSPNGVFGDQTDATPEVGEQLFDAATEQLVALL 245

Query: 251 N 251
            
Sbjct: 246 E 246


>gi|108805932|ref|YP_645869.1| creatininase [Rubrobacter xylanophilus DSM 9941]
 gi|108767175|gb|ABG06057.1| Creatininase [Rubrobacter xylanophilus DSM 9941]
          Length = 252

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 104/231 (45%), Gaps = 18/231 (7%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V+LPLGA EQHGPHLP+ TDT+ A  LAE +   LP  L     P  P G S EH    G
Sbjct: 24  VILPLGATEQHGPHLPLGTDTVRAGALAELLAERLPGAL---VAPALPFGCSDEHAGFPG 80

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
              +         +         G R++V+L+AHGGN   +++     R     L V + 
Sbjct: 81  LLGVEKETLARLLVEAARRAAAWGARRLVLLSAHGGNGEALALAREALRRELPQLAVWSE 140

Query: 144 WSRFTIPQGIIS------FPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
               +    + S       PE E+G+H GE ETS ML+L P LV+ D A    +   +  
Sbjct: 141 EDLLSPSPALASVARREGIPEGELGLHAGEGETSEMLSLRPDLVRRDRARPGYT--GDMG 198

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
              + LR+ G       ++  +  GV+G+   A   +G+  L   A    +
Sbjct: 199 AVVEALRSGG-------LRAAHESGVLGDPTRAEAGRGDAYLEARAEELAR 242


>gi|240172706|ref|ZP_04751365.1| creatininase [Mycobacterium kansasii ATCC 12478]
          Length = 246

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 69/233 (29%), Positives = 107/233 (45%), Gaps = 22/233 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+GA+EQHGP+LP+ TDT+IA  +   I         V  +P    G S EH    
Sbjct: 20  IAVLPVGAFEQHGPYLPLGTDTLIACAVTTAITK----HHRVLQLPPVTFGCSHEHAAYP 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV----STEARMRFSML 138
           GT ++  A        I  ++    IR ++++NAHGGN+ L ++V     +  +++  + 
Sbjct: 76  GTVSIGAATLTAIVTDITQSLTHQQIRGLIVVNAHGGNAVLTNVVQHANQSAHQLKLGLY 135

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
                W+      G+ S    +  +H GE+ETS++LA  P  ++   A   SS  S   R
Sbjct: 136 PSREDWAEARTAAGVTSSNHDD--MHAGELETSILLAAHPDYLRDGWA---SSDHSATDR 190

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
             +YL   G       +    P GV+G    AT  KG   L +       L++
Sbjct: 191 --RYLTTLG-------IGPYTPTGVIGYPSQATAAKGRAALDHLGRNVATLID 234


>gi|159037584|ref|YP_001536837.1| creatininase [Salinispora arenicola CNS-205]
 gi|157916419|gb|ABV97846.1| Creatininase [Salinispora arenicola CNS-205]
          Length = 238

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 110/235 (46%), Gaps = 30/235 (12%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGL----AERIKSILPPRLPVTCMPVEPIGY 74
           R   + VLP+G++EQHG HLP+ TDT++A  +    AER    L P + ++C        
Sbjct: 15  RAASVAVLPVGSFEQHGAHLPLVTDTVVACAIAKAVAERYDLFLLPPVTISC-------- 66

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM- 133
           S EH    GT +++        + I  ++R  GI ++ ++N HGGN  L ++V  EA + 
Sbjct: 67  SHEHAAWRGTVSISATTLTAVVVDIARSLRASGIHRLAVINGHGGNYALANVVQ-EANVA 125

Query: 134 --RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSS 191
               ++      W    +  G+ S    +  +H GE+E S++L +AP +V+    + F  
Sbjct: 126 GPAMTLFPTRADWDDARVAAGMHSTAHQD--MHAGELEVSLLLHVAPEVVR----DGF-- 177

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
            Q++ L + +       H     M      GV+G    AT  KG+ +L      F
Sbjct: 178 EQADHLADDR------RHLLTRGMDGYTTSGVIGLPSHATTAKGKAVLEALVRSF 226


>gi|302555376|ref|ZP_07307718.1| creatininase [Streptomyces viridochromogenes DSM 40736]
 gi|302472994|gb|EFL36087.1| creatininase [Streptomyces viridochromogenes DSM 40736]
          Length = 242

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 111/228 (48%), Gaps = 24/228 (10%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+G++EQHGP+LP+ TDT++A  +A  I    P  L      + P+  S  H +  
Sbjct: 24  VAVLPVGSFEQHGPYLPLATDTLVACAVAREIAGAYPVHL------LPPVTISCSHEHAG 77

Query: 83  GTKTLTYAEAIEHWLA--IIDAIRKMGIRKIVILNAHGGNSPLVSIV--STEARMRFSML 138
              T++ +    H +   I  ++R+ G+  +V++N HGGN  L ++V  S+    R ++ 
Sbjct: 78  WPGTVSISSVTLHAVVRDIAASLRRSGVDALVVVNGHGGNYVLGNVVQESSARGERMALF 137

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
             +  W       G+++   T+  +H GEIETS++L   P +++           S+F+ 
Sbjct: 138 PAAEDWEAARERAGVVTSLLTD--MHAGEIETSILLHAHPEMLRPGY------ETSDFVA 189

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
           + +       H     M      GV+G     + +KG+ LL+  A+ F
Sbjct: 190 DDR------RHLLTLGMSGYTDSGVIGRPSLGSAEKGKELLASLADSF 231


>gi|111225224|ref|YP_716018.1| putative creatininase [Frankia alni ACN14a]
 gi|111152756|emb|CAJ64499.1| Conserved hypothetical protein; putative Creatininase [Frankia alni
           ACN14a]
          Length = 227

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 112/232 (48%), Gaps = 28/232 (12%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           +LPLG+ EQHGPHLP++TDT IA+ +A  +   L P L    +   P G S EH    GT
Sbjct: 1   MLPLGSTEQHGPHLPLDTDTRIASAVAHGLAQRLEPLLVGAAL---PYGASGEHAGFPGT 57

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVS---IVSTEARMRFSMLVV 140
            +L         + ++ ++     R +V++N HGGN + L S   I++ E R  F     
Sbjct: 58  VSLGTQVLERVVVELVRSVDDT-ARAVVLVNGHGGNIAALRSARRILAGEGRPVF----- 111

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
              W+        +  P  +  +H G  ETS++L LAP LV++DLA    S       + 
Sbjct: 112 --LWAPVAALAATVGVPAADRDLHAGRGETSLLLHLAPDLVRLDLAVAGPS------PSL 163

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
             L A G       +  L+P GV+G+   A+  +G  LL  + +  ++ L D
Sbjct: 164 AELLARG-------VAALSPSGVLGDPAGASAAEGARLLDAYVDDAVERLLD 208


>gi|284044394|ref|YP_003394734.1| creatininase [Conexibacter woesei DSM 14684]
 gi|283948615|gb|ADB51359.1| Creatininase [Conexibacter woesei DSM 14684]
          Length = 259

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 81/158 (51%), Gaps = 8/158 (5%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+GA EQHGPHLP  TD ++A  +A      LP  +     P    G S  H+   
Sbjct: 22  VAVLPVGAVEQHGPHLPTGTDALVAGAVARAACERLPDGVTALLAPTLAYGSSDHHLPFG 81

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L+ A        ++ ++R  G  + +I+NAHGGN+ +   V+  A +   ML  + 
Sbjct: 82  GTLSLSPATLAAVLGDLLRSLRAGGCERALIVNAHGGNAEICGAVAQAAAIEHDMLAAAV 141

Query: 143 SWSRFTIPQGIIS---FPETEIGIHGGEIETSMMLALA 177
           S+ R + P   ++   FP      H G  ETS++LALA
Sbjct: 142 SYWRVSAPPATLAGWPFPG-----HAGAYETSLVLALA 174


>gi|325968777|ref|YP_004244969.1| creatininase [Vulcanisaeta moutnovskia 768-28]
 gi|323707980|gb|ADY01467.1| Creatininase [Vulcanisaeta moutnovskia 768-28]
          Length = 239

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 114/241 (47%), Gaps = 24/241 (9%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D  KD ++++P+G+ EQHGPHLP+ TD+IIA  +AE ++  LP R  V   PV  +G S+
Sbjct: 10  DVPKDSLIIVPIGSVEQHGPHLPLGTDSIIANYVAEEVERRLPSR--VLLYPVIAVGSSM 67

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE--ARMR 134
           EH+   GT  + +   I + L  I+ +       +V +N HGGN   ++IV  E     R
Sbjct: 68  EHVGFTGTTWVRFENLIHYILDFIEGVSAWDPVGVVFVNGHGGNVDALNIVVKEWNYSRR 127

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
              +    +++R  I      FP      H   +ETS++ A+   LV+ D   N      
Sbjct: 128 NPRIYHYYAYNRRVIDFITRYFPSFG---HADAVETSLIAAINRDLVRWDRIINV----- 179

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKK--GEGLLSYFANCFIQLLND 252
           +   N   +R            D++  GVVG+     VK   G  +L +  N  ++ + D
Sbjct: 180 DVSGNINIVRT----------IDVSRTGVVGSLSRDLVKPEVGSEILRFMVNDILRQIQD 229

Query: 253 I 253
           I
Sbjct: 230 I 230


>gi|16554502|ref|NP_444226.1| putative amidase [Halobacterium sp. NRC-1]
          Length = 275

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 111/246 (45%), Gaps = 9/246 (3%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   D + P   D    + + ++PLG+ EQHGPHLP +TD  IA   A  +      R  
Sbjct: 18  VYLADEAWPELGDYFDAESLALVPLGSTEQHGPHLPESTDHRIAEAFARTVAD----RTG 73

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V C P   +G S  H    GT  +      ++  +    +   GI ++V +NAHGGN   
Sbjct: 74  VLCTPPVNVGVSPHHRQFPGTMWVEPPVFRDYVASFTRNLAFHGIDRVVFVNAHGGNVSH 133

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V    R   ++  V   W   +IP+ ++     + G HGG  ET++M  L    V  
Sbjct: 134 LREVGRRLRDEGTLYAVEWMWDE-SIPE-LVDEVFDQNGPHGGPKETALMQYLDGEHVHD 191

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D  E+        + +   ++ HGS +F +   D    GV+G+  DAT + GE L    +
Sbjct: 192 DRLEDARDGGVASVADADTIK-HGSRTF-YDAIDNTDNGVLGDQTDATAETGERLFEAAS 249

Query: 244 NCFIQL 249
           +  +QL
Sbjct: 250 DQLVQL 255


>gi|323357094|ref|YP_004223490.1| amidase [Microbacterium testaceum StLB037]
 gi|323273465|dbj|BAJ73610.1| uncharacterized protein, putative amidase [Microbacterium testaceum
           StLB037]
          Length = 264

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/229 (31%), Positives = 110/229 (48%), Gaps = 20/229 (8%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A ++ + ++P+GA EQHGPHLP+ TDT IAA  A    +     +    +P  P G+S E
Sbjct: 11  AAREGVALVPIGATEQHGPHLPVTTDTTIAAAFATAAAARAAKEVATWVLPPLPFGFSPE 70

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRK----MGIRKIVILNAHGGNSPLVSIVSTEARM 133
           H    GT  L+     +  LAI D I +     GIR+++ +N HGGN  L+ +   + R 
Sbjct: 71  HAGRPGTIALSP----QTLLAIADDIGRGVAASGIRRLLFVNGHGGNPELLHVACRQLRE 126

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPET-EIGIHGGEIETSMMLALAPHLVKMDLA-----E 187
           R  +   +       +P  +     T ++  H G  ETS++LAL P  V+MD A     E
Sbjct: 127 RRGLAAFAVHVPGLALPPELAEGVTTGDLDAHAGHYETSVLLALDPAAVEMDAARADGLE 186

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
              +      R F      G+ S  W + DL+  GV+G+   A  + GE
Sbjct: 187 EVRAAADSLTRPF------GAVSVPWHVDDLSRSGVIGDPTTADARWGE 229


>gi|297203665|ref|ZP_06921062.1| creatininase [Streptomyces sviceus ATCC 29083]
 gi|197717120|gb|EDY61154.1| creatininase [Streptomyces sviceus ATCC 29083]
          Length = 255

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 109/228 (47%), Gaps = 24/228 (10%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+G++EQHGP+LP+ TDT++A  +A  I +  P  L      + P+  S  H +  
Sbjct: 33  VAVLPVGSFEQHGPYLPLATDTLVACAVAREIAAAYPVHL------LPPVTMSCSHEHAA 86

Query: 83  GTKTLTYAEAIEHWLA--IIDAIRKMGIRKIVILNAHGGNSPLVSIVS-TEAR-MRFSML 138
              T++ +    H +   I  ++R+ G+  +V++N HGGN  L ++V    AR  R ++ 
Sbjct: 87  WPGTVSISAVTLHSVVQDIAASLRRSGVEALVVVNGHGGNYVLGNVVQEASARGERMALF 146

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
             +  W       G+++   T+  +H GEIETS++L   P  ++           S+F+ 
Sbjct: 147 PAAEDWETARTEAGVVTSLLTD--MHAGEIETSILLHTHPESLRPGY------ETSDFVA 198

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
           + +       H     M      GV+G     + +KG+ LL   A  F
Sbjct: 199 DDR------RHLLTLGMSGYTDSGVIGRPSLGSAEKGKALLESLAASF 240


>gi|169236430|ref|YP_001689630.1| creatininase [Halobacterium salinarum R1]
 gi|167727496|emb|CAP14284.1| creatininase [Halobacterium salinarum R1]
          Length = 258

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/227 (29%), Positives = 105/227 (46%), Gaps = 8/227 (3%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + ++PLG+ EQHGPHLP +TD  IA   A  +      R  V C P   +G S  H    
Sbjct: 20  LALVPLGSTEQHGPHLPESTDHRIAEAFARTVAD----RTGVLCTPPVNVGVSPHHRQFP 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  +      ++  +    +   GI ++V +NAHGGN   +  V    R   ++  V  
Sbjct: 76  GTMWVEPPVFRDYVASFTRNLAFHGIDRVVFVNAHGGNVSHLREVGRRLRDEGTLYAVEW 135

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W   +IP+ ++     + G HGG  ET++M  L    V  D  E+        + +   
Sbjct: 136 MWDE-SIPE-LVDEVFDQNGPHGGPKETALMQYLDGEHVHDDRLEDARDGGVASVADADT 193

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
           ++ HGS +F +   D    GV+G+  DAT + GE L    ++  +QL
Sbjct: 194 IK-HGSRTF-YDAIDNTDNGVLGDQTDATAETGERLFEAASDQLVQL 238


>gi|300790153|ref|YP_003770444.1| creatinine amidohydrolase [Amycolatopsis mediterranei U32]
 gi|299799667|gb|ADJ50042.1| creatinine amidohydrolase [Amycolatopsis mediterranei U32]
          Length = 232

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 111/237 (46%), Gaps = 28/237 (11%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R+  + VLP+G++EQHG HLP+ TDT+IAA LA  +    P       + + PI  S  H
Sbjct: 16  RRASVAVLPVGSFEQHGAHLPLATDTVIAATLAGAVAEAYP------VLHLPPITISCSH 69

Query: 79  MYVDGTKTLTYAEAIEHWLA--IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
            +     T++ +    H +   +  +++  G+ ++V++N HGGN  L ++V  EA    +
Sbjct: 70  EHAGWAGTVSISARTLHAVVTDVAASLKASGVDRLVLVNGHGGNYVLSNVVQ-EAAGAMA 128

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK--MDLAENFSSRQS 194
           +      W       G+ +  + +  +H GE+ETS++L   PHLV+   + A++ + R+ 
Sbjct: 129 LFPGVADWQAAHTAAGLRTSLDDD--MHAGELETSILLHAHPHLVRPGHETADHVTDRE- 185

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                         H     ++     GVVG    A+  KG  +L      F  +L 
Sbjct: 186 --------------HLLTLGLRAYTESGVVGRPSLASAAKGHVVLDTLVQRFAGVLE 228


>gi|29828334|ref|NP_822968.1| hypothetical protein SAV_1792 [Streptomyces avermitilis MA-4680]
 gi|29605437|dbj|BAC69503.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 266

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 113/240 (47%), Gaps = 20/240 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+G++EQHG  LP+ TDT++A  +A  + +      PV  +P   I  S EH    
Sbjct: 33  VAVLPVGSFEQHGAFLPLATDTLVACAIAREVAAA----YPVHLLPPVTISCSHEHAAWP 88

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA--RMRFSMLVV 140
           GT +++          I D++R+ G+  +V++NAHGGN  L ++V   A    R ++   
Sbjct: 89  GTVSISSVTLHAVVRDIADSLRRSGVETLVLVNAHGGNYVLGNVVQESAGSGTRMALFPA 148

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
              W       G+ +   ++  +H GEIETS++L   P LV+           ++FL + 
Sbjct: 149 PEDWDAARERAGVQTSLLSD--MHAGEIETSILLHTHPELVRPGY------ETTDFLVDD 200

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
           +       H     M      GV+G    A+ +KG+ LL+   + F    + + S   ++
Sbjct: 201 R------RHLLTLGMSAYTESGVIGRPSLASAEKGKQLLAGLVDSFEPYFSLVTSESATV 254


>gi|119952517|ref|YP_949922.1| putative creatinine amidohydrolase [Arthrobacter aurescens TC1]
 gi|119951647|gb|ABM10557.1| putative creatinine amidohydrolase [Arthrobacter aurescens TC1]
          Length = 233

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 94/174 (54%), Gaps = 18/174 (10%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS-----ILPPRLPVTCMPVEPI 72
           AR   I VLP+G++EQHG HLP+ TD+I+A  +AE + S     +LPP + ++C      
Sbjct: 14  ARNASIAVLPIGSFEQHGSHLPLATDSIVACAVAEAVSSQYDLMLLPP-VTISC------ 66

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE-- 130
             S EH    GT +++ A        +  ++ + G+RK+V+++ HGGN  L ++      
Sbjct: 67  --SHEHSDFAGTVSISAATLYAVVKDVAASLDQRGVRKLVLVSGHGGNYVLGNVAQEGNV 124

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
              R ++      W +     G+ +    +  +HGGE+ETS++L +AP LV+ D
Sbjct: 125 GTCRMALFPHRDDWEQARKAGGLTTSNHED--MHGGELETSILLHVAPELVRGD 176


>gi|302526436|ref|ZP_07278778.1| conserved hypothetical protein [Streptomyces sp. AA4]
 gi|302435331|gb|EFL07147.1| conserved hypothetical protein [Streptomyces sp. AA4]
          Length = 229

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 115/237 (48%), Gaps = 34/237 (14%)

Query: 7   FTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
             D S P  A+ A    I+ +PLGA EQHGPHLP++TDT IA  L ER+ +    R  V 
Sbjct: 3   LADLSSPDVAEYAASGAILAVPLGATEQHGPHLPLSTDTDIATALCERLAA---ERSDVL 59

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMG--IRKIVILNAHGGNSPL 123
             P  P G S EH    GT ++  A A E  L +++  R  G   R+++ ++AHGGN+  
Sbjct: 60  VAPAVPYGSSGEHAGFAGTLSIGQA-ATE--LLLVELGRSAGETFRRLLFVSAHGGNA-- 114

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
            S+    A +R     VS    R+   QG           H G  ET++ LAL P  V++
Sbjct: 115 ASVTRAAATLRAESRDVSVFEPRW---QG---------DPHAGRPETALQLALRPEKVRL 162

Query: 184 DLAENFSSRQ-SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           D A    +R  SE L     LR  G       ++ +   G++G+   AT  +G+ LL
Sbjct: 163 DKAVPGDTRPLSELL---PILRKGG-------VRAVTDTGILGDPTGATADEGQDLL 209


>gi|300709806|ref|YP_003735620.1| creatinine amidohydrolase [Halalkalicoccus jeotgali B3]
 gi|299123489|gb|ADJ13828.1| creatinine amidohydrolase [Halalkalicoccus jeotgali B3]
          Length = 255

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 109/245 (44%), Gaps = 12/245 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + ++PLG+ EQHGPHLP  TD IIA  LA         R    C P   +G S  H    
Sbjct: 20  LALVPLGSTEQHGPHLPEGTDHIIAESLARAAAD----RTGYLCTPTVNVGVSPHHRQFH 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  +      ++  +++  +   GI ++V +NAHGGN   +  V      R     +  
Sbjct: 76  GTMWVDAPVFRDYVESLVSNLTYHGIDRVVFVNAHGGNITHLREVGRRLHDREEAYAIEW 135

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W   +IP  +    E + G HGG  ET+M+  LA  LV+ D  E+       F  +  +
Sbjct: 136 MWDE-SIPTLVSELFE-QNGPHGGPKETAMIQHLAGELVREDRLEDAHEGGVVFPTDDSH 193

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFD 262
              +G+ +F +   D +  GV G+  DAT +KG+ L   F     QL       D   F+
Sbjct: 194 --RNGARTF-YDCIDNSANGVFGDQTDATAEKGKRL---FEAATEQLCELCEWLDEQPFE 247

Query: 263 KDVQK 267
             V K
Sbjct: 248 DLVAK 252


>gi|325675411|ref|ZP_08155095.1| creatininase [Rhodococcus equi ATCC 33707]
 gi|325553382|gb|EGD23060.1| creatininase [Rhodococcus equi ATCC 33707]
          Length = 230

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 102/222 (45%), Gaps = 26/222 (11%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R D  V +P+G++EQHGPHLP++TDT IA  L   +   L     V   P    G S EH
Sbjct: 13  RDDLTVAVPVGSFEQHGPHLPLDTDTRIATALTGAVAGAL---TGVVTAPAITYGASGEH 69

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT ++   EA+E  L           R++V +N HGGN P  ++V T   +R+   
Sbjct: 70  EGFAGTISIGT-EALEALLVEYGRSACRWARRVVFVNGHGGNGP--ALVKTVELLRYEGR 126

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
               +W    +P             H G  ETS++L L+P  V MD AE  ++     L 
Sbjct: 127 --DAAWLPCAVPG---------ADAHAGRTETSLLLHLSPADVAMDRAEPGNTAPIADL- 174

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
               LR+ G       M    P G++G+   AT ++GE L +
Sbjct: 175 -MPQLRSGG-------MLAATPNGILGDPTGATAEEGERLFA 208


>gi|269126965|ref|YP_003300335.1| Creatininase [Thermomonospora curvata DSM 43183]
 gi|268311923|gb|ACY98297.1| Creatininase [Thermomonospora curvata DSM 43183]
          Length = 252

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 119/260 (45%), Gaps = 38/260 (14%)

Query: 12  LPLCADA----RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP-RLPVTC 66
           LPL   A    R+  + +LP+G++EQHGP+LP+ TDT++A  +A  + +     RLP   
Sbjct: 10  LPLSTSAEEGERRAAVALLPVGSFEQHGPYLPLATDTVVACTIAGALAAAYRVLRLP--- 66

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLA--IIDAIRKMGIRKIVILNAHGGNSPLV 124
               PI  S  H +     T++ + A  H L   +  ++R+ GI K+V++N HGGN  L 
Sbjct: 67  ----PITISCSHEHEGWPGTVSISAATLHALVGDVAASLRRAGIGKLVVVNGHGGNYVLG 122

Query: 125 SIVSTEARMRFSMLVVS-----TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           ++V  EA       V++       W       G+ +   ++  +H GE+ETS++L   PH
Sbjct: 123 NVVQ-EANAAAGEPVMALFPGPQEWESAMAAAGVQTSAWSD--MHAGELETSLLLHAHPH 179

Query: 180 LVK--MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
           LV+   +  ++    +   L                 M      GVVG    A+ +KGE 
Sbjct: 180 LVRPGYEAGDHLCDDRRHLLT--------------LGMAGHTRSGVVGRPSLASARKGEK 225

Query: 238 LLSYFANCFIQLLNDINSFD 257
           +L +    F   L  +   D
Sbjct: 226 VLGHLVELFADCLAVLGGPD 245


>gi|239834637|ref|ZP_04682965.1| Hypothetical protein OINT_2001494 [Ochrobactrum intermedium LMG
           3301]
 gi|239822700|gb|EEQ94269.1| Hypothetical protein OINT_2001494 [Ochrobactrum intermedium LMG
           3301]
          Length = 286

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 113/234 (48%), Gaps = 10/234 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP+G+ EQHGPHLP+ TDT  A+  A R   ++   +PV  +P + +G S  H+   
Sbjct: 37  LAILPVGSLEQHGPHLPVITDTTSASAAAIRAARLVAEEIPVAVLPGQWLGMSEHHLPFG 96

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL Y         I  +++ +G  +++I+N HGGN   +S+   E  + F+M +V+T
Sbjct: 97  GTITLDYDTFSRVIRCIARSLKTLGFSRLLIVNGHGGNIDPLSVAVRELAVEFAMPIVAT 156

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD-LAENFSSRQSEFLRNFK 201
           +       +    F       H  E E S+MLA+    V+ D   + F ++Q        
Sbjct: 157 TPWMLAGDEARKIFEVDNGPHHACEGEASVMLAIVGDAVRTDKFGQAFGNQQHP------ 210

Query: 202 YLRAHGSHSFGWSMKDLNP-KGVVGNAMDATVKKGEGLLSYFANCFIQLL-NDI 253
            +      S  +S  +  P  G  G+   AT +KGE  L   A   ++L+ ND+
Sbjct: 211 -VDVPADVSRFYSFAERAPVTGTWGDPRSATAEKGERFLDLHARELVKLIRNDV 263


>gi|326445231|ref|ZP_08219965.1| creatininase [Streptomyces clavuligerus ATCC 27064]
          Length = 243

 Score = 89.0 bits (219), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 114/249 (45%), Gaps = 37/249 (14%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS-----ILPPRLPVTCMPVEPIG 73
           R   I VLP+G++EQH  HLP+ TDT++AA +A  +       +LPP + ++C       
Sbjct: 7   RNASIAVLPVGSFEQHAAHLPLTTDTLVAAAIAREVADAYGLFLLPP-VTISC------- 58

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
            S EH    GT +++          I  ++   GIR++V++N HGGN  L +IV  EA  
Sbjct: 59  -SHEHAAWPGTVSISATTLTAVVGDIARSLEGSGIRRLVLVNGHGGNYVLSNIVQ-EANA 116

Query: 134 -------RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
                  R ++      W+      G+ +    +  +H GEIETS++L L P  V+    
Sbjct: 117 HPGPGGPRMALFPRPEDWNTAREAAGLTTTAHED--MHAGEIETSLLLHLHPTQVR---- 170

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                R ++ L +  +L  HG       ++     GVVG    AT  KG+ +L      F
Sbjct: 171 --DGYRDADHLADRPHLLVHG-------LRPYTLTGVVGCPSLATATKGKTILHTLTTAF 221

Query: 247 IQLLNDINS 255
              L  + +
Sbjct: 222 QDTLAALTT 230


>gi|330834690|ref|YP_004409418.1| creatininase [Metallosphaera cuprina Ar-4]
 gi|329566829|gb|AEB94934.1| creatininase [Metallosphaera cuprina Ar-4]
          Length = 229

 Score = 88.6 bits (218), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 93/176 (52%), Gaps = 20/176 (11%)

Query: 14  LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG 73
           L  ++ K  I +LP+G+ EQHGPHLPM TD+I+A  +A+ +  +    L     P    G
Sbjct: 6   LTKESLKASIGLLPIGSVEQHGPHLPMGTDSIVAESVAQEVDKLERDTL---LFPTVYYG 62

Query: 74  YSIE-----HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
            SIE     H+ V+    +++         ++D+ +++GI+ ++++N HGGNS L+ +VS
Sbjct: 63  CSIEHGNLPHVSVNDLNFMSFV------YDLLDSTKRLGIKGVILINGHGGNSELLQVVS 116

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
              ++ F+++            +    F +    +H G +ETS+M  L P LVK D
Sbjct: 117 --RKVNFTLMRPKVKVVNLLSLEEFKRFDD----LHAGTVETSLMKFLRPELVKED 166


>gi|21224950|ref|NP_630729.1| hypothetical protein SCO6654 [Streptomyces coelicolor A3(2)]
 gi|289767779|ref|ZP_06527157.1| creatininase [Streptomyces lividans TK24]
 gi|3334785|emb|CAA19933.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)]
 gi|289697978|gb|EFD65407.1| creatininase [Streptomyces lividans TK24]
          Length = 273

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 111/226 (49%), Gaps = 20/226 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+G++EQHGP+LP+ TDT++A  +A  +        PV  +P   IG S EH    
Sbjct: 31  VAVLPVGSFEQHGPYLPLATDTLVACAVARAVADA----YPVHLLPPVTIGCSHEHADWP 86

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV--STEARMRFSMLVV 140
           GT +++          I D++R+ G+  +V++N HGGN  L ++V  S+    R ++   
Sbjct: 87  GTVSISAVTLHAVVRDIADSLRRSGVGALVVVNGHGGNYVLGNVVQESSARGERMALFPA 146

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           +  W       G+++   T+  +H GEIETS++L   P LV+           ++F+ + 
Sbjct: 147 AEDWETARRRAGVVTSLLTD--MHAGEIETSILLHKHPELVRPGY------EAADFVADD 198

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
           +       H     M      GV+G     + +KG+ LL   A+ F
Sbjct: 199 RR------HLLSLGMSAYTDSGVIGRPSLGSAEKGKELLESLADSF 238


>gi|149174398|ref|ZP_01853025.1| creatinine amidohydrolase [Planctomyces maris DSM 8797]
 gi|148846943|gb|EDL61279.1| creatinine amidohydrolase [Planctomyces maris DSM 8797]
          Length = 250

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 106/226 (46%), Gaps = 15/226 (6%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           +R++ +V+LP+ A EQHGPH+P  TD II   +AE+++  L  +  +  +P   +G S  
Sbjct: 15  SREETLVILPIAAVEQHGPHMPTGTDDIICTAVAEKVEERLKEK--IVLLPTLWLGASQH 72

Query: 78  HMYVDGTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF- 135
           H+    T T +  E  E  L  I +++ K G R+++ILN HGGN   + I     ++ F 
Sbjct: 73  HLRWGATLT-SRVENYETLLCEICESLLKDGFRRVMILNGHGGNIGPMQIALRRLQVDFP 131

Query: 136 -SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
              L+ ++ WS        +   + +   H  E ETS+++ L P LV+    ENF     
Sbjct: 132 NCQLLAASYWSIAEEEIASVMQGDCKTVGHACEAETSLIMYLRPELVRSARVENFDDYAP 191

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           + +      R          M      G  G    A+ +KG+ + S
Sbjct: 192 DVVDGVYVCR---------DMFQRTSAGATGRPDLASAEKGDKMFS 228


>gi|296133756|ref|YP_003641003.1| Creatininase [Thermincola sp. JR]
 gi|296032334|gb|ADG83102.1| Creatininase [Thermincola potens JR]
          Length = 264

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 113/245 (46%), Gaps = 8/245 (3%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDT-IIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           ++D +VVLP+GAYEQHGPHL +NTDT I+     E +       +P   +P   +G S  
Sbjct: 20  KEDPVVVLPVGAYEQHGPHLTLNTDTDIVLEITKEAVGKACSTGIPCALLPPLWLGISEH 79

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           HM   GT T+  +        I+ ++ + G++K +++N HGGN   +     E      +
Sbjct: 80  HMSFSGTITMRQSTLTALVFDILKSLARHGVKKFLVVNGHGGNMAALRYAIDEVGAHCEV 139

Query: 138 L-VVSTSWSRFTIPQGIISFPETEIG--IHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
             V+ T W    +   +    ++E G   HG E+ETS+ + +AP  V+ DL      + +
Sbjct: 140 EPVLVTYW--HLVADLVARLRKSEFGGISHGCELETSLKMHIAPEDVRKDLLRANVVKGN 197

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           E+     +  A    +     + L+  G VG+   AT   GE +         +L+  + 
Sbjct: 198 EYWSPEMF--ASNRVAMYKPYRQLSEYGHVGDPTKATPDFGEAVFKAVVAELAKLITMMQ 255

Query: 255 SFDVS 259
             D+ 
Sbjct: 256 KGDLE 260


>gi|322371135|ref|ZP_08045687.1| Creatininase [Haladaptatus paucihalophilus DX253]
 gi|320549125|gb|EFW90787.1| Creatininase [Haladaptatus paucihalophilus DX253]
          Length = 254

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 108/240 (45%), Gaps = 17/240 (7%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP G+ EQHGP LP+ TD + A  +A      L  R  V  +P  P+G S  H   D
Sbjct: 21  VALLPTGSVEQHGPALPLGTDFMAAQAVA----GTLGDRENVVLLPTVPVGVSEHHRQFD 76

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT     A   ++   I+ +I   G++K+VI+N HGGN   +  V+   R       V  
Sbjct: 77  GTLWTDPATFEDYVTDIVSSIASHGVQKVVIVNGHGGNDGALRRVARRVRREEVAYAVPW 136

Query: 143 SWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           +W       GI    E E G+   H  EIETSM+L +A  LV+    E   +  ++    
Sbjct: 137 NWW-----GGIGDVLEDEFGMGITHADEIETSMLLEVAEELVREAALEAAEAGANDAWGE 191

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
                 HG+ + G+   D +  GVVG     + + G  LL   ++    L+  +   D+ 
Sbjct: 192 ----DVHGA-NVGFDTADFSESGVVGQPTRGSREAGARLLDASSDELAALVEWLGEQDID 246


>gi|225414507|ref|ZP_03761696.1| hypothetical protein CLOSTASPAR_05730 [Clostridium asparagiforme
           DSM 15981]
 gi|225041971|gb|EEG52217.1| hypothetical protein CLOSTASPAR_05730 [Clostridium asparagiforme
           DSM 15981]
          Length = 254

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/221 (33%), Positives = 104/221 (47%), Gaps = 19/221 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + V+P+GA EQHGP+   NTDT  A G ++ I      ++ V C PV P G S+ HM   
Sbjct: 23  LAVVPVGACEQHGPNTTFNTDTARAYGFSKMIGERFGSQVLV-CPPV-PYGISVHHMAFP 80

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL     I     I  A+ K GIR+IV LN HGGNS  +S V    +    +    +
Sbjct: 81  GTVTLRCETYINLLTDIAVALSKHGIRRIVFLNGHGGNSGSLSAVINILKYEHGIDAYYS 140

Query: 143 SWSRFTIPQGIISFPE---TEIGIHGGEIETSMMLALAPHLV-----KMDLAENFSSRQS 194
                   +GI   PE   +E   H  E ET+  + L P +V     K ++ E F  R  
Sbjct: 141 GIGLNLFEEGIT--PEMGWSENLGHASESETAQAMVLCPEVVRAERKKGEVVEGFIIRGK 198

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           E    F+Y    G  ++ W  +D +  G +G+A  A V  G
Sbjct: 199 E--APFRY----GGCAWNWK-EDASANGALGDARLANVDDG 232


>gi|326332450|ref|ZP_08198726.1| putative creatinine amidohydrolase [Nocardioidaceae bacterium
           Broad-1]
 gi|325949763|gb|EGD41827.1| putative creatinine amidohydrolase [Nocardioidaceae bacterium
           Broad-1]
          Length = 253

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 119/249 (47%), Gaps = 14/249 (5%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
            +L     A    +VV+P+GA+EQHG  LP+ TD I A  LAE + + LP +  V   P 
Sbjct: 9   TTLEAARSAEAGTVVVIPVGAFEQHGAGLPLATDQIRAEALAEAVAAALPGK--VVIGPG 66

Query: 70  EPIGYSIEHMYVDGTKTLT---YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126
            P+G S  H    GT +L    +A  +  +   ++++   G R+ +++  HGGN+  +  
Sbjct: 67  VPVGVSPHHQAFAGTVSLRPTLFAAVVREY---VESLAAHGWRRFLVITGHGGNNATLGT 123

Query: 127 VSTE-ARMRFSMLVVSTSWSRFTI--PQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           ++ E  R R  +     +W+  T      + +   + +  H GE ET+ ML +APHLV+ 
Sbjct: 124 LAQELLRDRPDL---ELAWTPVTTLAKDAVATMELSPVSGHSGEAETAQMLHVAPHLVRH 180

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           DL    ++   E     +  R+    +       L+P GV+G+   AT + G  +L+   
Sbjct: 181 DLLTPGTTTPDELDPLARLARSVSQPAVALPYDRLSPTGVLGDPRRATAEDGRAILAEAT 240

Query: 244 NCFIQLLND 252
           +  +  + +
Sbjct: 241 DRIVAFIKE 249


>gi|229580997|ref|YP_002839396.1| Creatininase [Sulfolobus islandicus Y.N.15.51]
 gi|228011713|gb|ACP47474.1| Creatininase [Sulfolobus islandicus Y.N.15.51]
          Length = 233

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 105/205 (51%), Gaps = 25/205 (12%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           + R+D + ++P+G+ EQHGPHLPM TD+II+  +A + +  L         P    G S+
Sbjct: 10  EIREDLVGLVPVGSIEQHGPHLPMGTDSIISENVASKAEEKLKE--TTLLFPTVYYGVSL 67

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRK-MGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
           EH       +L++  AI  +  ++++I K +G+R+I+I+N HGGNS  + +V  E  M++
Sbjct: 68  EHKGFPFI-SLSFQTAISFFNDLLESIFKDLGLRRIIIVNGHGGNSYFLPLVQREFNMKY 126

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEI------GIHGGEIETSMMLALAPHLVKMDLAENF 189
           S   V      F I      F E E        +H G +ETS + A+   +V+++  E  
Sbjct: 127 SNAKVMI----FNI------FGEEEKLLFNVNDLHAGTVETSKIYAIDKRVVRLNKIEEI 176

Query: 190 SSRQSEFLRN--FKYLRAHGSHSFG 212
            S     +R+  F Y     ++ FG
Sbjct: 177 KSYD---VRDGVFVYYSTKEANQFG 198


>gi|55377138|ref|YP_134988.1| creatinine amidohydrolase [Haloarcula marismortui ATCC 43049]
 gi|55229863|gb|AAV45282.1| creatinine amidohydrolase [Haloarcula marismortui ATCC 43049]
          Length = 256

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 104/246 (42%), Gaps = 28/246 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH---- 78
           + ++PLG+ EQHGPHLP+ TD +I    A         R    C P   +G S  H    
Sbjct: 20  LALVPLGSTEQHGPHLPLATDHLIGEAFAREAAD----RTGYLCTPTINVGVSPHHRQFN 75

Query: 79  --MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
             M+VD      Y E+    LA        GI +++ +NAHGGN   +  V    R    
Sbjct: 76  GTMWVDAPVFRDYVESFTRNLAY------HGIDRVIYVNAHGGNIEHLREVGRRLRDDEV 129

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR---Q 193
           +  +   W   +IP  +    E + G HGG  ET+M+  L   LV  D  E+        
Sbjct: 130 LYAIEWMWDE-SIPDLVDDLFE-QNGPHGGPKETAMIQHLRSELVHDDRLEDARDGGIPS 187

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN-- 251
            E     KY    GS +F +   D    GV+G+  DAT +KG  +        ++L    
Sbjct: 188 VEAAETNKY----GSRTF-YDAADNTDNGVLGDQTDATAEKGAEMFEAATEQLVRLCEWL 242

Query: 252 DINSFD 257
           D  +FD
Sbjct: 243 DAQAFD 248


>gi|221636263|ref|YP_002524139.1| creatinine amidohydrolase [Thermomicrobium roseum DSM 5159]
 gi|221157498|gb|ACM06616.1| creatinine amidohydrolase [Thermomicrobium roseum DSM 5159]
          Length = 266

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 109/233 (46%), Gaps = 15/233 (6%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +VV+P+G+ EQHGPH    TD+  A   + R+   + P   V   PV P G S  HM   
Sbjct: 26  LVVIPVGSTEQHGPHATFATDSARAYEFSVRLAERMYPE--VLVAPVMPFGVSPHHMAFP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL+    ++    +++++ + G  + + +N HGGN P + ++    R    +L    
Sbjct: 84  GTITLSAETFMQVLYEVVESLAEHGFERFLFVNGHGGNRPALELLVQRLRRELDVLAAWV 143

Query: 143 SWSRFT---IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           S +      + +G ++    E+  H  E ETS +L LAP  V+ +     +    E L  
Sbjct: 144 SITELANDVVQRGKVA----EVIGHACESETSQLLYLAPWAVREE-----ALAPGELLEQ 194

Query: 200 -FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
            + +    G     +S  ++   G +G+A  A+V+ GE ++    N  ++ + 
Sbjct: 195 AYPHASWWGPVHVAYSFDEITANGALGDARAASVEFGEQIVETALNRLVEFVE 247


>gi|239927696|ref|ZP_04684649.1| hypothetical protein SghaA1_05684 [Streptomyces ghanaensis ATCC
           14672]
          Length = 229

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 101/221 (45%), Gaps = 20/221 (9%)

Query: 28  LGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTL 87
           +G+YEQHGP LP+ TDT++A  +A  I        PV  +P   I  S EH    GT +L
Sbjct: 1   MGSYEQHGPFLPLATDTLVACAVAREIADA----YPVHLLPPVTISCSHEHAAWPGTVSL 56

Query: 88  TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV--STEARMRFSMLVVSTSWS 145
           +          I D++R+ G+  +V++N HGGN  L ++V  S+    R ++      W 
Sbjct: 57  SSVTLHAVVRDIADSLRRSGVEALVLVNGHGGNYVLGNVVQESSARGERTALFPAPEDWE 116

Query: 146 RFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRA 205
                 G+++   T+  +H GEIETS++L   P L++     + S               
Sbjct: 117 TARRRAGVVTSLLTD--MHAGEIETSILLHTHPELLRPGYETSDSVADDR---------- 164

Query: 206 HGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
              H     M      GV+G     + +KG+ LL+  A+ F
Sbjct: 165 --RHLLSLGMAAYTDSGVIGRPSLGSAEKGKKLLASLADSF 203


>gi|322372116|ref|ZP_08046658.1| Creatininase [Haladaptatus paucihalophilus DX253]
 gi|320548538|gb|EFW90210.1| Creatininase [Haladaptatus paucihalophilus DX253]
          Length = 266

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 118/240 (49%), Gaps = 15/240 (6%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           ++V+P+G+ EQHG HLP++TDT++A  +A R        +P+   P    G+S  H+ + 
Sbjct: 30  VLVVPVGSIEQHGHHLPVSTDTLLADAVAHRGAERAADDVPILVTPPVWSGFSPHHLSLG 89

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV-SIVSTEARMRFSMLVVS 141
           GT +L   + ++    + D   + G   +  +N HGGN+  + + VS   +    + V  
Sbjct: 90  GTISLELDDLLDALADVADTALENGFDGLCFVNGHGGNAAAINNAVSIVGKSHPDVEVAG 149

Query: 142 TSWSRFTIPQGIISFPETEIG--IHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL-- 197
            ++ +   P  +    E+E G   HGGE ETS+ML L P LV+M+ A+      +E+L  
Sbjct: 150 LTYFQLAEPF-VDEIRESETGGMSHGGEFETSLMLHLHPELVRMEDAD------AEYLDE 202

Query: 198 ---RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
              R  K L   G  +     ++ +  G +G+   A  +KGE LL    +    +  +++
Sbjct: 203 PYDRGTKDLLVGGPLATYRPFEEYSDTGAIGDPKLANAEKGEKLLDRLTDELADVFRNVS 262


>gi|167771048|ref|ZP_02443101.1| hypothetical protein ANACOL_02402 [Anaerotruncus colihominis DSM
           17241]
 gi|167666718|gb|EDS10848.1| hypothetical protein ANACOL_02402 [Anaerotruncus colihominis DSM
           17241]
          Length = 248

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 121/252 (48%), Gaps = 41/252 (16%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI-----LPPRLPV-TCMPVEP 71
           AR   + ++P+G+ EQHGPHLP++TD  IAA   E +        +PP LPV TC     
Sbjct: 13  ARDTDLAIIPIGSIEQHGPHLPLSTDYRIAAAFGEAVAEAAGGFSIPP-LPVSTCR---- 67

Query: 72  IGYSIEHMYVDGTKTLTYAEAIEHWL-AIIDAIRKMGIRKIVILNAHGGNSPLVSIV-ST 129
                EHM   G   +   +   H L +++ ++++ G R+ V L  HGG   L +++   
Sbjct: 68  -----EHMGKKGAVWMD-PDVFYHMLYSMLMSLKEQGFRRAVTLQCHGGIFVLPAVIRQV 121

Query: 130 EARMRFSMLVVSTS-WSRFTI--PQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
            A      + V+    S F +   +GI    ET+  +H GE+ETS+ML +AP LV M+ A
Sbjct: 122 NATNNPDFMAVNIDICSLFGVVAAEGIT---ETDKELHAGEVETSLMLHIAPELVHMERA 178

Query: 187 ENF-SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
            +F  + Q  +L      RA             +P GV G    A+  KG+ +L  F   
Sbjct: 179 VDFVPAVQRPYLGYGSIFRA-------------SPSGVWGEPSRASADKGKRILERFTAL 225

Query: 246 FIQLLNDINSFD 257
            +Q ++   +FD
Sbjct: 226 AVQEMD--QAFD 235


>gi|269121787|ref|YP_003309964.1| creatininase [Sebaldella termitidis ATCC 33386]
 gi|268615665|gb|ACZ10033.1| Creatininase [Sebaldella termitidis ATCC 33386]
          Length = 244

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 113/232 (48%), Gaps = 28/232 (12%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           K+ +++LP+G+ EQHG HLP+ TDTI+A  LA     ++ PR+    +P    GYS    
Sbjct: 20  KNPVMILPVGSTEQHGFHLPLGTDTILAKALAR----MVAPRINSLIIPALYYGYSWVWH 75

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRK----MGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            + GT TL      EH+  ++  I K     G + ++I+N H  N+  +     E + + 
Sbjct: 76  KIPGTITLEQ----EHFKTVLKDIAKSVETYGTKLLIIINGHDANNQSLKYTVREMKYQT 131

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIG---IHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            M ++   +  F+  +    + E+EI     H  E ETS+MLA    LV M       ++
Sbjct: 132 DMKILYFFYPNFS--EIYKKYCESEIQNGLFHAEEFETSLMLAENDKLVDM-------TK 182

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             +   ++  L +H S   G    D++  GV G+A  A  +KG+ +   FA+
Sbjct: 183 AVKEYPDYPPLYSHTSEILG----DISKSGVFGDATAAGKEKGQKMFEEFAD 230


>gi|291532941|emb|CBL06054.1| Uncharacterized protein, putative amidase [Megamonas hypermegale
           ART12/1]
          Length = 252

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 90/183 (49%), Gaps = 11/183 (6%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A+ D + ++P+G+ EQHGP  P+ TD +I    A++I+     R  V  +P  P G +  
Sbjct: 16  AKDDLVAIIPIGSTEQHGPVGPLGTDFLIPDYFAKQIEK----RTEVLIVPTVPFGIATH 71

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           H+   GT  + +         I+D + + G++K V LN HGGN+P +  V+ EA  +  +
Sbjct: 72  HVEFSGTIDIGFDGLYAVIKGIVDGLSRHGVKKFVFLNGHGGNTPALDKVALEANKKGCL 131

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV-KMDLAENFSSRQSEF 196
                 WS   +   +        G HG   E SM++A+   L+ K DL E   +  S+ 
Sbjct: 132 CAQIDWWSLAPMLNPVWK------GGHGDGQEVSMIMAIDEGLINKDDLMETKVNHLSDK 185

Query: 197 LRN 199
           L+N
Sbjct: 186 LKN 188


>gi|312140952|ref|YP_004008288.1| amidase [Rhodococcus equi 103S]
 gi|311890291|emb|CBH49609.1| putative amidase [Rhodococcus equi 103S]
          Length = 230

 Score = 86.7 bits (213), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 101/222 (45%), Gaps = 26/222 (11%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R D  V +P+G++EQHGPHLP++TDT IA  L   +   L     V   P    G S EH
Sbjct: 13  RDDLTVAVPVGSFEQHGPHLPLDTDTRIATALTGAVAGAL---TGVVTAPAITYGASGEH 69

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT ++   EA+E  L           R++V +N HGGN P  ++V T   +R+   
Sbjct: 70  EGFAGTISIG-TEALEALLVEYGRSACRWARRVVFVNGHGGNGP--ALVKTVELLRYEGR 126

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
               +W    +P             H G  ETS++L L+P  V M  AE  ++     L 
Sbjct: 127 --DAAWLPCAVPG---------ADAHAGRTETSLLLHLSPADVTMGRAEPGNTAPIADL- 174

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
               LR+ G       M    P G++G+   AT ++GE L +
Sbjct: 175 -MPQLRSGG-------MLAATPNGILGDPTGATAEEGERLFA 208


>gi|225569813|ref|ZP_03778838.1| hypothetical protein CLOHYLEM_05907 [Clostridium hylemonae DSM
           15053]
 gi|225161283|gb|EEG73902.1| hypothetical protein CLOHYLEM_05907 [Clostridium hylemonae DSM
           15053]
          Length = 252

 Score = 86.7 bits (213), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 111/244 (45%), Gaps = 16/244 (6%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +KD ++V+P+G+ EQHG    + TD ++ + LA+ +  +      V   P  P G    H
Sbjct: 16  QKDPVLVIPVGSTEQHGAQCALGTDYMVPSYLADHVADMED----VIIAPTVPYGVCPYH 71

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
           +  +G+  + Y         I+D++ + G+++ V+LN HGGN+P +   + E   +  + 
Sbjct: 72  LSFEGSINIGYEGLYMVLHGIMDSLMQHGVKRFVVLNGHGGNTPSIDRAALEVYHKGGIC 131

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
                WS       +    E   G HG  +ETS M+A+AP  V ++L +  +++      
Sbjct: 132 ASIDWWSL------VAELDEKFCGGHGDILETSAMMAVAPDAVHLELGQPMNAQHPSENV 185

Query: 199 NFKYLRA----HGSHSFGWSMKDLNPKGVVG--NAMDATVKKGEGLLSYFANCFIQLLND 252
              Y++A     G+       K++ P G  G  +  D+T + G+  L          L +
Sbjct: 186 EAAYIQAVRYKGGTVRLVRDTKEIAPSGWFGPFDPKDSTAELGQEALDLSVEFIRGFLEE 245

Query: 253 INSF 256
           +  F
Sbjct: 246 MKGF 249


>gi|227831446|ref|YP_002833226.1| Creatininase [Sulfolobus islandicus L.S.2.15]
 gi|227457894|gb|ACP36581.1| Creatininase [Sulfolobus islandicus L.S.2.15]
 gi|323475796|gb|ADX86402.1| creatininase [Sulfolobus islandicus REY15A]
 gi|323478509|gb|ADX83747.1| Creatininase [Sulfolobus islandicus HVE10/4]
          Length = 233

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 105/205 (51%), Gaps = 25/205 (12%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           + R+D + ++P+G+ EQHGPHLPM TD+II+  +A + +  L         P    G S+
Sbjct: 10  EIREDLVGLVPVGSIEQHGPHLPMGTDSIISEYVASKAEEKLKE--TTLLFPTVYYGVSL 67

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRK-MGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
           EH       +L++  AI  +  ++++I K +G+R+I+I+N HGGNS  + +V  E  M++
Sbjct: 68  EHKGFPFI-SLSFQTAISFFNDLLESIFKDLGLRRIIIVNGHGGNSYFLPLVQREFNMKY 126

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEI------GIHGGEIETSMMLALAPHLVKMDLAENF 189
           S   V      F I      F E E        +H G +ETS + A+   +V+++  E  
Sbjct: 127 SNAKVMI----FNI------FGEEEKLLFNVNDLHAGTVETSKIYAIDKRVVRLNKIEEI 176

Query: 190 SSRQSEFLRN--FKYLRAHGSHSFG 212
            S     +R+  F Y     ++ FG
Sbjct: 177 KSYD---VRDGVFVYYSTKEANQFG 198


>gi|284998983|ref|YP_003420751.1| Creatininase [Sulfolobus islandicus L.D.8.5]
 gi|284446879|gb|ADB88381.1| Creatininase [Sulfolobus islandicus L.D.8.5]
          Length = 233

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 105/205 (51%), Gaps = 25/205 (12%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           + R+D + ++P+G+ EQHGPHLPM TD+II+  +A + +  L         P    G S+
Sbjct: 10  EIREDLVGLVPVGSIEQHGPHLPMGTDSIISEYVASKAEEKLKE--TTLLFPTVYYGVSL 67

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRK-MGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
           EH       +L++  AI  +  ++++I K +G+R+I+I+N HGGNS  + +V  E  M++
Sbjct: 68  EHKGFPFI-SLSFQTAISFFNDLLESIFKDLGLRRIIIVNGHGGNSYFLPLVQREFNMKY 126

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEI------GIHGGEIETSMMLALAPHLVKMDLAENF 189
           S   V      F I      F E E        +H G +ETS + A+   +V+++  E  
Sbjct: 127 SNAKVMI----FNI------FGEEEKLLFNVNDLHAGTVETSKIYAIDKRVVRLNKIEEI 176

Query: 190 SSRQSEFLRN--FKYLRAHGSHSFG 212
            S     +R+  F Y     ++ FG
Sbjct: 177 KSYD---VRDGVFVYYSTKEANQFG 198


>gi|238620899|ref|YP_002915725.1| Creatininase [Sulfolobus islandicus M.16.4]
 gi|238381969|gb|ACR43057.1| Creatininase [Sulfolobus islandicus M.16.4]
          Length = 233

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 108/199 (54%), Gaps = 13/199 (6%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           + R+D + ++P+G+ EQHGPHLPM TD II+  +A + +  L         P    G S+
Sbjct: 10  EIREDLVGLVPVGSIEQHGPHLPMGTDIIISEYVASKAEEKLKE--TTLLFPTVYYGVSL 67

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRK-MGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
           EH       +L++  AI  +  ++++I K +G+R+I+I+N HGGNS  + +V  E  M++
Sbjct: 68  EHKGFPFI-SLSFQTAISFFNDLLESIFKDLGLRRIIIVNGHGGNSYFLPLVQREFNMKY 126

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
           S   V   ++ F+  + ++ F   +  +H G +ETS + A+   +V+++  E   S    
Sbjct: 127 SNAKVMI-FNIFSEEEKLL-FNVND--LHAGTVETSKIYAIDKRVVRLNKIEEIKSYD-- 180

Query: 196 FLRN--FKYLRAHGSHSFG 212
            +R+  F Y     ++ FG
Sbjct: 181 -VRDGVFVYYSTKEANQFG 198


>gi|223938711|ref|ZP_03630600.1| Creatininase [bacterium Ellin514]
 gi|223892562|gb|EEF59034.1| Creatininase [bacterium Ellin514]
          Length = 307

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 104/224 (46%), Gaps = 15/224 (6%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +D IV+ P+ A EQH  HLP  TD+I+  G+A R+++ LP    +  +PV+ +G S  H+
Sbjct: 76  RDIIVIYPIAALEQHSRHLPFFTDSILCDGVASRLEAALPNE--ILLLPVQWLGASAHHL 133

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF--SM 137
            + G+ T      +      +  + + G R++ ILN HGGN     +   +  + F  S+
Sbjct: 134 GMPGSLTAQSDTYLNILCEPLRCLLQHGFRRVFILNGHGGNIDGFHLALRQLALEFPDSV 193

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM-DLAENFSSRQSEF 196
           L  ++ W         I   E +   H  E ETSMM+ L P LV+  ++A++     SE 
Sbjct: 194 LAGASYWDLADKEIAAILQGERKNVGHACEFETSMMMYLRPELVRTSEIADDKVKNTSEA 253

Query: 197 LR------NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKK 234
           L+      +FK    HG    G     L         MDA V K
Sbjct: 254 LKGIYIPLDFKRHTRHG----GSGQATLATAAKGKQFMDAIVPK 293


>gi|325001096|ref|ZP_08122208.1| creatinine amidohydrolase [Pseudonocardia sp. P1]
          Length = 253

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 104/233 (44%), Gaps = 20/233 (8%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           +LP+G++EQHGPHLP++TDT++A  LA R+        PV  +P   I  S EH    GT
Sbjct: 38  LLPVGSHEQHGPHLPLDTDTLVATSLAARLGQ----EYPVRVLPPVAISCSHEHAAWAGT 93

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV--STEARMRFSMLVVST 142
            +++          +  ++R  G+  +V++N HGGN  L ++V  ++   +  ++     
Sbjct: 94  VSISATTLAAVVGDVAASLRAAGVPALVLVNGHGGNHVLRNVVQEASTGPLPMALFPGGD 153

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W       G++S    +  +H GE+ETS++L   P +V+   A                
Sbjct: 154 DWVAARAAGGLVSSHSAD--MHAGELETSILLHTRPDVVRPGFAGADHDADER------- 204

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
                 H     ++  +  GVVG    AT  KG  +L      F   L  + S
Sbjct: 205 -----PHMLTLGLQAYSGSGVVGRPSLATEGKGRAVLDALVAGFGDHLRALGS 252


>gi|284167121|ref|YP_003405399.1| creatininase [Haloterrigena turkmenica DSM 5511]
 gi|284016776|gb|ADB62726.1| Creatininase [Haloterrigena turkmenica DSM 5511]
          Length = 260

 Score = 86.3 bits (212), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 109/234 (46%), Gaps = 19/234 (8%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++P+GA EQHGPHLP+ TDT I   +AER+ + L   L     P  P G S EH    G
Sbjct: 28  VIVPIGATEQHGPHLPLRTDTTIGDAIAERLANRLGDAL---VGPAIPFGPSREHEAFPG 84

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS-T 142
           T +++           + ++ + G  ++V+L +HGG+   V+    E      + VV+  
Sbjct: 85  TVSISPRTLRTLLGDYVASLERSGFERVVLLPSHGGSFASVAAAHPELACSHDVDVVAID 144

Query: 143 SWSRF--TIPQGI--ISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
              R+   + +G+        E  +H G +ET++MLA+ P  V+ D A +         +
Sbjct: 145 DLGRYLELLNEGLDRAGIDHREPVVHAGAVETAVMLAVDPDAVRADRAPDGYDGPVSAAK 204

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
            ++             +   +P GV+G+A  AT   GE +L +  + +   + D
Sbjct: 205 LYRD-----------GIDAYSPNGVLGDARPATADVGETILEHVVDAYAAEVRD 247


>gi|257386646|ref|YP_003176419.1| creatininase [Halomicrobium mukohataei DSM 12286]
 gi|257168953|gb|ACV46712.1| Creatininase [Halomicrobium mukohataei DSM 12286]
          Length = 237

 Score = 86.3 bits (212), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 109/235 (46%), Gaps = 16/235 (6%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP+G+ EQHGPH P+ TD + A  +AE           V   P  P+G + EH +  
Sbjct: 18  LAILPVGSTEQHGPHGPLGTDVLTAEAVAEAGAEAYDGE--VVVAPAIPVGVAEEHRHFA 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  +      ++    + ++   G  ++V++N HGGN   +  V        +   V  
Sbjct: 76  GTLWVGEDTFRDYVRETVASLASHGWDRVVVVNGHGGNVDALREVCGRVTRDGTAYAVPL 135

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           +W          +    ++G HGG +ETS++L+ AP LV+ D  E  ++  ++    F+ 
Sbjct: 136 TW--------FDAVDAPDMG-HGGPVETSLLLSTAPELVRTDRLEASAANGADSWGAFE- 185

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
              HG  +  +  ++ +  G VG+  DA  ++G+ LL   ++    +L  +   D
Sbjct: 186 ---HGV-NLAYDTEEFSENGTVGDPRDANRERGDALLDAASDALADVLASVRERD 236


>gi|257052901|ref|YP_003130734.1| Creatininase [Halorhabdus utahensis DSM 12940]
 gi|256691664|gb|ACV12001.1| Creatininase [Halorhabdus utahensis DSM 12940]
          Length = 242

 Score = 86.3 bits (212), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 69/239 (28%), Positives = 112/239 (46%), Gaps = 22/239 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP+G+ EQHGPH P+ TD IIA  +A+      P    V   P+  +G S EH    
Sbjct: 18  LAILPVGSTEQHGPHAPLGTDAIIAEAVADAGVEAYPGDA-VVAPPI-TVGVSEEHRAFP 75

Query: 83  GT---KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSML 138
           G+      T+   +   +A   ++   G  ++VI+N HGGN +PL  + +  +R   +  
Sbjct: 76  GSLWVSEDTFRATVRETVA---SLAHHGWDRVVIVNGHGGNVNPLREVCARISRHDDAYA 132

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           V  T W     P G IS        H G +ETS++  +AP L+  +  E      +E   
Sbjct: 133 VPFT-WFEAVDP-GDISMG------HAGPMETSVLEEVAPDLIDEEKMETAREEAAE--- 181

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
             ++    G  +  + +++  P GVVG+   A  ++GE LL    +  + LL D+   D
Sbjct: 182 --RWGEWTGGVNLAYDVEEFAPNGVVGDPTVADAERGEKLLRSARDELVTLLEDVAERD 238


>gi|302557196|ref|ZP_07309538.1| creatinine amidohydrolase [Streptomyces griseoflavus Tu4000]
 gi|302474814|gb|EFL37907.1| creatinine amidohydrolase [Streptomyces griseoflavus Tu4000]
          Length = 266

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 111/228 (48%), Gaps = 24/228 (10%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+G++EQHGP+LP++TDT++A  +A  I        PV  +P   I  S EH    
Sbjct: 40  IAVLPVGSFEQHGPYLPLSTDTLVACAIARAIADA----RPVHLLPPVTISCSHEHAAWP 95

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV--STEARMRFSMLVV 140
           GT +L+          + D++R+ G+  +V++N HGGN  L + V  S+    R ++   
Sbjct: 96  GTVSLSSVTLHAVIRDVADSLRRSGVDALVLVNGHGGNYVLGNAVQESSARGERMALFPA 155

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK--MDLAENFSSRQSEFLR 198
           +  W    +  G+ +   T+  +H GEIETS++L   P L++   + +++ +  +   L 
Sbjct: 156 AEDWETARVRAGVATSLLTD--MHAGEIETSILLHTHPELLRPGYETSDHIADDRRHLLT 213

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
           +               M      GV+G    A+ +KG+ LL    + F
Sbjct: 214 S--------------GMSTYTDSGVIGRPSLASAEKGKKLLESLTDSF 247


>gi|227828707|ref|YP_002830487.1| creatininase [Sulfolobus islandicus M.14.25]
 gi|229585925|ref|YP_002844427.1| Creatininase [Sulfolobus islandicus M.16.27]
 gi|227460503|gb|ACP39189.1| Creatininase [Sulfolobus islandicus M.14.25]
 gi|228020975|gb|ACP56382.1| Creatininase [Sulfolobus islandicus M.16.27]
          Length = 233

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 105/205 (51%), Gaps = 25/205 (12%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           + R+D + ++P+G+ EQHGPHLPM TD+II+  +A + +  L         P    G S+
Sbjct: 10  EIREDLVGLVPVGSIEQHGPHLPMGTDSIISEYVASKAEEKLKE--TTLLFPTIYYGVSL 67

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRK-MGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
           EH       +L++  AI  +  ++++I K +G+R+I+I+N HGGNS  + +V  E  M++
Sbjct: 68  EHKGFPFI-SLSFQTAISFFNDLLESIFKDLGLRRIIIVNGHGGNSYFLPLVQREFNMKY 126

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEI------GIHGGEIETSMMLALAPHLVKMDLAENF 189
           S   V      F I      F E E        +H G +ETS + A+   +V+++  E  
Sbjct: 127 SNAKVMI----FNI------FGEEEKLLFNVNDLHAGTVETSKIYAIDKRVVRLNKIEEI 176

Query: 190 SSRQSEFLRN--FKYLRAHGSHSFG 212
            S     +R+  F Y     ++ FG
Sbjct: 177 KSYD---VRDGVFVYYSTKEANQFG 198


>gi|242398842|ref|YP_002994266.1| putative amidase [Thermococcus sibiricus MM 739]
 gi|242265235|gb|ACS89917.1| putative amidase [Thermococcus sibiricus MM 739]
          Length = 242

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 113/244 (46%), Gaps = 44/244 (18%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-- 81
           ++LP+G+ E HG HLP+ TD      ++ R++  L  R  +  +   PI Y   H +V  
Sbjct: 26  LILPVGSVEAHGKHLPLGTDVFAPLEISRRVEEKLKDR-GIDILIAPPIWYG--HSFVLN 82

Query: 82  --DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSML 138
              GT  +      ++   I++   K G  K++ILN HGGN  PL+   + E   ++ + 
Sbjct: 83  VYPGTINVKSGTFQKYVQEILEEFAKEGFEKVIILNGHGGNIYPLIG-AAEEVVEKYDVE 141

Query: 139 VVSTSW--------SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
           VV  +W        SR    QG           H GE ETS++LA+ P LVKM+ A    
Sbjct: 142 VVLINWWMDFKEEISRICSSQG-----------HAGEDETSVILAINPELVKMEKA--IG 188

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA----NCF 246
            R++  +R  K          G    D+ P GV  N  +AT +KGE +L   +    N  
Sbjct: 189 ERRTRPVRIIK-------KDIGL---DIFPNGVNDNPHNATAEKGEEILEVVSEKITNIL 238

Query: 247 IQLL 250
           ++LL
Sbjct: 239 VELL 242


>gi|289581905|ref|YP_003480371.1| creatininase [Natrialba magadii ATCC 43099]
 gi|289531458|gb|ADD05809.1| Creatininase [Natrialba magadii ATCC 43099]
          Length = 245

 Score = 85.9 bits (211), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 108/242 (44%), Gaps = 16/242 (6%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + V+P+G+ EQHGPH P+  D + A  +A+    +      V   P  PIG + EH    
Sbjct: 18  LAVVPVGSTEQHGPHAPLGADVLTAEAVAD--AGLERTDRDVLRAPAIPIGVAEEHRQFP 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  ++      +    + ++   G+ ++V++N HGGN   +  V            V  
Sbjct: 76  GTMWVSPDTFRSYVSEAVQSLAHHGVERVVLVNGHGGNVDALREVGARLTRDGDAYTVPF 135

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF-K 201
           +W  F      +     ++G HGG +ET+++  + P LV+ D  E      ++    +  
Sbjct: 136 TW--FN----AVGEHSADMG-HGGPLETALLRHVEPELVREDRIEEARDGAADGWGEWTS 188

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           Y+      +  +     +  GVVG+  +   ++GE LL   A   ++LL+ +   DVS+ 
Sbjct: 189 YV------NLAYDSAQFSENGVVGDPAEGDAERGEKLLELAAESLVRLLDAVAERDVSVA 242

Query: 262 DK 263
           D 
Sbjct: 243 DS 244


>gi|90420054|ref|ZP_01227962.1| putative creatinine amidohydrolase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335388|gb|EAS49138.1| putative creatinine amidohydrolase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 264

 Score = 85.9 bits (211), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 119/257 (46%), Gaps = 51/257 (19%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS------ILPPRLPVTCMPVEPIGYSIE 77
           V++ + A EQHGPHLP++TD +I A   + +++      ++ P++ V C        S  
Sbjct: 20  VIVNVAAIEQHGPHLPLDTDAVIGAAFLDSLEARAGDEVLILPQVKVCC--------SEH 71

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE--ARMRF 135
           HM   GT ++ +   +++  AI+ ++ + G R +VI N+HGGN  +  ++  E  A  R 
Sbjct: 72  HMDFPGTLSIGHRSFLDYVGAILQSVVRHGFRNLVIFNSHGGNQAIGQVLLEEFGASHRD 131

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEI--GIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
             +V+ T W R   P+ I    E+      H  E+ETS+ML + P           S RQ
Sbjct: 132 CRIVMLT-WWRLAGPE-ISQIRESGFAGANHACELETSLMLHVDP----------ASVRQ 179

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDL----------------NPKGVVGNAMDATVKKGEG 237
            + L    Y+  H     GW+  D+                +  G VG+A  AT  KG+ 
Sbjct: 180 PDHLPPMSYVPTH-----GWANADMILPARGALFRSMAEMSDGLGAVGDASLATAAKGQA 234

Query: 238 LLSYFANCFIQLLNDIN 254
           ++       + ++ D++
Sbjct: 235 IIEAVTEQLLAVVRDLS 251


>gi|23009496|ref|ZP_00050522.1| COG1402: Uncharacterized protein, putative amidase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 102

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 57/95 (60%)

Query: 162 GIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPK 221
           GIH G IET++MLAL P LV+ D  ++F SR     R+F  LRA    +F W  +DL+  
Sbjct: 6   GIHAGGIETALMLALRPDLVRRDAIDSFVSRTVAMERDFTLLRAGRPAAFAWKTQDLHAS 65

Query: 222 GVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           G +G+A   T + GE  L+Y A  F+ LL +I+ F
Sbjct: 66  GALGDARLGTAEAGEAALAYGARAFVTLLGEIDRF 100


>gi|256783895|ref|ZP_05522326.1| hypothetical protein SlivT_05361 [Streptomyces lividans TK24]
          Length = 241

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 110/224 (49%), Gaps = 20/224 (8%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           +LP+G++EQHGP+LP+ TDT++A  +A  +        PV  +P   IG S EH    GT
Sbjct: 1   MLPVGSFEQHGPYLPLATDTLVACAVARAVADA----YPVHLLPPVTIGCSHEHADWPGT 56

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV--STEARMRFSMLVVST 142
            +++          I D++R+ G+  +V++N HGGN  L ++V  S+    R ++   + 
Sbjct: 57  VSISAVTLHAVVRDIADSLRRSGVGALVVVNGHGGNYVLGNVVQESSARGERMALFPAAE 116

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W       G+++   T+  +H GEIETS++L   P LV+           ++F+ + + 
Sbjct: 117 DWETARRRAGVVTSLLTD--MHAGEIETSILLHKHPELVRPGY------EAADFVADDR- 167

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                 H     M      GV+G     + +KG+ LL   A+ F
Sbjct: 168 -----RHLLSLGMSAYTDSGVIGRPSLGSAEKGKELLESLADSF 206


>gi|15899547|ref|NP_344152.1| hypothetical protein SSO2832 [Sulfolobus solfataricus P2]
 gi|284174684|ref|ZP_06388653.1| hypothetical protein Ssol98_08511 [Sulfolobus solfataricus 98/2]
 gi|13816187|gb|AAK42942.1| Conserved hypothetical protein [Sulfolobus solfataricus P2]
 gi|261601319|gb|ACX90922.1| Creatininase [Sulfolobus solfataricus 98/2]
          Length = 233

 Score = 85.5 bits (210), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 110/204 (53%), Gaps = 23/204 (11%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM-PVEPIGYS 75
           + R D + ++P+G+ EQHGPHLPM TD II+  +A + +  L     +T + P    G S
Sbjct: 10  EIRGDLVGLVPVGSIEQHGPHLPMGTDGIISEYIASKAEEKLK---DITLLFPTIYYGVS 66

Query: 76  IEHM---YVDGTKTLTYAEAIEHWLAIIDAI-RKMGIRKIVILNAHGGNSPLVSIVSTEA 131
           +EH    +V    +L++  AI  +  +++++   +G+R+I+I+N HGGNS  + +V  E 
Sbjct: 67  LEHKGFPFV----SLSFQTAISFFTDLLESVFNDLGLRRIIIVNGHGGNSYFLPLVQREF 122

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV---KMDLAEN 188
            M+ S   V   ++ F   + I+ F   +  +H G IETS + A+   LV   K+D  +N
Sbjct: 123 NMKHSDAKV-IVFNTFGEEEKIL-FNVND--LHAGTIETSKIWAIGKSLVRVNKIDEIKN 178

Query: 189 FSSRQSEFLRNFKYLRAHGSHSFG 212
           +  R   F+    Y  +  ++ FG
Sbjct: 179 YEVRDGVFI----YYSSREANQFG 198


>gi|312194876|ref|YP_004014937.1| creatininase [Frankia sp. EuI1c]
 gi|311226212|gb|ADP79067.1| Creatininase [Frankia sp. EuI1c]
          Length = 253

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/253 (30%), Positives = 117/253 (46%), Gaps = 36/253 (14%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY--SIEHMY 80
           IV+LPLG+ EQHGPHLP++TDT IA  +A  + + LP       +   P+GY  S EH  
Sbjct: 27  IVLLPLGSTEQHGPHLPLDTDTRIAVAVAAAVAARLP-----GALVAPPLGYGASGEHAG 81

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMG--IRKIVILNAHGGNSP----LVSIVSTEARMR 134
             GT +L  A A+E  +A+I+ +R        +V++N HGGN+      V +++ E R  
Sbjct: 82  FPGTLSLGTA-ALE--MALIELVRSADDTAAGMVLVNGHGGNATALRGAVRLLTAEGR-- 136

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
             +LV    W+        +  P     +H G  ETS+ML LAP LV+ D A    S   
Sbjct: 137 -RVLV----WAPRAAVASAVGVPGAVGDLHAGRAETSLMLHLAPELVRPDAATRGPSPAL 191

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
             L     L              L+P GV+G+   A+  +G  LL    +  +  +    
Sbjct: 192 PDLVERGVL-------------PLSPSGVLGDPTGASAAEGVALLDALVSDAVSTIESWP 238

Query: 255 SFDVSIFDKDVQK 267
           +   S    D ++
Sbjct: 239 AARPSSRHPDTRR 251


>gi|167760532|ref|ZP_02432659.1| hypothetical protein CLOSCI_02906 [Clostridium scindens ATCC 35704]
 gi|167661898|gb|EDS06028.1| hypothetical protein CLOSCI_02906 [Clostridium scindens ATCC 35704]
          Length = 250

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 109/244 (44%), Gaps = 16/244 (6%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +KD ++V+P+G+ EQHG    + TD ++ + LA+ +  +      V   P  P G    H
Sbjct: 16  QKDPVLVIPVGSTEQHGAQCALGTDYMVPSYLADHVADMED----VIIAPTVPYGVCPYH 71

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
           +  +G+  + Y         I+D++ + G+R+ V+LN HGGN+P +   + E   +  + 
Sbjct: 72  LSFEGSINIGYEGLYMVLHGIMDSLMQHGVRRFVVLNGHGGNTPSIDRAALEVYHKGGIC 131

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
                WS       +    E   G HG  +ETS M+A+ P  V ++L +  + +      
Sbjct: 132 ASIDWWSL------VAELDEKFRGGHGDILETSAMMAVDPDAVHLELGQPMNPQHPSKNV 185

Query: 199 NFKYLRA----HGSHSFGWSMKDLNPKGVVG--NAMDATVKKGEGLLSYFANCFIQLLND 252
              Y++A     G+       K++ P G  G  +  D+T + G+  L          L +
Sbjct: 186 EAAYIQAVRYKGGTVRLVRDTKEIAPSGWFGPFDPKDSTSELGQEALDMSVTFIRGFLEE 245

Query: 253 INSF 256
           I  F
Sbjct: 246 IKGF 249


>gi|222479810|ref|YP_002566047.1| Creatininase [Halorubrum lacusprofundi ATCC 49239]
 gi|222452712|gb|ACM56977.1| Creatininase [Halorubrum lacusprofundi ATCC 49239]
          Length = 257

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 113/256 (44%), Gaps = 13/256 (5%)

Query: 5   IIFTDNSLPLCADARKDWIVVL-PLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP-RL 62
           +   D++ P   +A  D  V L PLG+ EQHGPHLP+ TD +IA  LA          R 
Sbjct: 1   MYLADHTWPELGEALSDESVALVPLGSTEQHGPHLPLATDHLIAEALASAAAEETGAVRT 60

Query: 63  PVTCMPVEPIGYSIE-HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           P   + V P        M+VD  +   Y E     LA        GI ++V +NAHGGN 
Sbjct: 61  PTVTVGVSPHHRQFPGTMWVDPPEFRDYVEGFTRNLAY------HGIDRVVFVNAHGGNV 114

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +  V        +   +   W   +IP+ +    E   G H G  ET+M+  +AP LV
Sbjct: 115 QHLREVGRRLHEDETAYAIEWMWDE-SIPELVDDLFEHN-GPHAGPKETAMITHIAPELV 172

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           K D  E+        L     +  HG+ ++ +   D +  G  G+  D T +K E L   
Sbjct: 173 KTDRLEDARDDGLVHLDESDAV-VHGARTY-YDAVDNSANGAFGDPTDVTPEKAERLFEA 230

Query: 242 FANCFIQLLNDINSFD 257
            ++  +QL+  +++ D
Sbjct: 231 ASDQLVQLVEWLDARD 246


>gi|284044248|ref|YP_003394588.1| creatininase [Conexibacter woesei DSM 14684]
 gi|283948469|gb|ADB51213.1| Creatininase [Conexibacter woesei DSM 14684]
          Length = 255

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 83/162 (51%), Gaps = 13/162 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + ++PLGA EQHGPHLP+ TD IIA  LA  + + L    PV   PV P+G S  H+   
Sbjct: 19  VGLIPLGAVEQHGPHLPVATDAIIARHLAGEVAARLTE--PVLVAPVLPLGVSAHHLGFA 76

Query: 83  GTKTLTYAEAIEHWL-AIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
           GT  L  AEA    + A  DA+R +G+R++ I +AHGGN    +I    A       V  
Sbjct: 77  GTVHLD-AEAFGACVRAYADAMRDLGLRRVAIFSAHGGN--FAAIAEVAASYADDPGVEV 133

Query: 142 TSWSRFTIPQGIISFPETEIGI-------HGGEIETSMMLAL 176
            +++ FT   G +       G+       H G +ETS +L L
Sbjct: 134 IAYTDFTRYLGAMRSGAGRAGVVVPDADTHAGGLETSQILYL 175


>gi|229580368|ref|YP_002838768.1| Creatininase [Sulfolobus islandicus Y.G.57.14]
 gi|228011084|gb|ACP46846.1| Creatininase [Sulfolobus islandicus Y.G.57.14]
          Length = 233

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 103/205 (50%), Gaps = 25/205 (12%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           + R+D + ++P+G+ EQHGPHLPM TD+II+  +A + +  L         P    G S+
Sbjct: 10  EIREDLVGLVPVGSIEQHGPHLPMGTDSIISEYVASKAEEKLKE--TTLLFPTVYYGVSL 67

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAI-RKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
           EH       +L++  AI  +  ++++I   +G+R+I+I+N HGGNS  + +V  E  M++
Sbjct: 68  EHKGFPFI-SLSFQTAISFFNDLLESIFNDLGLRRIIIVNGHGGNSYFLPLVQREFNMKY 126

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEI------GIHGGEIETSMMLALAPHLVKMDLAENF 189
           S   V      F I      F E E        +H G +ETS +  +   +V+++  E  
Sbjct: 127 SNAKVMI----FNI------FGEEEKLLFNVNDLHAGTVETSKIYTIDKRVVRLNKIEEI 176

Query: 190 SSRQSEFLRN--FKYLRAHGSHSFG 212
            S     +R+  F Y     ++ FG
Sbjct: 177 KSYD---VRDGVFVYYSTKEANQFG 198


>gi|313122468|ref|YP_004038355.1| uncharacterized protein, amidase [Halogeometricum borinquense DSM
           11551]
 gi|312296812|gb|ADQ69408.1| uncharacterized protein, putative amidase [Halogeometricum
           borinquense DSM 11551]
          Length = 269

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 109/241 (45%), Gaps = 17/241 (7%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL----PVTCMPVEPIGYSIEH 78
           ++V+P+G+ EQHG HLP+ TDT+    LAER+ +    R+    P+   P    GYS  H
Sbjct: 32  VLVVPVGSIEQHGAHLPVATDTL----LAERVATASAKRIVADVPILVAPSVRPGYSPHH 87

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE-ARMRFSM 137
           + V GT +  +   ++    + +     G   +V +N HGGN+ L+    +E  R     
Sbjct: 88  LPVGGTLSAGFETLLDLLRDMAETGLDNGFDALVFVNGHGGNTSLIDAAVSEIGREHPDR 147

Query: 138 LVVSTSWSRFTIPQGIISFPETEIG--IHGGEIETSMMLALAPHLVKMDL--AENFSSRQ 193
            ++  ++    +     +  E+++G   HGGE ETSMML L P LV  D   AE +    
Sbjct: 148 EILGLTYFEL-VADLAATVRESDLGGMAHGGEFETSMMLHLFPELVDTDEMPAEYWDEH- 205

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
             + +    L   G  S   S  + +  G +G+   A    G  L          LL D+
Sbjct: 206 --YEQGGADLVVGGPLSVYRSFDEYSESGAIGDPSVADENTGRQLFDGAVTALSDLLTDV 263

Query: 254 N 254
           +
Sbjct: 264 H 264


>gi|76801704|ref|YP_326712.1| hypothetical protein NP2120A [Natronomonas pharaonis DSM 2160]
 gi|76557569|emb|CAI49151.1| conserved hypothetical protein [Natronomonas pharaonis DSM 2160]
          Length = 263

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 107/227 (47%), Gaps = 9/227 (3%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + ++P+G+ EQHGPHLP++TD +IA GLA         R  V C P   +G S  H    
Sbjct: 20  VALVPVGSTEQHGPHLPLSTDHVIAEGLAREAAD----RAGVVCTPTITVGVSPHHRQFH 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT ++      ++  ++  ++   GI +IV +NAHGGN   +  V        +   V  
Sbjct: 76  GTMSVEAPVFRDYVESLSRSLVYQGIDRIVYVNAHGGNVEHLREVGRRLHEDGAAYAVEW 135

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W   +IP  +    E + G H G  ETSM+  LA ++ + +LA+         L + + 
Sbjct: 136 MWDE-SIPDLVDDLFE-QNGPHAGPKETSMVWYLADNVREDELADARDG-GCPALEDIRT 192

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
              +G+  F  ++++ +  G  G+  DAT  KGE L    +     L
Sbjct: 193 TY-NGARLFYDAIENSD-NGAFGDPTDATAAKGERLFEAASEQLADL 237


>gi|269126593|ref|YP_003299963.1| Creatininase [Thermomonospora curvata DSM 43183]
 gi|268311551|gb|ACY97925.1| Creatininase [Thermomonospora curvata DSM 43183]
          Length = 237

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 73/230 (31%), Positives = 113/230 (49%), Gaps = 29/230 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++P+G+ EQHGPHLP+ TD +IA  +AER  + L    P    PV   G S EH    G
Sbjct: 19  VLVPVGSTEQHGPHLPLGTDGLIARAVAERAAAAL--DGPPLVAPVIAYGASGEHAGFPG 76

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGI--RKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
           T ++ +  A+E  L  ++ +R + +   +IV +N HGGN+P  ++ +   RMR     V 
Sbjct: 77  TVSIGH-RALEAML--VEIVRSLALWAGRIVFVNGHGGNTP--ALDAAVGRMRAEGHQV- 130

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
            +W+   +P G           H G  ETS+ML LAPHLV+     + S           
Sbjct: 131 -AWAGCGVPGGD---------AHAGHTETSVMLHLAPHLVRP--FGHVSGDARPLAEIMP 178

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
            L A G       ++ L+P GV+G+   A+ + G  L++      I+ + 
Sbjct: 179 ELVARG-------VRALSPSGVLGDPAGASAEHGRALVAAMVASLIRRIE 221


>gi|310820383|ref|YP_003952741.1| creatininase family protein [Stigmatella aurantiaca DW4/3-1]
 gi|309393455|gb|ADO70914.1| Creatininase family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 639

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 101/234 (43%), Gaps = 27/234 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
            VLPLGA EQHG HLP   DT IA  LAER  + +     + C P  P+G S EHM   G
Sbjct: 405 AVLPLGAVEQHGAHLPFAADTWIADALAERFCARV--EEAIAC-PALPVGCSTEHMAFPG 461

Query: 84  T---KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS-PLVSIVSTEARMRFSM-L 138
           T   +T T    +E  LA   + R+ G  +  + + HGGN  PL   +         M L
Sbjct: 462 TLSLRTGTLRAVLEDLLA---SCRQHGFERAFLFSGHGGNEGPLAECIGALREASAPMEL 518

Query: 139 VVSTSWSRFT-----IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           +V T  +R T       Q     PE   G H GE ETS++  L    V++D  E      
Sbjct: 519 IVFTDLARLTHLSHGASQEHGVGPECS-GYHAGEFETSILRGLRSETVRLDRLEP----- 572

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
                 F       S  F  S++   P G VG+   +  ++ E  L  + +  +
Sbjct: 573 -----GFVKPTDRPSELFYPSLRVNAPNGTVGDPRPSAPERAERYLEVWVDVLV 621


>gi|310815541|ref|YP_003963505.1| Creatininase [Ketogulonicigenium vulgare Y25]
 gi|308754276|gb|ADO42205.1| Creatininase [Ketogulonicigenium vulgare Y25]
          Length = 250

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 96/219 (43%), Gaps = 18/219 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLPLGA EQHG HLP+  D  +A G+A  I   L   L    +P  P G +  +    
Sbjct: 23  VAVLPLGAVEQHGAHLPLTVDADLALGVARAIADPLDALL----LPAMPYGDAWNNAAYP 78

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSMLVVS 141
           GT +L+ A        I   +++MG+  +++LN H GN  P++      A      L + 
Sbjct: 79  GTLSLSPATLRAAITDIGKGLQEMGVSSLILLNGHFGNHEPMLLAARDLAGGGLPCLHLD 138

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM-DLAENFSSRQSEFLRNF 200
                    +   S P      H  E+ETSMMLAL P  V+M D A ++ +  + F    
Sbjct: 139 YPGLAELAEKHCDSTPAAPHFYHADEVETSMMLALRPDAVRMADAAPSYPTFPATFGAEP 198

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
             LR+             NP GV G+   AT  KG   +
Sbjct: 199 MQLRS------------FNPSGVFGDPRPATANKGRAFI 225


>gi|115377420|ref|ZP_01464624.1| creatininase subfamily, putative [Stigmatella aurantiaca DW4/3-1]
 gi|115365577|gb|EAU64608.1| creatininase subfamily, putative [Stigmatella aurantiaca DW4/3-1]
          Length = 603

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 101/234 (43%), Gaps = 27/234 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
            VLPLGA EQHG HLP   DT IA  LAER  + +     + C P  P+G S EHM   G
Sbjct: 369 AVLPLGAVEQHGAHLPFAADTWIADALAERFCARV--EEAIAC-PALPVGCSTEHMAFPG 425

Query: 84  T---KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS-PLVSIVSTEARMRFSM-L 138
           T   +T T    +E  LA   + R+ G  +  + + HGGN  PL   +         M L
Sbjct: 426 TLSLRTGTLRAVLEDLLA---SCRQHGFERAFLFSGHGGNEGPLAECIGALREASAPMEL 482

Query: 139 VVSTSWSRFT-----IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           +V T  +R T       Q     PE   G H GE ETS++  L    V++D  E      
Sbjct: 483 IVFTDLARLTHLSHGASQEHGVGPECS-GYHAGEFETSILRGLRSETVRLDRLEP----- 536

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
                 F       S  F  S++   P G VG+   +  ++ E  L  + +  +
Sbjct: 537 -----GFVKPTDRPSELFYPSLRVNAPNGTVGDPRPSAPERAERYLEVWVDVLV 585


>gi|196231716|ref|ZP_03130573.1| Creatininase [Chthoniobacter flavus Ellin428]
 gi|196224188|gb|EDY18701.1| Creatininase [Chthoniobacter flavus Ellin428]
          Length = 252

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 113/257 (43%), Gaps = 23/257 (8%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM- 67
           D   P  A   KD  ++ PL A EQHG HLP+ TD+++   L E I+ ++P R     + 
Sbjct: 5   DLPWPAVAALPKDTPIIFPLAALEQHGHHLPVFTDSLL---LGEVIRRVVP-RFEEKALF 60

Query: 68  -PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126
            P++ +G S  H+   GT +      ++    + +     G R+   +N HGGN      
Sbjct: 61  APLQWLGNSEHHLDFAGTLSAAPRVYLDMLNGLAENFLHHGFRRFFFVNGHGGNDVPGRQ 120

Query: 127 VSTEARMRFS-----MLVVSTSWSRFTIP-QGIISFPETEIGIHGGEIETSMMLALAPHL 180
              E R R       + + +T WS  + P     +  + E+G H  E ETSMML LAPHL
Sbjct: 121 AIFELRQRHRELDDVLFLFATYWSLGSRPWDADPAIVQREMG-HACEWETSMMLRLAPHL 179

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V     +   +    F   F         S GW  ++ +  G +G    +T  KGE L  
Sbjct: 180 V----GDYKQAPPVAFGTPFT------PASRGWITRERSEPGHIGRPRFSTADKGETLFR 229

Query: 241 YFANCFIQLLNDINSFD 257
            F++    ++  +  +D
Sbjct: 230 VFSDDVASMIERVIKWD 246


>gi|158604963|gb|ABW74778.1| creatininase [Campylobacter concisus 13826]
          Length = 257

 Score = 82.0 bits (201), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 109/235 (46%), Gaps = 13/235 (5%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           +   G+ E HG HLP+  D  +   +A+R    L   + V   P  P G SI +     +
Sbjct: 27  ITTFGSCESHGWHLPLGPDLFVPEEIAKRAALRLGKTIVV---PGVPFGTSIHYNQFPMS 83

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF--SMLVVST 142
            TL +   I     I +++   GI+ I+ILN H GN P + I + + + R   ++LV   
Sbjct: 84  VTLRFETTIAIAEDIFESLINNGIKHIIILNGHDGNIPALEIAARKVKDRHKDAVLVFIP 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           +W   T  +   +F   +   HGGE ETS+ +A+ P LV ++ A++           F  
Sbjct: 144 AWWNITGARLKGTFDVWDGLGHGGEGETSITMAVKPELVNLEYAKSQVPHDVIGFGEFST 203

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
           +         W +K++   G  G++  A+++KG+ +L    +  ++++  +   D
Sbjct: 204 II--------WDIKEVTETGATGDSTKASLEKGQKMLDCVTDYVVEIVEKLEKMD 250


>gi|315231099|ref|YP_004071535.1| creatinine amidohydrolase [Thermococcus barophilus MP]
 gi|315184127|gb|ADT84312.1| creatinine amidohydrolase [Thermococcus barophilus MP]
          Length = 236

 Score = 82.0 bits (201), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 111/238 (46%), Gaps = 36/238 (15%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVTCMPVEPIGYSIEHMYV- 81
           V+LP+G+ E HG HLP+ TD      +A+R+++ L  +   +   P  PI Y   H +V 
Sbjct: 21  VILPIGSVEAHGKHLPLGTDVFAPVEIAKRVEAKLREKGKEILIAP--PIWYG--HSFVL 76

Query: 82  ---DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSM 137
               GT  +       +   ++    + G RKI++LN HGGN  PLV      AR R+++
Sbjct: 77  DVFPGTINVKADTLRRYVRDVMAEFAEEGFRKIILLNGHGGNYYPLVEAAEEVAR-RYNV 135

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGI-----HGGEIETSMMLALAPHLVKMDLAENFSSR 192
            V   +W         I F E  + I     H GE ETS++LA+ P LVKM+ AE    R
Sbjct: 136 EVWLINWW--------IDFREDILSICSSQGHAGEDETSVILAIKPELVKMEKAEG-EKR 186

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
            S+  +  K +             +L P GV  +   AT +KGE +L   +    + +
Sbjct: 187 TSKVRKIRKDIAL-----------ELFPNGVNDDPRGATKEKGEAILEVISKKIARFI 233


>gi|257387008|ref|YP_003176781.1| creatininase [Halomicrobium mukohataei DSM 12286]
 gi|257169315|gb|ACV47074.1| Creatininase [Halomicrobium mukohataei DSM 12286]
          Length = 267

 Score = 81.6 bits (200), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 86/164 (52%), Gaps = 9/164 (5%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           ++V+P+G+ EQHG HLP+ TDTI+   +           +PV   P    G+S  H+   
Sbjct: 31  VLVVPVGSIEQHGHHLPVATDTILVDAVVHGGTEQAGADVPVLVTPTVWTGFSPHHLSFG 90

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRK----IVILNAHGGNSPLV-SIVSTEARMRFSM 137
           GT +L     ++H  A+++ +   GI+     +  +N HGGN+ LV ++VST      + 
Sbjct: 91  GTLSLE----LDHLRAVLEDVALTGIQNGFDAVCFVNGHGGNAALVDAVVSTVGTETDAE 146

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           ++ +T ++  T   G +   E     HGGE ETS+ML L P LV
Sbjct: 147 VLGTTYFTLATDEVGALRDSEDGGMAHGGEYETSLMLHLRPDLV 190


>gi|322371351|ref|ZP_08045903.1| putative amidase [Haladaptatus paucihalophilus DX253]
 gi|320549341|gb|EFW91003.1| putative amidase [Haladaptatus paucihalophilus DX253]
          Length = 250

 Score = 81.6 bits (200), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 61/186 (32%), Positives = 91/186 (48%), Gaps = 11/186 (5%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVTCMPVEPIGYSIEHMYV 81
            VVLP G+ EQH  HLP+  DT+ A  L+  +    P R L +  +P  P GYS  HM  
Sbjct: 29  FVVLPTGSVEQHSLHLPVTVDTLRAESLSRELVEAAPDRDLSMVRLPTLPYGYSEHHMNY 88

Query: 82  DGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
            GT TL   TY   IE    I ++I + G  ++ I+N HGGN+  +++ +   +    + 
Sbjct: 89  AGTVTLSSDTYQRVIED---IGESIAEHGAERLAIVNCHGGNNAPLTLAADRIQRDHGVK 145

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF-L 197
                W+ F   +    F + E G H G+ ETS++    P LVK +  E    R++ F  
Sbjct: 146 TSLVHWTNFARDRLEERFGD-EWG-HAGDHETSVIELFYPDLVKTEKKEP-QVRKARFEA 202

Query: 198 RNFKYL 203
           R + Y 
Sbjct: 203 RKYTYF 208


>gi|284035547|ref|YP_003385477.1| Creatininase [Spirosoma linguale DSM 74]
 gi|283814840|gb|ADB36678.1| Creatininase [Spirosoma linguale DSM 74]
          Length = 264

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 123/264 (46%), Gaps = 16/264 (6%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           + F++ S P   ++ KD ++VLP+ A EQHGPHL ++TDT I   LA   +  L P L +
Sbjct: 1   MTFSELSYPQI-NSHKDKVLVLPIAAMEQHGPHLSVSTDTDIVTRLAVEAEKAL-PNLVL 58

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLT---YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN- 120
            C P  P G S  H+   GT +L    Y + I     +++++   G ++IV+LN HGGN 
Sbjct: 59  LC-PTLPYGSSHHHLSFGGTMSLDPELYTQVIS---CLVESLILSGHQRIVLLNGHGGNI 114

Query: 121 SPLVSIVSTEARMRFS-----MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
           +P+   ++  +R RF       L ++T W             E+    H  E ETS+ML 
Sbjct: 115 TPVKQALAVLSR-RFDASHKPTLALATYWELAGSVFAGEPPMESPALSHACEYETSLMLH 173

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           L P  V MD AE     +      ++    +   +     + ++  G  G     T +KG
Sbjct: 174 LFPEKVWMDRAERARRPERNGYIGWEDDEPYRGVTVFKQTEFISGNGSSGEPQRGTPEKG 233

Query: 236 EGLLSYFANCFIQLLNDINSFDVS 259
           + L  +     +Q L    ++ +S
Sbjct: 234 KHLFGHAVAALVQFLESFRTWPLS 257


>gi|54025178|ref|YP_119420.1| hypothetical protein nfa32090 [Nocardia farcinica IFM 10152]
 gi|54016686|dbj|BAD58056.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 233

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 103/224 (45%), Gaps = 31/224 (13%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I+ +P GA EQHGPHLP++TDT IA  L   + +    R  V   P  P G S EH    
Sbjct: 19  ILAIPFGATEQHGPHLPLSTDTDIAVALCAELAAR---RGDVLVAPPVPYGSSGEHAGFP 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKM--GIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           GT ++    A+E  L +++  R       +I++++ HGGN  L  +   +A +R     V
Sbjct: 76  GTLSIGQ-RALE--LLVVELCRSATDTFARILLVSGHGGN--LEPLHRAQALLRSESRDV 130

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
                        +  P      H G  ET++ LAL PH V+MD AE   +R    +   
Sbjct: 131 R------------VYLPRWRGDAHAGRAETALQLALTPHRVRMDRAEPGDTRPLPEI--L 176

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             LRA G       ++ ++  GV+G+   A  + G  LL+   +
Sbjct: 177 PLLRAGG-------VRAVSGNGVLGDPTGADAEHGRALLAALGD 213


>gi|288921117|ref|ZP_06415406.1| Creatininase [Frankia sp. EUN1f]
 gi|288347493|gb|EFC81781.1| Creatininase [Frankia sp. EUN1f]
          Length = 235

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 109/232 (46%), Gaps = 32/232 (13%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS-----ILPPRLPVTCMPVEPIGYSIE 77
           + VLP+G++EQHG  LP+ TDT+IA+ +A RI       +LPP +  +C        S E
Sbjct: 20  VAVLPVGSFEQHGDFLPLTTDTLIASAIARRIADDYGLFLLPP-ITFSC--------SHE 70

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM---R 134
           H    GT +++    I     I  ++   G+ ++VI+N HGGN  L +IV  EA +   R
Sbjct: 71  HASYPGTVSISARTLIALIDDITASLSASGVDRLVIVNGHGGNYVLSNIVQ-EANIGGPR 129

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
             +    T W+R     G+ +    +  +H GE+E S++L   P  V+       S +  
Sbjct: 130 MILFPGKTDWTRAREAAGMETDHSED--MHAGELEVSVLLHTTPEQVR------DSYKSG 181

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
           + + N +       H     M      GV+G    A+  KG  LL+  ++ F
Sbjct: 182 DHIANER------PHLLSVGMPTYTSTGVIGRPSLASSIKGGHLLAGLSSAF 227


>gi|269839013|ref|YP_003323705.1| creatininase [Thermobaculum terrenum ATCC BAA-798]
 gi|269790743|gb|ACZ42883.1| Creatininase [Thermobaculum terrenum ATCC BAA-798]
          Length = 265

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 108/237 (45%), Gaps = 15/237 (6%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP----PRLPVTCMPVEPIGYSIEH 78
           + V+PL   E+HG HLP+ TD  I   +A R  +I P    P    T +P        E 
Sbjct: 21  VCVIPLSVIERHGHHLPLGTDMYIGREVANRAAAIEPAIVFPDYIFTQIP--------EA 72

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
            +  GT ++     I+    +   + + G++KIV+LNAHGGN  L+++ +          
Sbjct: 73  RHRAGTISIDPDLMIQLLDNVCREVARNGLKKIVLLNAHGGNFGLLALFNMLPLYSPRDY 132

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           V+    +   +PQG+    +     H G  ETSM+LA+ P LV+MD     ++ +   L 
Sbjct: 133 VIYIVHALGPLPQGVEVPWDASAEGHAGPGETSMILAIRPDLVRMDQVP--TNDEGRALG 190

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
             + LR  G  +  W   D +P    G+A  A  + G+ LL   A    + L  I +
Sbjct: 191 RLRALREAGVQTGIWWYAD-HPTHYQGDARAADAEAGDRLLDARAEQVARALRAIKA 246


>gi|225387051|ref|ZP_03756815.1| hypothetical protein CLOSTASPAR_00801 [Clostridium asparagiforme
           DSM 15981]
 gi|225046869|gb|EEG57115.1| hypothetical protein CLOSTASPAR_00801 [Clostridium asparagiforme
           DSM 15981]
          Length = 258

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/251 (27%), Positives = 108/251 (43%), Gaps = 34/251 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV+P+G+ E HG H+P+ TDT+I     ++I  +L  +  V   P  P G +   M   G
Sbjct: 21  VVIPVGSIENHGKHMPLGTDTLIP----DKIVELLEEKSGVMIAPTIPYGATNTIMGCTG 76

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T TL     +     + D++ + G RK VILN HGGN+  +  V  +   R + L     
Sbjct: 77  TITLGTDGLVMILTKVTDSLFRYGFRKFVILNGHGGNNKAIETVGMQLHRRGAWLANLNW 136

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
           W    +  G ++ PE + G HGG  ET+ ++ + P L+  D          +   N K  
Sbjct: 137 W----LMAGELN-PEWK-GGHGGAEETAGVMGVDPSLIDYDYINEPMDLIDDVAPNMK-- 188

Query: 204 RAHGSHSFGWSMKDLNPKGVV---------GNAMD-------ATVKKGEGLLSYFANCFI 247
                 + GW   D     VV         GN          ATV+ G+ +L  FA+   
Sbjct: 189 ------TTGWGTVDYKGATVVFPREMHNYSGNGWYGKDEPHLATVEWGQEMLRTFADYMA 242

Query: 248 QLLNDINSFDV 258
             L ++   D+
Sbjct: 243 DFLTELEKLDL 253


>gi|168701038|ref|ZP_02733315.1| Creatininase [Gemmata obscuriglobus UQM 2246]
          Length = 253

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 113/260 (43%), Gaps = 19/260 (7%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
             D + P  A   K   ++LP+ A EQHG H+P+ TD+++   +  R K + P       
Sbjct: 3   LADLTWPAVAALPKTTPIILPIAALEQHGKHMPVFTDSMLLGEVVRRTK-LAPVATKCLF 61

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126
            P++ +G S  H+   GT + +    ++    + +   + G  +I  +N HGGN      
Sbjct: 62  APLQWLGNSHHHLDFPGTLSASPRVYLDLLKDLAECFIRHGFTRIAFVNGHGGNVTPYQQ 121

Query: 127 VSTEARMRF-----SMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPHL 180
              E + ++      +L+  T W     P   I    +  +G H  E ETSM+L L P L
Sbjct: 122 ALFELKQQYRDRRDLLLLALTYWDAAGNPADTIPGLVQARMG-HACEWETSMVLRLRPEL 180

Query: 181 VKMDLAENFS-SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           V  D+A         EF   ++           W M D +  G VG    AT +KGE L 
Sbjct: 181 VIGDVAAVPEVPHGREFAPGYR----------AWVMPDRSEPGHVGAPSAATAEKGEALF 230

Query: 240 SYFANCFIQLLNDINSFDVS 259
           ++FA   +  L  + ++D S
Sbjct: 231 AHFAAGVVAYLERVVNWDGS 250


>gi|110667713|ref|YP_657524.1| hypothetical protein HQ1759A [Haloquadratum walsbyi DSM 16790]
 gi|109625460|emb|CAJ51887.1| conserved hypothetical protein [Haloquadratum walsbyi DSM 16790]
          Length = 243

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 108/242 (44%), Gaps = 28/242 (11%)

Query: 25  VLPLGAYEQHGPHLPMNTDT----IIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           +LP+G+ EQHGPH P+ TDT    +IA   AE           V   P  P+G + EH  
Sbjct: 20  LLPIGSTEQHGPHAPLGTDTFDAEVIAQNAAEEYSD------SVIVAPSVPVGIAEEHRE 73

Query: 81  VDG---TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             G   T  +T+ + +     I+ ++   G   +VI+N HGGN P +  V+ +     + 
Sbjct: 74  FTGTLWTDEMTFRQYVRD---IVRSLASHGWDHVVIVNGHGGNIPALEAVTAQIIRHDNA 130

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
             V  +W         I    + +G H G IETS++    P  V  D   + ++  S+  
Sbjct: 131 YAVPFTWFE------AIGEHTSSMG-HAGPIETSLLERTRPESVHTDRLTDAAAGASDRW 183

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
            +++     GS +      +    GVVG+  +A+ + G  LL+   +    LL+ + S D
Sbjct: 184 GDWQ-----GSVNLAVDSTEFTENGVVGDPREASAELGAELLTAATDELCSLLDAVRSHD 238

Query: 258 VS 259
            +
Sbjct: 239 AA 240


>gi|282857194|ref|ZP_06266438.1| putative creatinine amidohydrolase [Pyramidobacter piscolens W5455]
 gi|282584980|gb|EFB90304.1| putative creatinine amidohydrolase [Pyramidobacter piscolens W5455]
          Length = 241

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 107/232 (46%), Gaps = 17/232 (7%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           ++LP+GA+E  GPHLP+  DT++A  +A RI      ++     P  P+GYS      +G
Sbjct: 22  MILPVGAFEVWGPHLPVGADTLVAEEIANRISE----KIGWVVGPSVPVGYSESLFAPEG 77

Query: 84  TKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
                  E++ ++L  I+D++ + G+ +   +  H GN  +++ ++T  R   ++     
Sbjct: 78  GTVTVRPESLRNYLYDIVDSLAETGVNRFCFVGPHLGNVSVITEIATHLRRTRNVKCCLI 137

Query: 143 SWSRFTIP--QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
            W R   P  +GI+ +       H  E  TS  + L P LVK +  ++     +E+    
Sbjct: 138 DWWRIIQPICRGILKYDGRPAHAHAAEAGTSTFMYLRPDLVKGERLKDVGLVANEYPDIP 197

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           +++             +  P+  VG+   A+ +KGE ++    +  ++ L  
Sbjct: 198 QFI----------PFVETYPEAHVGDPTPASAEKGEQIVGKTVDRVVEFLKQ 239


>gi|289582279|ref|YP_003480745.1| creatininase [Natrialba magadii ATCC 43099]
 gi|289531832|gb|ADD06183.1| Creatininase [Natrialba magadii ATCC 43099]
          Length = 254

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 104/228 (45%), Gaps = 13/228 (5%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           V+P G+ EQHGP LP+  D + A   A         R     +P  P+G S+ H   DGT
Sbjct: 23  VVPTGSTEQHGPALPLGMDHMAAQAFARSAAD----REDTVVLPTIPVGVSVHHRQFDGT 78

Query: 85  KTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
             ++ AE  E ++   I ++ + G+RK V++N HGGNS  +   +    +R      +  
Sbjct: 79  LYVS-AETFEQYVEETIASLAEHGVRKAVVVNGHGGNSGALRRAAR--TLRDEETAFAPP 135

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
           W+ +   + + +    E G H   +E+S++  +   LV+ D  E   +  SE        
Sbjct: 136 WNWWDSVEDVAADLFDEDGGHADAMESSLLWHIRDDLVQPDELEAAEAGASESWGE---- 191

Query: 204 RAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
             HG+ + G+   D +  G VG    A  +KGE L    A+    LL+
Sbjct: 192 SVHGA-ALGFDTIDFSESGAVGRPTQADPEKGEALFEAGADQLDALLD 238


>gi|156937482|ref|YP_001435278.1| creatininase [Ignicoccus hospitalis KIN4/I]
 gi|156566466|gb|ABU81871.1| Creatininase [Ignicoccus hospitalis KIN4/I]
          Length = 250

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 116/245 (47%), Gaps = 23/245 (9%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPV 64
           ++    +P+    R D +V+LP+G+ E+HG HLP+ TDT+IA  +A R+   L  +   V
Sbjct: 4   VYDLAKVPMSRVERLD-LVILPIGSIERHGNHLPLGTDTLIAEEVARRVAKKLSEKGYHV 62

Query: 65  TCMPVEPIGYSIEHMYVDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
             +P    GY+    ++DGT ++     A+ +E  L  + + R   I +I+I+N HGGN 
Sbjct: 63  GLLPPIWYGYTWSLRHLDGTVSVEAENLAKFVEDILVTLPSPR---IPRILIINGHGGNK 119

Query: 122 PLVSIVSTEARMRFS--MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
             + +   EA  R S  + + + SW      +  +    T +  H  EIETSM++A+   
Sbjct: 120 EPLEVAVKEALNRLSPGIKIGAVSWWDMVPKEAFLQAFGT-LPSHACEIETSMVMAICEE 178

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            V +   E     + + LR+    R   S            +G +G+   A  ++GE LL
Sbjct: 179 CVDLGDVEPVPPAERKLLRSLSETRRAFS------------RGYMGDPKRAKKEEGERLL 226

Query: 240 SYFAN 244
              A 
Sbjct: 227 EVAAE 231


>gi|146304172|ref|YP_001191488.1| creatininase [Metallosphaera sedula DSM 5348]
 gi|145702422|gb|ABP95564.1| Creatininase [Metallosphaera sedula DSM 5348]
          Length = 226

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 91/181 (50%), Gaps = 27/181 (14%)

Query: 12  LPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEP 71
           L L  D     I V+P+G+ EQHGPHLP+ TD++IA  +AE++  I      +   P   
Sbjct: 4   LELTKDELSSPIGVIPVGSIEQHGPHLPLGTDSMIAEAVAEKVAQI----EGLLLFPTVY 59

Query: 72  IGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
            G S+EH  +    ++     +     I+++  K+ I+ +V++N HGGN+ L+ +V    
Sbjct: 60  YGCSVEHGDLPQV-SIGDVNFLNMMGDILESSVKLNIKGLVLVNGHGGNTDLLKVV---- 114

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPET-EIGI-------HGGEIETSMMLALAPHLVKM 183
                     T    FT P+  +   +  EIGI       H G +ETS++L L P LV++
Sbjct: 115 ----------TRRVNFTRPRPKVMLVDLHEIGIFSQYRDLHAGTVETSLLLYLRPELVRL 164

Query: 184 D 184
           D
Sbjct: 165 D 165


>gi|269929058|ref|YP_003321379.1| Creatininase [Sphaerobacter thermophilus DSM 20745]
 gi|269788415|gb|ACZ40557.1| Creatininase [Sphaerobacter thermophilus DSM 20745]
          Length = 251

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 107/242 (44%), Gaps = 31/242 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTD----TIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           VV   G+ EQHGP LP  TD    T++A  +AER+ ++L         P  P G S  HM
Sbjct: 26  VVTAAGSMEQHGPQLPFQTDTLLGTVLAEAVAERLGNVL-------VGPTIPFGVSEHHM 78

Query: 80  YVDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSI-VSTEARMR 134
              GT TL   T+   + H++A   ++   G   ++++ +HGGN +PL  +   T  ++ 
Sbjct: 79  AFPGTITLDTATFKAVVRHYVA---SLAHHGFTTVIVIPSHGGNFAPLRELEEETGGQIG 135

Query: 135 FSMLVVSTSWSRFTIPQGIISFPE----TEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
            +  +  T    F  P   I+  +       G H GE ETSM+LA  P LV M      S
Sbjct: 136 GARYLPYTDLMAFMKPMEEIAAQDGITPQVAGAHAGEAETSMVLAARPDLVDM------S 189

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
                F+  F    A     F   M  L   G++G+A  A   +GE  ++  A+      
Sbjct: 190 QAAEGFVGTFDAGAAQ--LIFERGMTALTANGILGDARPADAARGERYIAALADMLAAYF 247

Query: 251 ND 252
            +
Sbjct: 248 RE 249


>gi|253578650|ref|ZP_04855921.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849593|gb|EES77552.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 253

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 113/247 (45%), Gaps = 16/247 (6%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
            KD I+V+P+G+ EQHG    + TD ++ + LA+ ++ +      V   P  P G    H
Sbjct: 16  EKDPIIVIPVGSTEQHGTQGALGTDFMVPSYLADHVEDVDN----VIVAPTVPYGVCPYH 71

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
           +  +G+  + Y         I+D++ + G ++ V+LN HGGN+P +   + E   +  + 
Sbjct: 72  LSFEGSINIGYEGLYMVLHGIMDSLMQHGAKRFVVLNGHGGNTPSIDRAALEVYHKGGVC 131

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
                WS       +    +   G HG  +ETS M+A+AP  V ++L++  +++      
Sbjct: 132 ASVDWWSL------VAQLDKKFDGGHGDVLETSAMMAIAPESVHLELSKPINAQDPSENM 185

Query: 199 NFKYLRA----HGSHSFGWSMKDLNPKGVVG--NAMDATVKKGEGLLSYFANCFIQLLND 252
              Y++A     G        K++ P G  G  +  D++ + G+  L    +     L +
Sbjct: 186 KAAYIQAVNFKGGIVRLVRDTKEIAPSGWFGPFDPKDSSAELGQEALDLAVSYIRDFLEE 245

Query: 253 INSFDVS 259
           +   ++S
Sbjct: 246 MKQIELS 252


>gi|319649268|ref|ZP_08003427.1| hypothetical protein HMPREF1013_00031 [Bacillus sp. 2_A_57_CT2]
 gi|317399073|gb|EFV79752.1| hypothetical protein HMPREF1013_00031 [Bacillus sp. 2_A_57_CT2]
          Length = 256

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 112/223 (50%), Gaps = 18/223 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
             ++P+GA+EQHGPH+  + D ++A  +A ++   + P   VT  P   +G S  H++  
Sbjct: 23  FAIIPVGAHEQHGPHMAESCDAVLAERMANKLGQRMFPYAIVT--PTVNMGVSEHHIHFP 80

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV-- 140
           GT TL  +  I     ++ ++++ GI+K + LN+HGGN   +++ +        + V   
Sbjct: 81  GTITLQPSTLIAILTDMVSSLKQHGIKKFLFLNSHGGNQSTLNLAAMTITKELEVEVYYA 140

Query: 141 -STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS---EF 196
            +TS ++ +I +    + ++ +  H  E E S  L LAP LV+ DL E    ++    E 
Sbjct: 141 KTTSSAKGSIGK----YVKSPLFGHSCEREVSEALYLAPELVREDLLEKGDIKEGGRWER 196

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LR  K ++        +  +++   G +G+    + + GE ++
Sbjct: 197 LRPGKAVQGF------YFYEEMTGNGCIGDGRQGSREIGEQIV 233


>gi|295696603|ref|YP_003589841.1| Creatininase [Bacillus tusciae DSM 2912]
 gi|295412205|gb|ADG06697.1| Creatininase [Bacillus tusciae DSM 2912]
          Length = 231

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 117/238 (49%), Gaps = 16/238 (6%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +VLP+GA EQHGP LP++TD  IAA LAE+++ +L     V  +P  P   S EH    G
Sbjct: 1   MVLPMGAVEQHGPILPIDTDLRIAALLAEKLEEVLGTHR-VLRLPPIPFTLSWEHRGFPG 59

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST-EARMRFSMLV 139
             +L   T    ++  +  + A    G   +V+++ HGGN  L S+ +   AR    ++V
Sbjct: 60  VISLSVVTLHHILDDLMTSLRAWGSYGPSLVVLVSWHGGNQALESLAAELGARHNLPLVV 119

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           + +S SR    Q  ++ P+    +H G +ETS++ A  P     DL  N ++   E    
Sbjct: 120 LPSSKSRRAAYQ--MAGPQD---VHAGSLETSIITAFWP-----DLLANRTAMLQEDAPP 169

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
           F+ +    +   G  M+ ++  GV GNA + +V  G+  +          + ++ SF+
Sbjct: 170 FQAMDVQTALQ-GLGMRRISSSGVWGNAANPSVDAGKAGIQQLVAQMAAEVREMLSFE 226


>gi|15922840|ref|NP_378509.1| hypothetical protein ST2507 [Sulfolobus tokodaii str. 7]
 gi|15623631|dbj|BAB67618.1| 231aa long conserved hypothetical protein [Sulfolobus tokodaii str.
           7]
          Length = 231

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 118/244 (48%), Gaps = 38/244 (15%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM--- 79
           I ++P+G+ EQHGPHLPM TD+II   +A+RI+ +L  +  +   P      SIEH    
Sbjct: 19  IPLIPIGSIEQHGPHLPMGTDSIIVEEIAKRIEKMLSDK--ILLFPTIYYTCSIEHGDFP 76

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR---FS 136
           Y      ++Y   I +   +++ + +    K +ILN HGGN  ++ IV      +   F 
Sbjct: 77  YF----GVSYITMISYLTELVNQLSRY-FDKAIILNGHGGNESILDIVKRSINFQNKHFK 131

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           + + S       + +G+  F   +  +H G +E+S++  + P LV+            E 
Sbjct: 132 LYIFS------VVGKGLEYFKIRD--LHAGTVESSIIKYINPRLVR-----------EER 172

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           L++  Y    G  +   +  D NP G++   +D  VK  E L   F +   +++ND+ SF
Sbjct: 173 LKDIDYTVKDGVFN-TITTSDANPHGIIN--LDGKVKIDEKLGEEFIS---RVVNDLYSF 226

Query: 257 DVSI 260
            +S+
Sbjct: 227 ILSL 230


>gi|55376890|ref|YP_134741.1| creatinine amidohydrolase [Haloarcula marismortui ATCC 43049]
 gi|55229615|gb|AAV45035.1| creatinine amidohydrolase [Haloarcula marismortui ATCC 43049]
          Length = 266

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 109/237 (45%), Gaps = 18/237 (7%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI---GYSIEHM 79
           ++V+P+G+ EQHG HLP+ TDT+    L E +      RL    + V P    G+S  H+
Sbjct: 31  VLVIPVGSVEQHGNHLPVVTDTL----LVEAMVDTAIERLDGVPVVVTPPVWSGFSPHHL 86

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRK----IVILNAHGGNSPLVSIVSTEARMRF 135
              GT +L +A    H  A ++ I   GI+     ++ +N HGGNS L+  V +   +  
Sbjct: 87  SFGGTLSLEFA----HLRATLEDIAHAGIQNGFDAMLFVNGHGGNSSLIDAVVSTVGVDT 142

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIG--IHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
              V+ T++      + I     TE G   HGGE ETS+MLAL P LV      +     
Sbjct: 143 DAEVLGTTYFHLASDR-IEELRTTETGGMAHGGEFETSLMLALRPDLVGDPAVRDGEPMD 201

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
             +    + L   G+ S   S  + +  G +G    A+ + GE + S   +    L+
Sbjct: 202 EHYGWGGQDLLDGGNVSVYRSFDEYSSSGAIGTPKQASAETGERIRSVIGDELAALM 258


>gi|291300801|ref|YP_003512079.1| Creatininase [Stackebrandtia nassauensis DSM 44728]
 gi|290570021|gb|ADD42986.1| Creatininase [Stackebrandtia nassauensis DSM 44728]
          Length = 260

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 109/248 (43%), Gaps = 22/248 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           ++VLP+GA EQHGP LP+ TD  +A  +AE          P+   P  P G SI H++  
Sbjct: 24  VLVLPIGAIEQHGPSLPLGTDAALAEAVAEAGIEASATSRPLVLAPTIPYGNSIHHLFA- 82

Query: 83  GTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
                  +  ++  LA +ID+  + G R+I ILN HGGN   V +   +A  R  +++ +
Sbjct: 83  -CAGSVSSRTLQLVLADLIDSFVRSGFRRIFILNGHGGNDECVHLAVKDAVNRHPVVLGA 141

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS-----EF 196
            S+    +P GI  FP  ++  H G  E S+++A    L+  D A       S     +F
Sbjct: 142 ASYWTL-VPDGI--FPADQVPGHAGAFEASLLMAARADLLPPDAAAGGPPGSSMVHTGDF 198

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
                 +RA       W+       G   +   A ++ G   L        Q L+     
Sbjct: 199 GPGVTVVRAG-----DWATS----GGFTDDPAKADIEAGRECLRALGQRLGQALDRFA-- 247

Query: 257 DVSIFDKD 264
           DVS+ D D
Sbjct: 248 DVSLPDDD 255


>gi|224539279|ref|ZP_03679818.1| hypothetical protein BACCELL_04181 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224519101|gb|EEF88206.1| hypothetical protein BACCELL_04181 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 253

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 112/248 (45%), Gaps = 25/248 (10%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D + D +V+LP GA E H  HLP  TD I+   +A    ++      V CM + P+ + +
Sbjct: 18  DVKYD-VVILPWGATEPHNLHLPYLTDCILPHDIAVDAAALALEHSGVRCMVMPPVPFGV 76

Query: 77  ------EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
                 E  +   T+  T    +E    I+ ++   G+RK++I++ HGGN+    ++   
Sbjct: 77  HNPGQRELPFCIHTRYSTQQAILED---IVASLYAQGMRKLIIISGHGGNN-FKGMIRDL 132

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
           A +    L+++T W     P+G   + E EI  H GE ETS+M+   P LV +D A +  
Sbjct: 133 AFVYPDFLIIATDWFSIVSPKG---YFEAEIDDHAGESETSVMMHYHPELVNLDEAGDGE 189

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGV---VGNAMDATVKKGEGLLSYFANCFI 247
           S+         +     +   GW+ +  +   +   VGN   A+ +KG   +        
Sbjct: 190 SK--------PFAIPSLNEKVGWAPRHWDKATIDSGVGNPRKASAEKGAHYVKPVIEKLA 241

Query: 248 QLLNDINS 255
           QL  ++  
Sbjct: 242 QLFTEVGQ 249


>gi|160882334|ref|ZP_02063337.1| hypothetical protein BACOVA_00282 [Bacteroides ovatus ATCC 8483]
 gi|156112248|gb|EDO13993.1| hypothetical protein BACOVA_00282 [Bacteroides ovatus ATCC 8483]
 gi|295084112|emb|CBK65635.1| Uncharacterized protein, putative amidase [Bacteroides
           xylanisolvens XB1A]
          Length = 254

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 114/243 (46%), Gaps = 23/243 (9%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           RK  IV+LP GA E H  HLP  TD I++  +A     I   +  V CM + PIG   ++
Sbjct: 21  RKYDIVILPWGATEPHNLHLPYMTDCILSHDVAVDAALIAKQKYGVNCMVMPPIGMGSQN 80

Query: 79  MYVDGTKTLTYA-----EAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
               G + L +      E  +  L  I+ ++   GIRK+VI+N HGGN+   S++   + 
Sbjct: 81  ---PGQRELPFCIHTRYETQKAILTDIVSSLYVQGIRKLVIINGHGGNT-FKSMIRDLSV 136

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
                L+ S+ W      +     P    G H  E+ETS+M+   P LV ++ A N    
Sbjct: 137 DYPDFLIASSEWYTVLKVKDYFENP----GDHADEVETSVMMHYHPELVNLEEAGN-GEY 191

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG----EGLLSYFANCFIQ 248
           ++  +++     A    ++G   KD      VG+   A+V+KG    E +   +A  F +
Sbjct: 192 KTFAIQSLNEKVAWIPRNWGKVSKDTG----VGDPRGASVEKGKKFAEAVAEKYAKLFDE 247

Query: 249 LLN 251
           L+N
Sbjct: 248 LVN 250


>gi|328952196|ref|YP_004369530.1| Creatininase [Desulfobacca acetoxidans DSM 11109]
 gi|328452520|gb|AEB08349.1| Creatininase [Desulfobacca acetoxidans DSM 11109]
          Length = 242

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 115/246 (46%), Gaps = 29/246 (11%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           K   VV+P G+ E+HGPHLP++TDT+ A  +A R+    P       +   P+ Y I   
Sbjct: 17  KTETVVIPFGSVEEHGPHLPLSTDTMHAQEVAARLAKRCP------MLVAAPVHYGICRS 70

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIR---KMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
             +   T++ +      LA +D  R   + G R++++L  H G + + +++    R+   
Sbjct: 71  TREHPGTISISGDALRTLA-LDLGREFYRQGCRRLILLTGHAGGTHVAALIEAGERLLVE 129

Query: 137 M--LVVSTSWSRFTIPQGIISFP---ETEIGIHGGEIETSMMLALAPHLVKMDLAENFSS 191
           +  L ++       + + ++ +P    T    H GE+ET++MLA  P LV          
Sbjct: 130 LPDLKIAVVNILQLLREVLVQYPGLVHTPGDSHAGEVETAIMLAARPELVS-------GK 182

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
             +E+ R  K++       F W      P GV G+   A  ++GE +L+      ++LLN
Sbjct: 183 APAEWPRFPKFVLVRRKRKF-W------PGGVWGDPTQANAEQGEQILNLEVQFLLELLN 235

Query: 252 DINSFD 257
            +N+ +
Sbjct: 236 TMNNME 241


>gi|258651016|ref|YP_003200172.1| creatininase [Nakamurella multipartita DSM 44233]
 gi|258554241|gb|ACV77183.1| Creatininase [Nakamurella multipartita DSM 44233]
          Length = 232

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 110/233 (47%), Gaps = 31/233 (13%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +++LPLG+ EQHGPHLP++TDT+IA  LA+   +  P    V   PV P G S EH +  
Sbjct: 22  VLLLPLGSTEQHGPHLPLSTDTVIATRLAQWAHARRP---EVGLAPVMPYGASGEHAHFP 78

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMG--IRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           GT ++   EA+     +I+ +R      R ++++N HGGN+  +      +R     L V
Sbjct: 79  GTLSIG-TEALA--TVLIEFVRHAAGSWRHVLVVNGHGGNADALRRAVEVSRYEGRSLHV 135

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
             + S      G  + P      H G+ ETS+ML L P  V+MD A     + +      
Sbjct: 136 HHAAS-----AGPRADP------HAGDRETSLMLHLDPDRVRMDRA--VPGQTAPIAELM 182

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
             +   G       ++ ++P GV+G    A  ++G      FA    +LL  I
Sbjct: 183 PRISTDG-------IRAVSPTGVLGEPTGADAEEGR---RVFAEMGGRLLATI 225


>gi|160937890|ref|ZP_02085248.1| hypothetical protein CLOBOL_02784 [Clostridium bolteae ATCC
           BAA-613]
 gi|158439116|gb|EDP16870.1| hypothetical protein CLOBOL_02784 [Clostridium bolteae ATCC
           BAA-613]
          Length = 275

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 108/239 (45%), Gaps = 11/239 (4%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAE-RIKSILPPRLPVTCMPVEPIGYSI 76
           A ++ +V++PLGA EQHGPHLP  TD+++A    +   K +          P   I  S+
Sbjct: 39  AEENTLVLIPLGATEQHGPHLPAGTDSMLAEAACDIAAKKLDEMGRHAVIAPTVTISNSL 98

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
            H    GT +L     +++  +I   I   G R I  +N HGGN     +   +   R+ 
Sbjct: 99  HHGSYPGTLSLDPRLYMDYLTSIARGIVSHGFRNICCVNGHGGNGTPTDMAVMDIVTRYG 158

Query: 137 MLVVSTSWSRFTIPQG--IISFPETEIGI-HGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           + +   SW  + +       +  +T+  I H  E+ETS+MLAL   LV     E   ++ 
Sbjct: 159 IHI---SWVPYYVGCNGDFEAILDTQSNIFHADEVETSLMLALDESLVDPCYKE---AKG 212

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
               +   + R     +F    +     G++GN+  AT +KGE L    A+  +Q L D
Sbjct: 213 GNVQKGTPHGRPGRPFTF-LPFETRTETGILGNSYAATREKGEQLWEAVASHLVQALLD 270


>gi|295110922|emb|CBL27672.1| Uncharacterized protein, putative amidase [Synergistetes bacterium
           SGP1]
          Length = 272

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 106/230 (46%), Gaps = 17/230 (7%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPM---NTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           +KD ++++PLG+ EQ GPH P         +A  +++R  + +      TC+   P GYS
Sbjct: 19  KKDPVILIPLGSTEQQGPHTPTGDYRCAEAVAKAVSKRTGAYM-----TTCI---PFGYS 70

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE-ARMR 134
                  G+ +L     I     I       GI++I+  N H GN+PL+  VS    R R
Sbjct: 71  EYFRGFPGSVSLQPKTFISLMEDICCCFLDHGIKRIMFFNGHAGNNPLLDRVSRMILRER 130

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS--SR 192
             M+     WS  T       F + +   HG E  TSM   L P  ++M+L       +R
Sbjct: 131 GIMIPNVNLWSLLTPAFRKSVFDDPKTSAHGAEPLTSMTWYLNPEDMRMELLPERPRINR 190

Query: 193 QSEFL--RNFKYLRAHG-SHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           Q + +   N   L   G   S   +M+D++P G++GNA+ A+ + G+ L 
Sbjct: 191 QVQGMDVENLTTLTYDGIGFSVFMNMEDISPDGIMGNALLASPENGKKLF 240


>gi|326384844|ref|ZP_08206519.1| Creatininase [Gordonia neofelifaecis NRRL B-59395]
 gi|326196363|gb|EGD53562.1| Creatininase [Gordonia neofelifaecis NRRL B-59395]
          Length = 237

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 113/235 (48%), Gaps = 31/235 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +V+P+GA EQHGPHLP++TD  IA  +A    + L     V   P  P G S EH    G
Sbjct: 22  IVVPIGAVEQHGPHLPLDTDHRIAVAVAREAVAALGDSSNVLLAPAIPYGASGEHEGFPG 81

Query: 84  TKTLTYAEAIEHWLAIID----AIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
           T ++   EA+E  L +++    A+R  G  +++ +NAHGGN    ++ +  AR+R+    
Sbjct: 82  TVSIGR-EALE--LVVLEYGRSAMRWAG--RLLFVNAHGGNG--QALATAVARLRYE--- 131

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
                + F       +FP  +   H G  ETS+ML+LAP  V+  LA   +   S     
Sbjct: 132 -GRDAAFFP-----CAFPGAD--AHAGHTETSVMLSLAPDDVRRSLAA--AGNTSPIAAL 181

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
              LR  G       +  ++P GV+G+A  A    G  LL+  A+     L D N
Sbjct: 182 LGPLREGG-------VAAVSPNGVLGDATAADPDHGTELLAGLADRLAVGLRDWN 229


>gi|229490589|ref|ZP_04384427.1| creatininase family protein [Rhodococcus erythropolis SK121]
 gi|229322409|gb|EEN88192.1| creatininase family protein [Rhodococcus erythropolis SK121]
          Length = 230

 Score = 79.3 bits (194), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 101/212 (47%), Gaps = 30/212 (14%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV+P+G++EQHGPHLP++TDT IA  +A+ +  ++         P    G S EH    G
Sbjct: 22  VVVPVGSFEQHGPHLPLDTDTRIARAVAQALPDVV-------VAPAIEYGASGEHEGFAG 74

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T ++  AEA+E  +           ++++ +N HGGN P  ++    A +R+       +
Sbjct: 75  TISIG-AEAMETVVVEYGRSAFRWTKRVLFVNGHGGNGP--ALAKAVALLRYEGR--DAA 129

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
           W+   +              H G  ETS++L L+P LV M LAE  +   S        +
Sbjct: 130 WAPCAV---------AGADAHAGHTETSLLLHLSPDLVHMSLAE--TGNLSPIADLMPGM 178

Query: 204 RAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           R+ G       M  ++  GV+GN + AT + G
Sbjct: 179 RSGG-------MVAVSQNGVLGNPVGATAEDG 203


>gi|89071014|ref|ZP_01158234.1| hypothetical protein OG2516_17965 [Oceanicola granulosus HTCC2516]
 gi|89043438|gb|EAR49654.1| hypothetical protein OG2516_17965 [Oceanicola granulosus HTCC2516]
          Length = 253

 Score = 79.3 bits (194), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 116/246 (47%), Gaps = 28/246 (11%)

Query: 14  LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG 73
           + A A +  + +LP+G++EQHGPHLP++TD  IA  +A         R     +PV  +G
Sbjct: 15  IAAFAERHPVAILPVGSFEQHGPHLPLDTDNRIAEAMALETAR----RSVGMVLPVLNVG 70

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAII----DAIRKMGIRKIVILNAHGGN-SPLVSIVS 128
           Y+       GT T  +    E ++AII    +++   GI+ + +L+ HG N  P+   + 
Sbjct: 71  YAWVWRGKPGTLTFRF----ETYMAIIRDIAESLSGWGIKAVYVLSGHGSNPQPVKHAIR 126

Query: 129 TEARMRFSMLVVSTSWSRF-TIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD-LA 186
                 + + V++  +S    + +   S P     IH  EIETS+MLA+AP LV+MD  A
Sbjct: 127 EHIHGHYDIGVLNGIYSGLGEMLEECDSRPWHN-DIHAEEIETSLMLAIAPELVRMDRAA 185

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
            ++    +E+ ++              SM  L   GV G+   A+ +KG   L       
Sbjct: 186 ADYPPVPAEYGKSEL------------SMGQLMESGVFGDPTVASAEKGRRWLETGGQRS 233

Query: 247 IQLLND 252
            +L  D
Sbjct: 234 AELWLD 239


>gi|3873398|gb|AAC77474.1| unknown [Rhodococcus erythropolis]
          Length = 230

 Score = 79.3 bits (194), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 102/212 (48%), Gaps = 30/212 (14%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV+P+G++EQHGPHLP++TDT IA  +A+ +  ++         P    G S EH    G
Sbjct: 22  VVVPVGSFEQHGPHLPLDTDTRIARAVAQALPDVV-------VAPAIEYGASGEHEGFAG 74

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T ++  AEA+E  +           ++++ +N HGGN P  ++    A +R+       +
Sbjct: 75  TISIG-AEAMETLVVEYGRSAFRWTKRVLFVNGHGGNGP--ALAKAVALLRYEGR--DAA 129

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
           W    +P  +          H G  ETS++L L+P LV M LAE  +   S        +
Sbjct: 130 W----VPCAVAG-----ADAHAGHTETSLLLHLSPDLVHMSLAE--TGNLSPIADLMPGM 178

Query: 204 RAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           R+ G       M  ++  GV+GN + AT + G
Sbjct: 179 RSGG-------MVAVSQNGVLGNPVGATAEDG 203


>gi|257051635|ref|YP_003129468.1| Creatininase [Halorhabdus utahensis DSM 12940]
 gi|256690398|gb|ACV10735.1| Creatininase [Halorhabdus utahensis DSM 12940]
          Length = 260

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 106/228 (46%), Gaps = 10/228 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I ++PLG+ EQHGPHLP  TD +IA   A         R      P   IG S  H    
Sbjct: 20  IALIPLGSTEQHGPHLPEGTDHLIAEAFATEAAD----RTGFLRTPPVRIGVSPHHQQFP 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT ++      ++  +   ++   GI +++ +NAHGGN   +  V    R   ++  V  
Sbjct: 76  GTMSVDPPAFRDYVESFTRSLTNHGIDRVIYVNAHGGNITHLREVGRRLREDGTVFAVEW 135

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W   +IP+ +    +   G HGG  ET+++  L P LV     E+  +R    +   + 
Sbjct: 136 MWDE-SIPEQVNDVFDHN-GPHGGPKETALIQHLHPDLVHEGRLED--ARDGGRVEVSQD 191

Query: 203 L-RAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
           + R HG+ +F  S+++ +  GV G+  +AT + G  L    ++  + L
Sbjct: 192 VGRVHGARTFYDSIEN-SENGVFGDQTEATAEIGAELFDAASDELVAL 238


>gi|294055603|ref|YP_003549261.1| Creatininase [Coraliomargarita akajimensis DSM 45221]
 gi|293614936|gb|ADE55091.1| Creatininase [Coraliomargarita akajimensis DSM 45221]
          Length = 260

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 98/226 (43%), Gaps = 16/226 (7%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-D 82
           V+LPLGA EQHGPHL    D++    LA+++ + L  R  V  +P    G SI H +   
Sbjct: 28  VILPLGATEQHGPHLGTGMDSV----LADQLCAELGERTQVPVLPTLSYGCSIGHSHRWP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  L+    I     I D + + G+R+I ++N H GN+  V       R R+  L+++ 
Sbjct: 84  GTLALSPTTLIAVLCDIGDWLYRAGVRRIFLVNCHVGNAAPVRCALDTLRCRYDDLMLAA 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
                  P+    F       H    ETS+MLA AP +V+  +  +         R    
Sbjct: 144 LNDGDLTPEIAKEFAADGNDWHANAAETSLMLAKAPEMVRPAVVASADDPD----RTADC 199

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
           + AH        +   +  GV G+   ATV  GE L        ++
Sbjct: 200 VFAH-------PVNRTSTNGVTGSPSRATVAAGEALYETMLTTLVE 238


>gi|265763194|ref|ZP_06091762.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|263255802|gb|EEZ27148.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
          Length = 253

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 105/245 (42%), Gaps = 24/245 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI------ 76
           +++LP GA E H  HLP  TD I+   +A     +   R  V CM + P+ +        
Sbjct: 22  VIILPWGATEPHNLHLPYLTDCILPHDIAVEAAELALSRSGVRCMVIPPVPFGAHNPGQR 81

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           E  +   T+  T    +E    I+ ++   G RK++IL+ HGGN+    ++   A     
Sbjct: 82  ELPFCIHTRYATQQAILED---IVSSLHVQGFRKLLILSGHGGNN-FKGMIRDLAFEYPD 137

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
            L+ + +W     P+G     E EI  H GE ETS+M+   P LV +  A +  S+    
Sbjct: 138 FLIAAANWFEVVSPKGYF---EAEIDDHAGESETSVMMHYHPELVNLAEAGDGESK---- 190

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGV---VGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                +  A  +    W+ +  +   V   VGN   AT +KGE  +         L  ++
Sbjct: 191 ----PFAIASLNEKVAWAPRHWDKATVDSGVGNPKKATAEKGERYVKPIVEKLAGLFEEM 246

Query: 254 NSFDV 258
              D+
Sbjct: 247 AQHDL 251


>gi|159040706|ref|YP_001539958.1| creatininase [Caldivirga maquilingensis IC-167]
 gi|157919541|gb|ABW00968.1| Creatininase [Caldivirga maquilingensis IC-167]
          Length = 245

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 105/238 (44%), Gaps = 14/238 (5%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP G  E HGPHLP+ TD ++A  +AE        R     +P    G +       
Sbjct: 18  IAILPTGIVEAHGPHLPLGTDALMATYIAEEAAR----RTNALLLPTVWYGNTYVLDKFP 73

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +++       +  I   + + G++ +V++N HGGN   +S+ S +     +++++  
Sbjct: 74  GTISISNEVLYMLYREIFREVVRNGVKYLVVVNGHGGNVDALSMASKDVAKETNLVIILV 133

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           +W      +      ET  G H  E ETS + A  PHLVK    +  +    E       
Sbjct: 134 NWWIDLGREARRKVLETPEG-HAAEDETSEVWAAYPHLVKWIPRDGSADEWVEV-----K 187

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
            R +G  ++         K V G    A+V+KG+ +L    N   QL+ND+ S  + I
Sbjct: 188 FRVYGKDAYALEYT----KAVQGYPSRASVEKGKVILESAINELTQLINDLRSGKLPI 241


>gi|229494534|ref|ZP_04388297.1| creatinine amidohydrolase [Rhodococcus erythropolis SK121]
 gi|229318896|gb|EEN84754.1| creatinine amidohydrolase [Rhodococcus erythropolis SK121]
          Length = 250

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 112/239 (46%), Gaps = 35/239 (14%)

Query: 17  DARKDWI--VVLPLGAYEQHGPHLPMNTDTIIAA----GLAERIKSILPPRLPVTCMPVE 70
           +A  D I  V+  +GA EQHGPHLP++TDT+I       +A RI + +         P  
Sbjct: 8   EAMNDGIRNVIFAVGATEQHGPHLPLSTDTLIGTATSLAVATRIGATM-------VAPTI 60

Query: 71  PIGYSIEHMYVDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSI 126
             G S  HM   GT +L   T+ + +E +   + ++   G   I+++++HGGN  PL  +
Sbjct: 61  AFGVSPHHMSFPGTVSLREATFLDVVEDY---VRSLAAHGFDNILVISSHGGNFEPLAHL 117

Query: 127 VST------EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           +        E R+     ++    +   + +     PE   G H G+ ETS++LAL P L
Sbjct: 118 IERVGPRIGETRIHAHTDLLQLLAAFEAVAEEDSISPEA-CGSHAGDFETSIVLALRPDL 176

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           V M+ AE        FL  F    A  +  F    K L+  G++G+ + A   +GE  L
Sbjct: 177 VDMNAAE------PGFLGRFDKDTA--TALFDGGTKALSVNGILGDPVAALASRGERYL 227


>gi|325263118|ref|ZP_08129853.1| creatininase [Clostridium sp. D5]
 gi|324031511|gb|EGB92791.1| creatininase [Clostridium sp. D5]
          Length = 253

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 104/239 (43%), Gaps = 31/239 (12%)

Query: 28  LGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTL 87
            G+ E HG H  +  D  +   +A+R+   L   + V C+P    G SI +     + TL
Sbjct: 30  FGSCESHGWHCCLGPDYFVPTEVAKRVAEKLDNVIVVPCVP---FGTSIHYNQYPMSITL 86

Query: 88  TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF---SMLVVSTSW 144
            Y   I     I +++   GI+ I ILN H GN P + I +   + R      L +   W
Sbjct: 87  RYDTEIAIAEDIFESLINNGIKHIYILNGHDGNIPALEIAAHNVKNRHKDAKFLYLPDWW 146

Query: 145 S--------RFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           +        RF +  G+          HGGE ETS+M+A+ P LV ++ A+   S+  E 
Sbjct: 147 TKVGPVMGDRFEVWNGL---------GHGGEGETSIMMAVRPELVNLEYAK---SQVPE- 193

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
               K +  + +    W +K+L   G  G+   A+++KG  +L          + ++N 
Sbjct: 194 ----KVIEINETTGIIWDIKELTETGATGDPTKASIEKGNQMLDILVGIVADAIEEMNK 248


>gi|218130725|ref|ZP_03459529.1| hypothetical protein BACEGG_02316 [Bacteroides eggerthii DSM 20697]
 gi|217987069|gb|EEC53400.1| hypothetical protein BACEGG_02316 [Bacteroides eggerthii DSM 20697]
          Length = 253

 Score = 78.6 bits (192), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 70/251 (27%), Positives = 110/251 (43%), Gaps = 25/251 (9%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D + D +V+LP GA E H  HLP  TD I+   +A    ++   R  V CM + P+ +  
Sbjct: 18  DVKYD-VVILPWGATEPHNLHLPYLTDCILPHDIAVDAATLALERSGVRCMVMPPVPFGA 76

Query: 77  ------EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
                 E  +   T+  T    +E    I+ ++   GIRK+VIL  HGGN+    ++   
Sbjct: 77  HNPGQRELPFCIHTRYTTQQAILED---IVASLYVQGIRKLVILGGHGGNN-FKGMIRDL 132

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
           A      L+++T W      +G   + E +I  H GE ETS M+   P LV +  A + +
Sbjct: 133 AVTYPDFLIMATDWFSIIPTKG---YFEADIDDHAGESETSAMMYYHPELVNLAEAGDGA 189

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGV---VGNAMDATVKKGEGLLSYFANCFI 247
           SR         +  A  +    W+ +  +   V   VGN   A+ +KGE  L        
Sbjct: 190 SR--------PFAIASLNEKVAWTPRHWDKATVDSGVGNPKKASAEKGERYLKPVIEKLA 241

Query: 248 QLLNDINSFDV 258
            L  ++   D+
Sbjct: 242 TLFAEVGQHDL 252


>gi|225570045|ref|ZP_03779070.1| hypothetical protein CLOHYLEM_06141 [Clostridium hylemonae DSM
           15053]
 gi|225161515|gb|EEG74134.1| hypothetical protein CLOHYLEM_06141 [Clostridium hylemonae DSM
           15053]
          Length = 253

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 107/247 (43%), Gaps = 31/247 (12%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +D   +   G+ E HG H  +  D  +   +A+R+   +   + V C+P    G SI + 
Sbjct: 22  EDVTAITCFGSCESHGWHCCLGPDYFVPTEVAKRVAEKMDNVVVVPCVP---FGTSIHYN 78

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF---S 136
               + TL Y   I     I +++   GI+ I ILN H GN P + I +   + R     
Sbjct: 79  QYPMSVTLRYETEIAIAEDIFESLINNGIKHIYILNGHDGNIPALEIAAHNVKDRHRDAK 138

Query: 137 MLVVSTSWS--------RFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
            L +   W+        RF +  G+          HGGE ETS+M+A+ P LV ++ A+ 
Sbjct: 139 FLYLPDWWTKVGPIMGERFEVWNGL---------GHGGEGETSIMMAVRPELVNLEYAK- 188

Query: 189 FSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
             S+  E     K +  + +    W +K+L   G  G+   A+++KGE +L         
Sbjct: 189 --SQVPE-----KVIEINETTGVIWDIKELTETGATGDPTKASMEKGEQMLDILVGLVAD 241

Query: 249 LLNDINS 255
            +  +N 
Sbjct: 242 AIEKMNK 248


>gi|292654680|ref|YP_003534577.1| creatininase [Haloferax volcanii DS2]
 gi|291371142|gb|ADE03369.1| creatininase [Haloferax volcanii DS2]
          Length = 240

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 103/237 (43%), Gaps = 22/237 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP+G+ EQHGPH P+ TD + A  +AE           V   P  P+  + EH   D
Sbjct: 18  LALLPVGSTEQHGPHAPLGTDALNAESVAEVGADAFDGE--VVVGPTIPVSVAEEHRAFD 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  ++      +    I+++   G  ++V++N HGGN   ++ +         +  V+ 
Sbjct: 76  GTLWVSPDTFRAYVRETIESLAHHGFDRVVVVNGHGGNIDALAELCRRVSRTGDVYAVAF 135

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD----LAENFSSRQSEFLR 198
           +W         +    +++G HGG +ET+++    P LV+ D      +  + R  E++ 
Sbjct: 136 TWFD------AVGDHSSDMG-HGGPLETALLRHTHPELVREDRIDEARDGGADRWGEWVS 188

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
                 AH S  F          GVVG+       +G  L S  A+    LL+ + S
Sbjct: 189 GVNL--AHDSDEF-------TDNGVVGDPAKGDADRGAELESLAADSLASLLDAVES 236


>gi|253566771|ref|ZP_04844223.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|251944334|gb|EES84823.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|301162824|emb|CBW22371.1| conserved hypothetical protein [Bacteroides fragilis 638R]
          Length = 253

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 105/245 (42%), Gaps = 24/245 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI------ 76
           +++LP GA E H  HLP  TD I+   +A     +   R  V CM + P+ +        
Sbjct: 22  VIILPWGATEPHNLHLPYLTDCILPHDIAVEAAELALSRSGVRCMVMPPVPFGAHNPGQR 81

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           E  +   T+  T    +E    I+ ++   G RK++IL+ HGGN+    ++   A     
Sbjct: 82  ELPFCIHTRYATQQAILED---IVSSLHVQGFRKLLILSGHGGNN-FKGMIRDLAFEYPD 137

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
            L+ + +W     P+G     E EI  H GE ETS+M+   P LV +  A +  S+    
Sbjct: 138 FLIAAANWFEVVSPKGYF---EAEIDDHAGESETSVMMHYHPELVNLAEAGDGESK---- 190

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGV---VGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                +  A  +    W+ +  +   V   VGN   AT +KGE  +         L  ++
Sbjct: 191 ----PFAIASLNEKVAWAPRHWDKATVDSGVGNPKKATAEKGERYVKPIVEKLAGLFEEM 246

Query: 254 NSFDV 258
              D+
Sbjct: 247 AQHDL 251


>gi|158315010|ref|YP_001507518.1| creatininase [Frankia sp. EAN1pec]
 gi|158110415|gb|ABW12612.1| Creatininase [Frankia sp. EAN1pec]
          Length = 270

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 110/241 (45%), Gaps = 31/241 (12%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL---PPRLPVTCMPVEPIGYSIEHM 79
           +V++P+G++EQHGPHLP+ TDT IA  +AE    +L    P  PV   P  P+ Y+    
Sbjct: 31  LVLVPVGSFEQHGPHLPLVTDTTIAVAVAEGAARLLLRRRPAEPVLVAP--PLTYTASGE 88

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMG--IRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           +     T++    + H L +++ IR M      +V +NAHGGN  L  +     ++R   
Sbjct: 89  HQSFAGTISIGGPVLH-LVLVELIRSMSAWAGPVVFVNAHGGN--LRGLTDAVTQLREER 145

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGI------HGGEIETSMMLALAPHLVKMDLAENFSS 191
             V  +W    +P       +T          H G  ETS+ML LAP  V M  A   ++
Sbjct: 146 HDV--AW----VPCAATGTADTARACSAAGDAHAGFTETSLMLHLAPDQVDMTRAAAGNT 199

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
              + L     L   G       +  + P GV+G+   AT + GE +L        +L++
Sbjct: 200 TSLDEL--LPALVTGG-------LAAVAPSGVLGDPTAATAQDGERILRRMVGDVCELIH 250

Query: 252 D 252
           D
Sbjct: 251 D 251


>gi|302539277|ref|ZP_07291619.1| predicted protein [Streptomyces sp. C]
 gi|302448172|gb|EFL19988.1| predicted protein [Streptomyces sp. C]
          Length = 262

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 103/218 (47%), Gaps = 15/218 (6%)

Query: 14  LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG 73
           L A  +   ++ LP+G+ EQHGPHLP+ TDT+IA     ++ +       +  +P  P G
Sbjct: 19  LTARVQASSVLCLPVGSTEQHGPHLPLATDTLIADEFTRQLVAEHGEAFDLWQLPAVPYG 78

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDA--IRKMGIRKIVILNAHGGNSP-LVSIVSTE 130
            + EH +  GT +LT  E   + L  + A  +R      +V++N HGGN   L ++V   
Sbjct: 79  IAPEHAWAPGTLSLTITE-FTNLLHTLTAQYVRATKAHHLVLVNGHGGNRGVLTALVYEL 137

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
                  + V    +   +P G    PE   G+H    ET++ML LAP  V +D   +  
Sbjct: 138 GHAHHISVCVLHPLALANLPAG--DRPEIHAGLH----ETALMLHLAPDTVLLDQLADHP 191

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKD--LNPKGVVGN 226
            + ++ +R     R     ++ W+  D  +   GV+GN
Sbjct: 192 PQDADEIRRQVTDR---GVTWPWTSGDPAIAAAGVIGN 226


>gi|83591093|ref|YP_431102.1| creatininase [Moorella thermoacetica ATCC 39073]
 gi|83574007|gb|ABC20559.1| Creatininase [Moorella thermoacetica ATCC 39073]
          Length = 282

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 112/263 (42%), Gaps = 31/263 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++P+G+ E+HG H+P+ TD+     + ER   I    +P T  P+ P GYS  HM   G
Sbjct: 24  VMVPVGSCEKHGAHVPLGTDSFTTISVTERAAKIA--NVPYT--PLLPFGYSAHHMGRVG 79

Query: 84  TKTLTYAEAIEHWLAII-DAIRKM---GIRKIVILNAHGGNSPLVSIVSTEARMR---FS 136
               T   + E +  ++ D  R +   G  KIV +  HG N+  +  +  + R +   F 
Sbjct: 80  EGCGTVTLSAETFRRVLYDIARSLIYHGANKIVFVTHHGSNTKPIDELLRKLRYQTGAFV 139

Query: 137 MLVVSTSWSRFTIPQGIISFPETEI-GIHGGEIETSMMLALAPHLVKMDLA--------- 186
               + +     + +GI+  P  E  G H GE+ET+ M+A    LV M  A         
Sbjct: 140 AFYKTPTERECEVVKGILEGPPEETPGWHAGEMETAQMMAYDERLVDMSRAVNDRAHAPA 199

Query: 187 ---ENFSSRQSEFLRNFKYLRAHGSHSFGWSMK--DLNPKGVVGNAMDATVKKGEGLLSY 241
               NFS +       F+     GS +    M+  + +    +GN    T +KG  L   
Sbjct: 200 WMGPNFSKKDGTVTVMFR-----GSENIFVPMEHHEYSDHATIGNPFRGTKEKGLKLFEK 254

Query: 242 FANCFIQLLNDINSFDVSIFDKD 264
            A      L ++  F   + ++D
Sbjct: 255 EAEHLAAFLEEVKKFPFKVENRD 277


>gi|126433481|ref|YP_001069172.1| creatininase [Mycobacterium sp. JLS]
 gi|126233281|gb|ABN96681.1| Creatininase [Mycobacterium sp. JLS]
          Length = 249

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/252 (28%), Positives = 114/252 (45%), Gaps = 39/252 (15%)

Query: 2   NPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL-PP 60
           +P + FTD S     D R+  + ++P+GA EQHGPHLP+  DTIIA  + ER   +   P
Sbjct: 11  SPDLSFTDVS-----DGRE--VGLVPVGAVEQHGPHLPVGADTIIATAMCERASELTGAP 63

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYA------EAIEHWLAIIDAIRKMGIRKIVIL 114
            LP   + V   G+  E   + GT +LT A      E   HW A+       G+R+++ +
Sbjct: 64  VLPAITLGVS-FGHGTE---LPGTLSLTPALLAGIVEQYVHWAAL------SGLRRLLFV 113

Query: 115 NAHGGNSPLVSIVSTEARM-RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEI-ETSM 172
           N H GN+  ++  +   R+ R  + V +  W  +T    +++    +         ETS+
Sbjct: 114 NGHMGNTAALNTATDRIRLERRDVRVGAVDW--WTCDDQVLTAMMADAADAHANCAETSV 171

Query: 173 MLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATV 232
           +LA+ P LV +D   +           F+Y           +  +L+  GV G    AT 
Sbjct: 172 LLAMRPDLVHLDRMRDADDEDRTAGLVFRY-----------TATELSRNGVTGKPSLATA 220

Query: 233 KKGEGLLSYFAN 244
           + GE L    A 
Sbjct: 221 ELGEQLWKLAAE 232


>gi|317474263|ref|ZP_07933539.1| creatinine amidohydrolase [Bacteroides eggerthii 1_2_48FAA]
 gi|316909573|gb|EFV31251.1| creatinine amidohydrolase [Bacteroides eggerthii 1_2_48FAA]
          Length = 253

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/251 (27%), Positives = 109/251 (43%), Gaps = 25/251 (9%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D + D +V+LP GA E H  HLP  TD I+   +A     +   R  V CM + P+ +  
Sbjct: 18  DVKYD-VVILPWGATEPHNLHLPYLTDCILPHDIAVDAAMLALERSGVRCMVMPPVPFGA 76

Query: 77  ------EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
                 E  +   T+  T    +E    I+ ++   GIRK+VIL  HGGN+    ++   
Sbjct: 77  HNPGQRELPFCIHTRYTTQQAILED---IVASLYVQGIRKLVILGGHGGNN-FKGMIRDL 132

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
           A      L+++T W      +G   + E +I  H GE ETS M+   P LV +  A + +
Sbjct: 133 AVTYPDFLIMATDWFSIIPTKG---YFEADIDDHAGESETSAMMYYHPELVNLAEAGDGA 189

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGV---VGNAMDATVKKGEGLLSYFANCFI 247
           SR         +  A  +    W+ +  +   V   VGN   A+ +KGE  L        
Sbjct: 190 SR--------PFAIASLNEKVAWTPRHWDKATVDSGVGNPKKASAEKGERYLKPVIEKLA 241

Query: 248 QLLNDINSFDV 258
            L  ++   D+
Sbjct: 242 TLFAEVGQHDL 252


>gi|298292221|ref|YP_003694160.1| creatininase [Starkeya novella DSM 506]
 gi|296928732|gb|ADH89541.1| Creatininase [Starkeya novella DSM 506]
          Length = 258

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 113/238 (47%), Gaps = 37/238 (15%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIK----SILPPRLPVTC--MPVEPIGYSIE 77
           V+LPLG+ EQHGPHLP+N D ++  G+ ER+      ++ P +   C  MP    G    
Sbjct: 25  VLLPLGSTEQHGPHLPLNVDVVLPTGVCERVAREVGGLVAPTVNYGCKSMPRSGGGEQFP 84

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIR---KMGIRKIVILNAHGGNS-PLVSIVSTEARM 133
                GT +L   +A    L + D IR   + G+R++V++N H  N  P V  +    R 
Sbjct: 85  -----GTLSL---DANTFALVVRDVIRNLVRQGVRRLVVVNGHYENCWPSVEGLDLALRE 136

Query: 134 RFS-----MLVVSTSWSRFTIPQGIIS-FPETEIGI---HGGEIETSMMLALAPHLVKMD 184
             S     ++V+   +  F     +   FPE   GI   H   +ETS+ML L P LV+MD
Sbjct: 137 LKSEGVDDLVVMRLEYWDFAQRATLDRLFPEGFPGIDLEHASLLETSLMLVLRPELVEMD 196

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
            A   +   ++F     Y R      FG     L P GV+  A  +T +KGE L++ +
Sbjct: 197 KAP--TDGPAKFP---PYDRFPVPDDFG-----LPPSGVLAVATGSTAEKGEWLMADY 244


>gi|111023040|ref|YP_706012.1| hypothetical protein RHA1_ro06077 [Rhodococcus jostii RHA1]
 gi|110822570|gb|ABG97854.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 240

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 100/227 (44%), Gaps = 30/227 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV+P+G+ EQHGPHLP++TDT IA  +   +  +L         P    G S EH    G
Sbjct: 22  VVVPVGSLEQHGPHLPLDTDTAIADAVCRALPHVL-------VAPPIAYGASGEHEGFPG 74

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L  +EA+E  L            +++ +N HGGN P  ++V   A +R+    V  +
Sbjct: 75  TVSLG-SEALETVLVEYGRSACRWADRVLFVNGHGGNGP--ALVKAVALLRYEARDV--A 129

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
           W    +P             H G  ETS++L L+P  V++  AE  +       R    L
Sbjct: 130 WVPCAVPG---------ADAHAGRTETSLLLHLSPARVRLSRAE--AGNTEPVARLMPRL 178

Query: 204 RAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           R  G       M  ++  GV+G+   AT  +G  +     +   + L
Sbjct: 179 REGG-------MVAVSANGVLGDPTGATAAEGAQIFGVLVHAVTKAL 218


>gi|307595255|ref|YP_003901572.1| creatininase [Vulcanisaeta distributa DSM 14429]
 gi|307550456|gb|ADN50521.1| Creatininase [Vulcanisaeta distributa DSM 14429]
          Length = 245

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 105/238 (44%), Gaps = 14/238 (5%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP G  E HGPHLP+ TD ++A  +AE        R  V  +P    G +       
Sbjct: 18  VALLPTGIVEAHGPHLPLGTDALMATYIAEEAAK----RTNVLLLPTVWYGNTYVLDKFP 73

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +++       +  I   + + GIR ++++N HGGN+  +++ + +     +++++  
Sbjct: 74  GTISISNETLYMLYRDIFREVARNGIRYLIVINGHGGNADALNMAAKDVAKETNLVIIII 133

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           +W      +      ET  G H  E ETS + A  P LVK    +  +    E       
Sbjct: 134 NWWIDLAKEARKKVLETPEG-HAAEDETSEVWAAYPDLVKWVPRDGSADEWVE-----AR 187

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
            R +G   +         K V G    A+ +KG+ +L    N  +QL+ND+ +  + I
Sbjct: 188 FRVYGKEVYAMEYT----KAVQGYPSRASQEKGKAILEAAVNEVVQLINDLRNGKLPI 241


>gi|237720776|ref|ZP_04551257.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|229449611|gb|EEO55402.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
          Length = 251

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 113/243 (46%), Gaps = 23/243 (9%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           RK  IV+LP GA E H  HLP  TD I++  +A     +   +  V CM + PIG   ++
Sbjct: 18  RKYDIVILPWGATEPHNLHLPYMTDCILSHDVAVDAALMAKQKYGVNCMVMPPIGMGSQN 77

Query: 79  MYVDGTKTLTYA-----EAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
               G + L +      E  +  L  I+ ++   G RK++I+N HGGN+   S++   + 
Sbjct: 78  ---PGQRELPFCIHTRYETQKAILTDIVSSLYVQGFRKLIIINGHGGNT-FKSMIRDLSV 133

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
                L+ S+ W      +     P    G H  E+ETS+M+   P LV ++ A N    
Sbjct: 134 DYPDFLIASSEWYTVLKVKDYFENP----GDHADEVETSVMMHYHPELVNLEEAGN-GEY 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG----EGLLSYFANCFIQ 248
           ++  +++     A    ++G   KD      VG+   A+V+KG    E +   +A  F +
Sbjct: 189 KTFAIQSLNEKVAWIPRNWGKVSKDTG----VGDPRGASVEKGKKFAEAVAEKYAKLFDE 244

Query: 249 LLN 251
           L+N
Sbjct: 245 LVN 247


>gi|258514718|ref|YP_003190940.1| Creatininase [Desulfotomaculum acetoxidans DSM 771]
 gi|257778423|gb|ACV62317.1| Creatininase [Desulfotomaculum acetoxidans DSM 771]
          Length = 234

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 113/248 (45%), Gaps = 28/248 (11%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI-----KSILP 59
           ++ T++  P   D       +LP+G+ EQHG HLP++TD++IA GLA ++     KS L 
Sbjct: 1   MLTTNSKWPELTDVE---FAILPVGSIEQHGWHLPLSTDSLIANGLATKLAGKFNKSYLL 57

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNA 116
           P  P T         S EH    G+ +L   T A  IE    I+D++    I+K VI+N 
Sbjct: 58  PLFPFTS--------SFEHSGFPGSVSLKVSTIAAVIED---ILDSLEFSNIKKCVIVNG 106

Query: 117 HGGNSPLVSIVSTEARM--RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMML 174
           H GN  L ++V    R   R  +    ++W       GI +    +  +H GE ETS+++
Sbjct: 107 HQGNHFLRNVVQELNRFGPRVLLTPSKSAWDIAYQEAGISTTISKD--MHAGEGETSLIM 164

Query: 175 ALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKK 234
            L P  +     ++  S            R   + + G+  +    KGV    ++  VK+
Sbjct: 165 HLNPETINPSGVKDVDSPSRPLFEVLGMKRYTDTGAIGFPSRATEEKGVA--LLNILVKE 222

Query: 235 GEGLLSYF 242
            E ++  F
Sbjct: 223 CEKVIMEF 230


>gi|53713101|ref|YP_099093.1| putative amidase [Bacteroides fragilis YCH46]
 gi|60681368|ref|YP_211512.1| hypothetical protein BF1877 [Bacteroides fragilis NCTC 9343]
 gi|52215966|dbj|BAD48559.1| putative amidase [Bacteroides fragilis YCH46]
 gi|60492802|emb|CAH07576.1| conserved hypothetical protein [Bacteroides fragilis NCTC 9343]
          Length = 253

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 104/245 (42%), Gaps = 24/245 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI------ 76
           +++LP GA E H  HLP  TD I+   +A     +   R  V CM + P+ +        
Sbjct: 22  VIILPWGATEPHNLHLPYLTDCILPHDIAVEAAELALSRSGVRCMVMPPVPFGAHNPGQR 81

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           E  +   T+  T    +E    I+ ++   G RK++IL+ HGGN+    ++   A     
Sbjct: 82  ELPFCIHTRYATQQAILED---IVSSLHVQGFRKLLILSGHGGNN-FKGMIRDLAFEYPD 137

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
            L+ + +W     P+G     E EI  H GE ETS+M+   P LV +  A +  S+    
Sbjct: 138 FLIAAANWFEVVSPKGYF---EAEIDDHAGESETSVMMHYHPELVNLAEAGDGESK---- 190

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGV---VGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                +  A  +    W  +  +   V   VGN   AT +KGE  +         L  ++
Sbjct: 191 ----PFAIASLNEKVAWVPRHWDKATVDSGVGNPKKATAEKGERYVKPIVEKLAGLFEEM 246

Query: 254 NSFDV 258
              D+
Sbjct: 247 AQHDL 251


>gi|295840516|ref|ZP_06827449.1| creatininase [Streptomyces sp. SPB74]
 gi|197696597|gb|EDY43530.1| creatininase [Streptomyces sp. SPB74]
          Length = 266

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 90/188 (47%), Gaps = 19/188 (10%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI------KSILPP 60
            T+ +     +A  D + +LP+G+ EQH  HLP+ TDT++A  + ER       ++    
Sbjct: 6   LTETTWRETREAAPDAVALLPIGSQEQHAAHLPLGTDTLLAEAVTERALAHLAGRAAEGE 65

Query: 61  RLP-VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLA-----IIDAIRKMGIRKIVIL 114
           R+P V  +P  P G+S  H++      LT +    H L      I+D++   G R+++++
Sbjct: 66  RVPHVVRLPTLPYGHSPHHLFA---AALTLS---AHTLGLVLDEILDSLAATGHRRVLVV 119

Query: 115 NAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMML 174
           N HGGN  ++ +      +R  +   + S+     P           G H G  ETS+ML
Sbjct: 120 NGHGGNDEIMRLAVKRFALRAEVTAAACSYWSLGEPAADAEHAALVPG-HAGWFETSLML 178

Query: 175 ALAPHLVK 182
           A  P LV+
Sbjct: 179 AAHPALVR 186


>gi|329954552|ref|ZP_08295643.1| creatininase [Bacteroides clarus YIT 12056]
 gi|328527520|gb|EGF54517.1| creatininase [Bacteroides clarus YIT 12056]
          Length = 256

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 104/228 (45%), Gaps = 25/228 (10%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D + D +V+LP GA E H  HLP  TD I+   +A    ++   R  V CM + P+ +  
Sbjct: 21  DVKYD-VVILPWGATEPHNLHLPYLTDCILPHDIAVDAAALALERSGVRCMVMPPVPFGA 79

Query: 77  ------EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
                 E  +   T+  T    +E    I+ ++   GIRK++I++ HGGN+    ++   
Sbjct: 80  HNPGQRELPFCIHTRYATQQAILED---IVASLHAQGIRKLIIISGHGGNN-FKGMIRDL 135

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
           A +    L+++T W      +G   + E  I  H GE ETS M+   P LV +D A N  
Sbjct: 136 AFVYPDFLILATDWFGIVPTKG---YFEAAIDDHAGESETSAMMYYHPELVNLDEAGNGD 192

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGV---VGNAMDATVKKG 235
           SR         +  A  +    W+ +  +   V   VGN   A+ +KG
Sbjct: 193 SR--------PFAIASLNEKVAWAPRHWDKATVDSGVGNPGKASAEKG 232


>gi|134098955|ref|YP_001104616.1| creatininase [Saccharopolyspora erythraea NRRL 2338]
 gi|291006806|ref|ZP_06564779.1| creatininase [Saccharopolyspora erythraea NRRL 2338]
 gi|133911578|emb|CAM01691.1| creatininase [Saccharopolyspora erythraea NRRL 2338]
          Length = 242

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 111/243 (45%), Gaps = 40/243 (16%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +V++P G+ EQHGPHLP++TD+ IA  +A +    L     V   P +    S EH    
Sbjct: 19  LVIVPFGSCEQHGPHLPLDTDSSIATAVAWKGVRELADGTDVLLAPTQHYTASGEHEGFP 78

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMG--IRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           GT ++   +A+   L +++  R +     +++I+N HGGN+ +++    + R        
Sbjct: 79  GTVSIG-CDALH--LLVVELGRSLSGWCGRVLIVNGHGGNNAVLAKAVAQLRDERR---- 131

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA-----ENFSSRQSE 195
             +W    +  G           H G  ETSMM+AL P  V+ D A     E       E
Sbjct: 132 EVAWWPCAVQGG---------DAHAGRTETSMMMALRPLSVREDRARAGRTEPVRKLMGE 182

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
             RN              S++ ++P GV+G+   A+   GE LL+  A    +L   ++S
Sbjct: 183 LERN--------------SVRAVSPNGVLGDPGGASAAAGERLLNRMA---AELCTAVHS 225

Query: 256 FDV 258
           ++V
Sbjct: 226 WNV 228


>gi|298481306|ref|ZP_06999499.1| amidase [Bacteroides sp. D22]
 gi|298272510|gb|EFI14078.1| amidase [Bacteroides sp. D22]
          Length = 251

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 113/243 (46%), Gaps = 23/243 (9%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           RK  IV+LP GA E H  HLP  TD I++  +A     +   +  V CM + PIG   ++
Sbjct: 18  RKYDIVILPWGATEPHNLHLPYMTDCILSHDVAVDAALMAKQKYGVNCMVMPPIGMGSQN 77

Query: 79  MYVDGTKTLTYA-----EAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
               G + L +      E  +  L  I+ ++   G RK++I+N HGGN+   S++   + 
Sbjct: 78  ---PGQRELPFCIHTRYETQKAILTDIVSSLYVQGFRKLIIINGHGGNT-FKSMIRDLSV 133

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
                L+ S+ W      +     P    G H  E+ETS+M+   P LV ++ A N    
Sbjct: 134 DYPDFLIASSEWYTVLKVKDYFENP----GDHADEVETSVMMHYHPELVNLEEAGN-GEY 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG----EGLLSYFANCFIQ 248
           ++  +++     A    ++G   KD      VG+   A+V+KG    E +   +A  F +
Sbjct: 189 KTFAVQSLNEKVAWIPRNWGKVSKDTG----VGDPRGASVEKGKKFAEAVAEKYAKLFDE 244

Query: 249 LLN 251
           L+N
Sbjct: 245 LVN 247


>gi|284049333|ref|YP_003399672.1| Creatininase [Acidaminococcus fermentans DSM 20731]
 gi|283953554|gb|ADB48357.1| Creatininase [Acidaminococcus fermentans DSM 20731]
          Length = 243

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 105/244 (43%), Gaps = 26/244 (10%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
            KD +V++P GA E +GPHLPM TD ++    A+RI  ++         P    G S   
Sbjct: 18  EKDPLVIIPTGACEVYGPHLPMGTDLLV----AKRIAELVAEETDALIAPTIEAGESSAL 73

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
                T  +      ++   I+  + K G +KI+ +  H GN   V+ +S +   ++   
Sbjct: 74  ASFPCTFAMPRKILEDYLDYILGKVLKDGAKKILFITGHAGNVDTVNYLSKKYMEQYDFK 133

Query: 139 VVSTSWSRFTI--PQGIISFPETEIGIHGGEIETSMMLALAPHLV----KMDLAENFSSR 192
           +    W RF     +GI  +       H  E  TS+ML L P LV    +  +  + SS 
Sbjct: 134 MAQVDWWRFATVHNKGICQYEGYMCNGHASECGTSVMLYLFPELVDEAGETCVDPHTSSE 193

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
            S+F+   K+              D    G VG+A  AT +KGE ++     C  ++L  
Sbjct: 194 FSDFITLGKF-------------TDKTYNGTVGDATVATREKGEKIVE---ACLARILKF 237

Query: 253 INSF 256
           I ++
Sbjct: 238 IKAY 241


>gi|226365544|ref|YP_002783327.1| creatininase family protein [Rhodococcus opacus B4]
 gi|226244034|dbj|BAH54382.1| creatininase family protein [Rhodococcus opacus B4]
          Length = 240

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 101/227 (44%), Gaps = 30/227 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV+P+G+ EQHGPHLP++TDT IA  ++  +  +L         P    G S EH    G
Sbjct: 22  VVVPVGSLEQHGPHLPLDTDTTIADAVSRALPHVL-------VAPPIAYGASGEHEGFPG 74

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L  AEA+E  L            +++ +N HGGN P  ++V   A +R+    V  +
Sbjct: 75  TVSLG-AEALETVLVEYGRSACRWADRVLFVNGHGGNGP--ALVKAVALLRYEARDV--A 129

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
           W    +P             H G  ETS++L L+P  V++  AE  ++      R    L
Sbjct: 130 WVPCAVPGA---------DAHAGRTETSLLLHLSPGRVRLSRAEPGNTEP--VARLMPRL 178

Query: 204 RAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           R  G       M  ++  GV+G+   AT  +G  +     +     L
Sbjct: 179 REGG-------MVAVSANGVLGDPTVATAAEGAQIFGVLVHTVTNAL 218


>gi|47096612|ref|ZP_00234200.1| creatinine amidohydrolase, putative [Listeria monocytogenes str.
           1/2a F6854]
 gi|254899334|ref|ZP_05259258.1| hypothetical protein LmonJ_05959 [Listeria monocytogenes J0161]
 gi|254912527|ref|ZP_05262539.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254936854|ref|ZP_05268551.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|47014997|gb|EAL05942.1| creatinine amidohydrolase, putative [Listeria monocytogenes str.
           1/2a F6854]
 gi|258609449|gb|EEW22057.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|293590512|gb|EFF98846.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 247

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 109/232 (46%), Gaps = 22/232 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA EQHG HLP+  D  +A  LAE    ++  +     +P  P GYS     + 
Sbjct: 25  VAILPLGATEQHGHHLPLGVDIFLADHLAE----LVSEKTGAVVIPPMPFGYSWVWRDIP 80

Query: 83  GTKTLT--YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           GT ++   + EAI   +A   ++ + G++ +V++N H  N+  +     E      M V+
Sbjct: 81  GTISIQQHHVEAIIKDVA--HSVSRYGVKMLVLINGHDSNNNSMKYAVRELADELEMPVM 138

Query: 141 STSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
              +   +         +T  G IH  E ETS+MLA    LV+M  A          +R 
Sbjct: 139 YLFYPSLSEVMEKNCESDTWHGMIHACEFETSLMLATKKELVQMKKA----------VRE 188

Query: 200 F-KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           + +    +G  +   S+ DL+  GV G+A  AT +KGE ++  FA     LL
Sbjct: 189 YPEKPTLYGKTTI--SLGDLSKSGVYGDASLATEEKGEQMIELFAEKMTALL 238


>gi|153806238|ref|ZP_01958906.1| hypothetical protein BACCAC_00493 [Bacteroides caccae ATCC 43185]
 gi|149130915|gb|EDM22121.1| hypothetical protein BACCAC_00493 [Bacteroides caccae ATCC 43185]
          Length = 251

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 112/246 (45%), Gaps = 26/246 (10%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D R D IV LP GA E H  HLP  TD I++  +A     I   +  V CM + PIG   
Sbjct: 17  DGRYD-IVALPWGATEPHNLHLPYMTDCILSHDVAVSAALIAKQKYGVNCMVMPPIGMGS 75

Query: 77  EHMYVDGTKTL-----TYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
           ++    G + L     T  E  +  L  I+ ++   GIRK+VI+N HGGN+   S++   
Sbjct: 76  QN---PGQRELPFCIHTRYETQKAILTDIVSSLYVQGIRKLVIINGHGGNT-FKSMIRDL 131

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
           +      L+ S+ W      +     P    G H  E+ETS+M+   P LV  +L E  S
Sbjct: 132 SVDYPDFLIASSEWYTVLKVKDYFENP----GDHADEVETSVMMHYHPELV--NLEEAGS 185

Query: 191 SRQSEF-LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG----EGLLSYFANC 245
                F +++     A    ++G   KD      VG+   A+ +KG    E +   +A  
Sbjct: 186 GEYKTFAVQSLNEKVAWIPRNWGKVSKDTG----VGDPRGASAEKGKKFAEAVAEKYARL 241

Query: 246 FIQLLN 251
           F +L+N
Sbjct: 242 FDELVN 247


>gi|284163731|ref|YP_003402010.1| creatininase [Haloterrigena turkmenica DSM 5511]
 gi|284013386|gb|ADB59337.1| Creatininase [Haloterrigena turkmenica DSM 5511]
          Length = 246

 Score = 76.3 bits (186), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 105/238 (44%), Gaps = 16/238 (6%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + V+P+G+ EQHGPH P+ TD + A  +A+     +     V   P  P+G + EH    
Sbjct: 18  LAVVPVGSTEQHGPHAPLGTDVVAAEAVADAGVEHVD--REVVRAPAIPVGIAEEHRQFP 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  ++     ++    ++++   G  ++VI+N HGGN   +  V            V  
Sbjct: 76  GTMWVSEDTFRDYVREAVESLAHHGFDRVVIVNGHGGNVDALREVGGRITRGGDAYAVPF 135

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF-K 201
           +W         +     E+G HGG +ET+++   AP LV+ +  E+     +E   ++  
Sbjct: 136 TWFE------AVGEHSAEMG-HGGPLETALLRHCAPDLVREERIEDARDGHAEGWGDWLS 188

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           Y       +  +   +    GVVG+  D   + GE LL    +   +LL  +   DVS
Sbjct: 189 YT------NLAYDSAEFTENGVVGDPEDGDRQCGEELLELAGDALARLLEAVAERDVS 240


>gi|226305295|ref|YP_002765253.1| hypothetical protein RER_18060 [Rhodococcus erythropolis PR4]
 gi|226184410|dbj|BAH32514.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
          Length = 208

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 101/211 (47%), Gaps = 30/211 (14%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           ++P+G++EQHGPHLP++TDT IA  +A+ +  ++         P    G S EH    GT
Sbjct: 1   MVPVGSFEQHGPHLPLDTDTRIARAVAQALPDVV-------VAPAIEYGASGEHEGFAGT 53

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSW 144
            ++  AEA+E  +           ++++ +N HGGN P  ++    A +R+       +W
Sbjct: 54  ISIG-AEAMETLVVEYGRSAFRWTKRVLFVNGHGGNGP--ALAKAVALLRYEGR--DAAW 108

Query: 145 SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLR 204
               +P  +          H G  ETS++L L+P LV M LAE  +   S        +R
Sbjct: 109 ----VPCAVAG-----ADAHAGHTETSLLLHLSPDLVHMSLAE--TGNLSPIADLMPGMR 157

Query: 205 AHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           + G       M  ++  GV+GN + AT + G
Sbjct: 158 SGG-------MVAVSQNGVLGNPVGATAEDG 181


>gi|83595058|ref|YP_428810.1| creatininase [Rhodospirillum rubrum ATCC 11170]
 gi|83577972|gb|ABC24523.1| Creatininase [Rhodospirillum rubrum ATCC 11170]
          Length = 250

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 104/236 (44%), Gaps = 30/236 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSI--LPPRLPVTCMPVEPIGYSIE 77
            ++PLG+ E HG HLP   D +    +A G+AER++ +  LPP            G+S  
Sbjct: 23  ALIPLGSCESHGDHLPFAMDALTAHKLALGVAERMEKVFVLPPTF---------FGFSQH 73

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           + +   + +L+    I     I+D++    IR ++I+N H GN   + + +  AR+R   
Sbjct: 74  YWHKPMSISLSQDTNIRVIADILDSLAHWKIRNVLIINGHDGNISAIDVAARAARLRHPD 133

Query: 138 LVVSTSWSRFTIPQGIISFPETEI--GI-HGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
           + + +  + +     ++     E+  G+ HGGE ETS+ LA  P LV M  A        
Sbjct: 134 MKIGSLDAWWVTAGNLLPKDTFEVWNGLGHGGEGETSIGLACFPELVDMAHARGMIPEVD 193

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           E   N K L         W   +L   G  G    AT +KG+ +     +  +  L
Sbjct: 194 E---NVKEL---------WDFSELTDYGATGAPEKATREKGQAMYDVLVDYLVAYL 237


>gi|295136135|ref|YP_003586811.1| creatinine amidohydrolase [Zunongwangia profunda SM-A87]
 gi|294984150|gb|ADF54615.1| creatinine amidohydrolase [Zunongwangia profunda SM-A87]
          Length = 253

 Score = 75.9 bits (185), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 105/245 (42%), Gaps = 24/245 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLA-ERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           I +LP GA E H  HLP  TD I A G+A E  +        V  +P  P G +   M +
Sbjct: 21  IAILPWGATEAHNYHLPYATDNIEAHGVAKETCRKAWEQGAKVLLLPTIPFGVNTGQMDI 80

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
                L  +        +   + + GI K+VI N+HGGN      +  E  + F  +   
Sbjct: 81  PFCMNLNPSTQYAILKDVAQVLHRSGINKLVIFNSHGGNH--FKQMIRELSIEFPTIFTC 138

Query: 142 T-SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV-KMDLAENFSSRQSEFLRN 199
           T +W +    +     P    G H GE+ETS+++ LAP LV  ++ A + S++  +    
Sbjct: 139 TLNWFQALDAKAYFDDP----GDHAGELETSVVMHLAPDLVLPLEEAGDGSAKNYK---- 190

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGV-----VGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
            K LR       GW       + V     VGN  +AT KKG+  +          L +++
Sbjct: 191 IKGLRE------GWVSSQRQWRAVTKDTGVGNPKNATAKKGQKFIEAVTKKIADFLVELH 244

Query: 255 SFDVS 259
             DV+
Sbjct: 245 HADVN 249


>gi|254172231|ref|ZP_04878907.1| creatininase [Thermococcus sp. AM4]
 gi|214034127|gb|EEB74953.1| creatininase [Thermococcus sp. AM4]
          Length = 239

 Score = 75.9 bits (185), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 109/230 (47%), Gaps = 19/230 (8%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVTCMPVEPIGYSIEHMYVD 82
           V+LP+G+ E HG HLP+ TD      +AE ++  +  R   V  MP    G+S       
Sbjct: 21  VILPVGSVEAHGRHLPLGTDVFAPVRIAELVEQKIRERGKEVLLMPPIWYGHSFALNVYP 80

Query: 83  GTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSMLVV 140
           GT  +   E++  ++  ++  +   G R+IV+LN HGGN  PL       A +   + V 
Sbjct: 81  GTINVR-PESLRMYVGDVLAELAAEGFRRIVLLNGHGGNVYPLTEAAEDVAELYPDVEVY 139

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
             +W      + I+S   ++   H GE ETS+MLA+ P LV M       +R  +  RN 
Sbjct: 140 LINWW-LDFREEILSVCSSQ--GHAGEDETSVMLAVRPELVNMR-----EARGRKVKRNV 191

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           + +R       G   K++ P G+  +   AT +KGE +L   +    +++
Sbjct: 192 RVIR----KDIG---KEVFPDGLNDDPSPATAEKGERILQLVSERIARVI 234


>gi|70605987|ref|YP_254857.1| hypothetical protein Saci_0141 [Sulfolobus acidocaldarius DSM 639]
 gi|68566635|gb|AAY79564.1| conserved Archaeal protein [Sulfolobus acidocaldarius DSM 639]
          Length = 222

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 100/218 (45%), Gaps = 40/218 (18%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS------ILPPRLPVTC-MPV 69
           D  ++ I ++P+G+ EQHGPHLPM TD+IIA  +A+R++       +L P +  TC M  
Sbjct: 9   DDIQNKIALIPVGSLEQHGPHLPMGTDSIIAEEIAKRVEEELNNVVLLFPTVYYTCSMEH 68

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
           E   Y+       G   +T+A    + L I+++I K   +K V++  HGG   ++ +V  
Sbjct: 69  EGFPYA-------GVSYITFA---SYMLEILNSISKFS-KKAVLVIGHGGVVSVIDVVKR 117

Query: 130 EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENF 189
           +         V T    FT+ +      E    +H G IETS +  + P LV  D     
Sbjct: 118 QLNFTNKTFKVYT----FTVQE------ENSEDLHAGTIETSAIKVINPKLVNEDK---- 163

Query: 190 SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNA 227
                  L++  Y    G      + K+ NP G++   
Sbjct: 164 -------LKDVDYSFQEGVFDI-ITTKESNPYGIINKG 193


>gi|313623077|gb|EFR93357.1| creatininase subfamily [Listeria innocua FSL J1-023]
          Length = 247

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 111/238 (46%), Gaps = 22/238 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA EQHG HLP+  D  +A  LAE    ++  +     +P  P GYS     + 
Sbjct: 25  VAILPLGATEQHGHHLPLGVDIFLAEHLAE----LVSEKTGAIVIPPMPFGYSWVWRDIP 80

Query: 83  GTKTLT--YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           GT ++   + EAI   +A   ++ + G++ +V++N H  N+  +     E      M V+
Sbjct: 81  GTISIQQHHVEAIIKDVA--HSVSRYGVKMLVLINGHDSNNNSMKYAVRELADELEMPVM 138

Query: 141 STSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
              +   +          T  G IH  E ETS+MLA    LV+M  A          +R 
Sbjct: 139 YLFYPSLSEVMEKNCESGTWHGMIHACEFETSLMLATKKELVQMKKA----------VRE 188

Query: 200 F-KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           + +    +G  +   S+ DL+  GV G+A  AT +KGE ++  FA     LL +  S+
Sbjct: 189 YPEKPTLYGKSTI--SLGDLSKSGVYGDASLATEEKGEQMIQLFAEKMAALLLEGYSY 244


>gi|289643567|ref|ZP_06475683.1| Creatininase [Frankia symbiont of Datisca glomerata]
 gi|289506633|gb|EFD27616.1| Creatininase [Frankia symbiont of Datisca glomerata]
          Length = 240

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 106/219 (48%), Gaps = 31/219 (14%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           ++ +PLGA EQHGPHLP+  DT +A  L ER+      R  V   P  P G S EH    
Sbjct: 25  VLAVPLGATEQHGPHLPLTVDTELATALCERLARA---RSWVLVAPALPYGASGEHAGFP 81

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKM-GIRKIVILNAHGGN-SPLVSIVSTEARMRFSMLVV 140
           GT ++   + +E  L +++ +R       ++++  HGGN +PL   V   AR+R     V
Sbjct: 82  GTLSIGQ-DGVE--LLLVELVRSADAFAGVLLVCGHGGNAAPLRRAV---ARLRGEGRRV 135

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
             +W    +P G    P  +   H G  ETS+MLAL    V++D  E   +R    L   
Sbjct: 136 -LAW----LPGG----PADD--AHAGRTETSVMLALRGQAVRLDHVEPGVTRPIGEL--L 182

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
             LR  G       ++ ++P GV+G+   ++ + G  +L
Sbjct: 183 PALRESG-------VRAVSPNGVLGDPTGSSARAGTRIL 214


>gi|288927373|ref|ZP_06421220.1| putative amidase [Prevotella sp. oral taxon 317 str. F0108]
 gi|288330207|gb|EFC68791.1| putative amidase [Prevotella sp. oral taxon 317 str. F0108]
          Length = 260

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 110/249 (44%), Gaps = 25/249 (10%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +VVLP GA E H  HLP  TD I++  +A      L  +  +  M + P+G   ++    
Sbjct: 22  LVVLPWGATEPHNYHLPYLTDCILSHDIAVDAAQRLLTKHGLHAMVMPPVGMGSQN---P 78

Query: 83  GTKTLTYAEAIEHWLA------IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           G + L +     +         I+D++   G RK+VI+N HGGN    S++         
Sbjct: 79  GQRELPFCVHTRYETQKAILTDIVDSLYHQGFRKLVIVNGHGGNG-FKSMIRDLLTCYPD 137

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
            L+ ++ W +    +     P    G H  EIETS+M+   P LV  +LA+    + + F
Sbjct: 138 FLIAASDWFKMRNAKDFFDNP----GDHADEIETSVMMYYHPELV--NLADAGEGKSNAF 191

Query: 197 -LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
            +   +  R     ++G   KD      +G+   +T +KG+G      + ++    D   
Sbjct: 192 AIDALQEGRVWMPRNWGKVSKDTG----IGSPKQSTAEKGKGFADAVCDAYVDFFADF-- 245

Query: 256 FDVSIFDKD 264
             +++ D+D
Sbjct: 246 --IAVKDED 252


>gi|16804007|ref|NP_465492.1| hypothetical protein lmo1968 [Listeria monocytogenes EGD-e]
 gi|224498581|ref|ZP_03666930.1| hypothetical protein LmonF1_02344 [Listeria monocytogenes Finland
           1988]
 gi|224501231|ref|ZP_03669538.1| hypothetical protein LmonFR_01700 [Listeria monocytogenes FSL
           R2-561]
 gi|254827146|ref|ZP_05231833.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|254831430|ref|ZP_05236085.1| hypothetical protein Lmon1_08753 [Listeria monocytogenes 10403S]
 gi|255029979|ref|ZP_05301930.1| hypothetical protein LmonL_14524 [Listeria monocytogenes LO28]
 gi|284802413|ref|YP_003414278.1| hypothetical protein LM5578_2169 [Listeria monocytogenes 08-5578]
 gi|284995555|ref|YP_003417323.1| hypothetical protein LM5923_2120 [Listeria monocytogenes 08-5923]
 gi|16411421|emb|CAD00046.1| lmo1968 [Listeria monocytogenes EGD-e]
 gi|258599529|gb|EEW12854.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|284057975|gb|ADB68916.1| hypothetical protein LM5578_2169 [Listeria monocytogenes 08-5578]
 gi|284061022|gb|ADB71961.1| hypothetical protein LM5923_2120 [Listeria monocytogenes 08-5923]
          Length = 247

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 108/232 (46%), Gaps = 22/232 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA EQHG HLP+  D  +A  LAE    ++  +     +P  P GYS     + 
Sbjct: 25  VAILPLGATEQHGHHLPLGVDIFLADHLAE----LVSEKTGAVVIPPMPFGYSWVWRDIP 80

Query: 83  GTKTLT--YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           GT ++   + EAI   +A   ++ + G++ +V++N H  N+  +     E      M V+
Sbjct: 81  GTISIQQHHVEAIIKDVA--HSVSRYGVKMLVLINGHDSNNNSMKYAVRELADELEMPVM 138

Query: 141 STSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
              +   +          T  G IH  E ETS+MLA    LV+M  A          +R 
Sbjct: 139 YLFYPSLSEVMEKNCESGTWHGMIHACEFETSLMLATKKELVQMKKA----------VRE 188

Query: 200 F-KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           + +    +G  +   S+ DL+  GV G+A  AT +KGE ++  FA     LL
Sbjct: 189 YPEKPTLYGKTTI--SLGDLSKSGVYGDASLATEEKGEQMIELFAEKMTALL 238


>gi|322368429|ref|ZP_08042998.1| Creatininase [Haladaptatus paucihalophilus DX253]
 gi|320552445|gb|EFW94090.1| Creatininase [Haladaptatus paucihalophilus DX253]
          Length = 252

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 108/242 (44%), Gaps = 25/242 (10%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D R+   V++ +G+ EQHGPHLP+  DT+    LA+RI   L   L     P    G S 
Sbjct: 23  DGRR--TVIVAVGSVEQHGPHLPLIMDTLAGDELAKRIAEKLGDAL---AAPTVRPGCSG 77

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
            HM   GT T+  A  ++   A   ++ + G   IV++  HGGN   V+ V+ E      
Sbjct: 78  HHMEFPGTITIPAAVLMDLIRAYCKSLDEHGFEHIVLVPTHGGNFAPVNTVAPEVARDID 137

Query: 137 MLVVSTS-------WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENF 189
             V++ +            + +G + + E    IH G  ET+M+LA+   LV+ D  E  
Sbjct: 138 ANVIALADLADLMELQNEGLRKGGVEYQEDV--IHAGAAETAMVLAIDEGLVRTDELEVG 195

Query: 190 SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
              +    R         S  F    + +   GV+G+  + T + GE +L   A+ + + 
Sbjct: 196 HEEEISVSRLL-------SEGF----QSITENGVLGDPREGTTEAGEEILDTVASAYAER 244

Query: 250 LN 251
           ++
Sbjct: 245 ID 246


>gi|310828515|ref|YP_003960872.1| hypothetical protein ELI_2940 [Eubacterium limosum KIST612]
 gi|308740249|gb|ADO37909.1| hypothetical protein ELI_2940 [Eubacterium limosum KIST612]
          Length = 269

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 104/250 (41%), Gaps = 26/250 (10%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG-YS 75
           D +   + +LP+GA EQHGPH P   D   A GLAE++      +     +P+ P G + 
Sbjct: 20  DVKNCDMAILPIGATEQHGPHCPCGCDAYNAKGLAEKVAE----KTGAMLLPLLPYGSHP 75

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
             H Y+ GT  L Y         II      G +K  IL+AHG  S   ++V+       
Sbjct: 76  YHHWYMPGTIPLGYETHTNVLCDIIRGAANAGYKKFFILSAHGQVS--TTLVAVHKLGLE 133

Query: 136 SMLVVSTSWSRFTIP-QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
               +S  W       Q  +  P T    H  E ETSM L L P  + M  A +      
Sbjct: 134 GYFTLSAHWYDLLRDNQTALETPMT----HADEAETSMALYLYPQYIDMSKAVD---DGG 186

Query: 195 EFLRNFKYLRAHG-----SHSFGWSMKDLNPK------GVVGNAMDATVKKGEGLLSYFA 243
           E L N +++   G        + +      P+      GV+G+   ATV+KGE ++    
Sbjct: 187 ECLINDEFMIKPGMTPKPGQMYHFEGTFARPEYIELKSGVIGHPTLATVEKGEAIVEKAV 246

Query: 244 NCFIQLLNDI 253
           +    ++ D+
Sbjct: 247 SLISDIVEDV 256


>gi|108797841|ref|YP_638038.1| creatininase [Mycobacterium sp. MCS]
 gi|119866935|ref|YP_936887.1| creatininase [Mycobacterium sp. KMS]
 gi|108768260|gb|ABG06982.1| Creatininase [Mycobacterium sp. MCS]
 gi|119693024|gb|ABL90097.1| Creatininase [Mycobacterium sp. KMS]
          Length = 249

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 113/252 (44%), Gaps = 39/252 (15%)

Query: 2   NPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL-PP 60
           +P + FTD S     D R+  + ++P+GA EQHGP LP+  DTIIA  + ER   +   P
Sbjct: 11  SPDLSFTDVS-----DGRE--VGLVPVGAVEQHGPQLPVGADTIIATAMCERASELTGAP 63

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYA------EAIEHWLAIIDAIRKMGIRKIVIL 114
            LP   + V   G+  E   + GT +LT A      E   HW A+       G+R+++ +
Sbjct: 64  VLPAITLGVS-FGHGTE---LPGTLSLTPALLAGIVEQYVHWAAL------SGLRRLLFV 113

Query: 115 NAHGGNSPLVSIVSTEARM-RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEI-ETSM 172
           N H GN+  ++  +   R+ R  + V +  W  +T    +++    +         ETS+
Sbjct: 114 NGHMGNTAALNTATDHIRLERRDVRVGAVDW--WTCDDQVLTAMMADAADAHANCAETSV 171

Query: 173 MLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATV 232
           +LA+ P LV +D   +           F+Y           +  +L+  GV G    AT 
Sbjct: 172 LLAMRPDLVHLDRMRDADDEDRTAGLVFRY-----------TATELSRNGVTGKPSLATA 220

Query: 233 KKGEGLLSYFAN 244
           + GE L    A 
Sbjct: 221 ELGEQLWKLAAE 232


>gi|288562904|pdb|3A6H|A Chain A, W154a Mutant Creatininase
 gi|288562905|pdb|3A6H|B Chain B, W154a Mutant Creatininase
 gi|288562906|pdb|3A6H|C Chain C, W154a Mutant Creatininase
 gi|288562907|pdb|3A6H|D Chain D, W154a Mutant Creatininase
 gi|288562908|pdb|3A6H|E Chain E, W154a Mutant Creatininase
 gi|288562909|pdb|3A6H|F Chain F, W154a Mutant Creatininase
          Length = 260

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 89/183 (48%), Gaps = 20/183 (10%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A  D +++LP+GA EQHG H+ MN D ++   + +R+      R+    MP    GY  +
Sbjct: 20  AAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAE----RIGALVMPGLQYGYKSQ 75

Query: 78  HM-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTE 130
                  +  GT +L  A        II  + + G R++V++N H  NS  +   I    
Sbjct: 76  QKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYENSMFIVEGIDLAL 135

Query: 131 ARMRFSML----VVSTSWSRFTIPQGIIS--FPETEIG---IHGGEIETSMMLALAPHLV 181
             +R++ +    VV  S++ F     +I   +PE  +G    HGG  ETS+MLAL P LV
Sbjct: 136 RELRYAGIQDFKVVVLSYADFVKDPAVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLV 195

Query: 182 KMD 184
            +D
Sbjct: 196 DLD 198


>gi|256783129|ref|ZP_05521560.1| hypothetical protein SlivT_01420 [Streptomyces lividans TK24]
          Length = 263

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 82/172 (47%), Gaps = 14/172 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP------------VTCMPVE 70
           I +LP+G+ EQH  HLPM TDT++   + +R   +L    P            +  +P  
Sbjct: 22  IALLPIGSQEQHAGHLPMGTDTLLVEEVVDRALDLLDREAPEASEGSGAPVPEIVRLPAL 81

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
           P G+S  H++     +L+ A        ++D++   G  +I+++N HGGN  ++ +    
Sbjct: 82  PFGHSPHHLFA-AAVSLSAATLGAVLDDVLDSLVTSGYHRIMVVNGHGGNDEIMRLAVKR 140

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
             +R  + V + S+   T        P+   G H G  ETS+MLA  P LV+
Sbjct: 141 FALRARVTVAACSYWTLTAGGDDAGRPDVTPG-HAGWFETSLMLAAHPGLVR 191


>gi|288562886|pdb|3A6E|A Chain A, W174f Mutant Creatininase, Type I
 gi|288562887|pdb|3A6E|B Chain B, W174f Mutant Creatininase, Type I
 gi|288562888|pdb|3A6E|C Chain C, W174f Mutant Creatininase, Type I
 gi|288562889|pdb|3A6E|D Chain D, W174f Mutant Creatininase, Type I
 gi|288562890|pdb|3A6E|E Chain E, W174f Mutant Creatininase, Type I
 gi|288562891|pdb|3A6E|F Chain F, W174f Mutant Creatininase, Type I
 gi|288562892|pdb|3A6F|A Chain A, W174f Mutant Creatininase, Type Ii
 gi|288562893|pdb|3A6F|B Chain B, W174f Mutant Creatininase, Type Ii
 gi|288562894|pdb|3A6F|C Chain C, W174f Mutant Creatininase, Type Ii
 gi|288562895|pdb|3A6F|D Chain D, W174f Mutant Creatininase, Type Ii
 gi|288562896|pdb|3A6F|E Chain E, W174f Mutant Creatininase, Type Ii
 gi|288562897|pdb|3A6F|F Chain F, W174f Mutant Creatininase, Type Ii
          Length = 260

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 88/183 (48%), Gaps = 20/183 (10%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A  D +++LP+GA EQHG H+ MN D ++   + +R+      R+    MP    GY  +
Sbjct: 20  AAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAE----RIGALVMPGLQYGYKSQ 75

Query: 78  HM-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTE 130
                  +  GT +L  A        II  + + G R++V++N H  NS  +   I    
Sbjct: 76  QKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYENSMFIVEGIDLAL 135

Query: 131 ARMRFSML----VVSTSWSRFTIPQGIIS--FPETEIGI---HGGEIETSMMLALAPHLV 181
             +R++ +    VV  S+  F     +I   +PE  +G    HGG  ETS+MLAL P LV
Sbjct: 136 RELRYAGIQDFKVVVLSYWDFVKDPAVIQQLYPEGFLGFDIEHGGVFETSLMLALYPDLV 195

Query: 182 KMD 184
            +D
Sbjct: 196 DLD 198


>gi|21225833|ref|NP_631612.1| hypothetical protein SCO7569 [Streptomyces coelicolor A3(2)]
 gi|11228466|emb|CAC16449.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)]
          Length = 263

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 82/172 (47%), Gaps = 14/172 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP------------VTCMPVE 70
           I +LP+G+ EQH  HLPM TDT++   + +R   +L    P            +  +P  
Sbjct: 22  IALLPIGSQEQHAGHLPMGTDTLLVEEVVDRALDLLDREAPGASEGTGAPVPEIVRLPAL 81

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
           P G+S  H++     +L+ A        ++D++   G  +I+++N HGGN  ++ +    
Sbjct: 82  PFGHSPHHLFA-AAVSLSAATLGAVLDDVLDSLVTSGYHRIMVVNGHGGNDEIMRLAVKR 140

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
             +R  + V + S+   T        P+   G H G  ETS+MLA  P LV+
Sbjct: 141 FALRARVTVAACSYWTLTAGGDDAGRPDVTPG-HAGWFETSLMLAAHPGLVR 191


>gi|332795902|ref|YP_004457402.1| creatininase [Acidianus hospitalis W1]
 gi|332693637|gb|AEE93104.1| creatininase [Acidianus hospitalis W1]
          Length = 234

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 97/192 (50%), Gaps = 35/192 (18%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS------ILPPRLPVTCMPVEPIGY 74
           + I +LP+G+ EQHGPHLPM TD IIA  +A+R++S      +L P +  +C        
Sbjct: 13  NEISLLPVGSIEQHGPHLPMGTDAIIAEEIAKRVESEFKDDVLLFPTIYYSC-------- 64

Query: 75  SIEHM---YVDGTKTLTYAEAIEHWLAIIDAIRK-MGIRK-IVILNAHGGNSPLVSIVST 129
           SIEH    YV G   +T+      +  +++ I+K + + K ++I+NAHGGN  ++ ++  
Sbjct: 65  SIEHSGLPYV-GVSYITF------YNYLVEVIKKALELSKAVIIVNAHGGNQAILEVIKR 117

Query: 130 EARMRFSMLVVSTSWSRFTIPQGIISFPETEI----GIHGGEIETSMMLALAPHLVK-MD 184
           E  +             +   +  + +P+        +H G +E+S +  L P  VK   
Sbjct: 118 EINLNRE----DDKKESYNNKKVYVFYPDYNFFQGEDLHAGTVESSAIKYLYPSFVKESK 173

Query: 185 LAENFSSRQSEF 196
           + ++FS ++  F
Sbjct: 174 VGKDFSVKEGVF 185


>gi|294101037|ref|YP_003552895.1| Creatininase [Aminobacterium colombiense DSM 12261]
 gi|293616017|gb|ADE56171.1| Creatininase [Aminobacterium colombiense DSM 12261]
          Length = 259

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 102/245 (41%), Gaps = 17/245 (6%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + ++PLG+ EQHGP  P+ TD  I    A+R+++  P ++ V  +P  P G    H    
Sbjct: 20  VALIPLGSVEQHGPLAPLGTDYFIPEEFAKRVEAAYPDKIMV--LPTMPYGVCPYHASFP 77

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  +      E    I  ++   GI+K++ LN HGGN P +   +     R  +  +  
Sbjct: 78  GTIDMGIEILSEVMTRIAMSLMDTGIKKMIFLNGHGGNGPSLDKAALAVYKRGGLAAIVD 137

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM-DLAENFSSRQSEFLRNFK 201
            W+                G HG   ETS+M+AL P  V M D         S+ L+N  
Sbjct: 138 WWTLAG------ELNAKWAGGHGAGQETSVMMALKPEWVNMKDFFPANIHHVSDSLQNTH 191

Query: 202 ---YLRAHGSHSFGWSMKDLNPKGVVGNA---MDATVKKGEGLLSYFANCFIQLLNDINS 255
                   GS      +KD+   G  G      DA  + GE +L       I+ + +   
Sbjct: 192 ISIVTFEKGSVRIIRDVKDVTSSGAYGGTDAPEDANREWGEEILKGVTEYLIRFIAEY-- 249

Query: 256 FDVSI 260
           F VS+
Sbjct: 250 FKVSL 254


>gi|289767011|ref|ZP_06526389.1| creatinine amidohydrolase [Streptomyces lividans TK24]
 gi|289697210|gb|EFD64639.1| creatinine amidohydrolase [Streptomyces lividans TK24]
          Length = 272

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 82/172 (47%), Gaps = 14/172 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP------------VTCMPVE 70
           I +LP+G+ EQH  HLPM TDT++   + +R   +L    P            +  +P  
Sbjct: 31  IALLPIGSQEQHAGHLPMGTDTLLVEEVVDRALDLLDREAPEASEGSGAPVPEIVRLPAL 90

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
           P G+S  H++     +L+ A        ++D++   G  +I+++N HGGN  ++ +    
Sbjct: 91  PFGHSPHHLFA-AAVSLSAATLGAVLDDVLDSLVTSGYHRIMVVNGHGGNDEIMRLAVKR 149

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
             +R  + V + S+   T        P+   G H G  ETS+MLA  P LV+
Sbjct: 150 FALRARVTVAACSYWTLTAGGDDAGRPDVTPG-HAGWFETSLMLAAHPGLVR 200


>gi|307594509|ref|YP_003900826.1| creatininase [Vulcanisaeta distributa DSM 14429]
 gi|307549710|gb|ADN49775.1| Creatininase [Vulcanisaeta distributa DSM 14429]
          Length = 242

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 89/173 (51%), Gaps = 19/173 (10%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           KD ++++P+G+ EQHGPHLP+ TD+IIA  +A  ++  +  +      P+  +G S+EH 
Sbjct: 13  KDPLIIVPVGSIEQHGPHLPLGTDSIIANYIAAEVERKMQNK--ALLYPLIAVGSSMEHA 70

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE---ARMRFS 136
              GT  + +   I + L  I+++       IV +N HGGN   ++IV  E   +R+R  
Sbjct: 71  GFVGTTWVRFESLIHYLLDFIESVSAWSPVGIVFVNGHGGNVDALTIVVKEWNYSRVR-- 128

Query: 137 MLVVSTSWSRFTIPQGIIS-----FPETEIGIHGGEIETSMMLALAPHLVKMD 184
                 ++  +   + ++      FP      H   +ETS++ A++  LV+ D
Sbjct: 129 ----PRAYHYYIYNKRVVDYITRYFPSFG---HADAVETSLIAAISKDLVRWD 174


>gi|326329217|ref|ZP_08195543.1| creatininase family protein [Nocardioidaceae bacterium Broad-1]
 gi|325952952|gb|EGD44966.1| creatininase family protein [Nocardioidaceae bacterium Broad-1]
          Length = 231

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 91/174 (52%), Gaps = 21/174 (12%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVTCMPVEPIGYSIEHMYV 81
           ++++P+G+ EQHGPHLP +TDT IA+ + + +   L  + +     P   IG S EH   
Sbjct: 17  VLLVPVGSLEQHGPHLPFDTDTAIASAVTQGVADRLAEQGVESWVAPPIAIGSSGEHQSF 76

Query: 82  DGTKTLTYAEAIEHWLAIIDAIR--KMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSML 138
            GT ++  ++A+   L +++ +R  +    ++V++N HGGN + L S V+  A  R    
Sbjct: 77  AGTVSIG-SDALH--LVVVELVRSARTWAERVVLVNGHGGNAAALTSAVNQLAYERQ--- 130

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
             S  W         +     +  +H G  ETS+ML L P  V++DLAE   +R
Sbjct: 131 --SACW---------LPCRTEDYDLHAGRTETSLMLHLRPESVRLDLAEPGDTR 173


>gi|119720708|ref|YP_921203.1| creatininase [Thermofilum pendens Hrk 5]
 gi|119525828|gb|ABL79200.1| Creatininase [Thermofilum pendens Hrk 5]
          Length = 249

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 87/177 (49%), Gaps = 20/177 (11%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGL----AERIKSILPPRLPVTCMPVEPI 72
           + RK    VLP+G  E HG HLP+ TDT+I + L    AE++ ++L P          P+
Sbjct: 19  EKRKIDSFVLPVGTVEPHGTHLPLGTDTLIPSALGEYVAEKVNAVLLP----------PV 68

Query: 73  GYSIE---HMYVDGTKTLTYAEAIEHWL-AIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
            Y +    H Y    +     E +E  +  I++++   G R  +ILN HGGN+  +   +
Sbjct: 69  HYGVTTGLHGYFGSVRV--QPETLEALVYEILESMSLHGFRYGLILNGHGGNTQALDNAA 126

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
            +A +R  + V+   W      +G+      + G H    ET+M+LA+ P LVK +L
Sbjct: 127 KKAWLRNKLAVMVVDWWILAREKGVTREVLGKEGGHAATDETAMVLAIRPELVKRNL 183


>gi|118469315|ref|YP_891073.1| creatinine amidohydrolase [Mycobacterium smegmatis str. MC2 155]
 gi|118170602|gb|ABK71498.1| creatinine amidohydrolase [Mycobacterium smegmatis str. MC2 155]
          Length = 274

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 82/167 (49%), Gaps = 7/167 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAER-IKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           + VLP+GA EQHG HLP+ TD ++   + +R ++ +   R     +P    G+S  H++ 
Sbjct: 23  VAVLPIGAVEQHGDHLPLGTDFLLVEAVCDRALQQLEDDRTTWVRVPTMTFGHSPHHLFA 82

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
               +L      +    ++D++ + G R+IVI+N HGGN  LV +      +       +
Sbjct: 83  -AAVSLQAGTLTDVLADVLDSLAQTGFRRIVIVNGHGGNDELVRLAVKAHSLHAEGTAAA 141

Query: 142 TSW----SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
            S+    ++ T        P+   G H G  ETS+MLA+ P LV  D
Sbjct: 142 CSYWTLTAQTTAEAAATERPDRTPG-HAGWFETSLMLAVHPELVADD 187


>gi|325969517|ref|YP_004245709.1| creatininase [Vulcanisaeta moutnovskia 768-28]
 gi|323708720|gb|ADY02207.1| Creatininase [Vulcanisaeta moutnovskia 768-28]
          Length = 245

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 104/236 (44%), Gaps = 20/236 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP G  E HGPHLP+ TD ++A  +AE        R  V  +P    G +       
Sbjct: 18  VAILPTGIVEAHGPHLPLGTDALMATYIAEEAAK----RTNVLLLPTVWYGNTYVLDKFP 73

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +++       +  I   + + G+R ++++N HGGN   +S+ + +     ++++V  
Sbjct: 74  GTISISNETLYMLYRDIFREVARNGVRYLIVINGHGGNVDALSMAAKDVAKETNLVIVII 133

Query: 143 SWS---RFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           +W       + + ++  PE     H  E ETS + A  P LVK    +  +    E    
Sbjct: 134 NWWIDLAKEVRKKVLETPEG----HAAEDETSEVWAAYPDLVKWVPRDGSADEWVE---- 185

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
               R +G   +         K V G    A+ +KG+ +L    +  +QL+ND+ +
Sbjct: 186 -ARFRIYGKEIYAQEYT----KAVQGYPSKASPEKGKAILEAAISEVVQLINDLRN 236


>gi|189466268|ref|ZP_03015053.1| hypothetical protein BACINT_02642 [Bacteroides intestinalis DSM
           17393]
 gi|189434532|gb|EDV03517.1| hypothetical protein BACINT_02642 [Bacteroides intestinalis DSM
           17393]
          Length = 253

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 106/241 (43%), Gaps = 24/241 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI------E 77
           V+LP GA E H  HLP  TD I+   +A     +   R  V CM + P+ +        E
Sbjct: 24  VILPWGATEPHNLHLPYLTDCILPHDIAVDAAMLALKRSGVRCMVMPPVPFGAHNPGQRE 83

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             +   T+  T    +E    I+ ++   G+RK++I++ HGGN+    ++   A      
Sbjct: 84  LPFCIHTRYATQQAILED---IVASLYAQGMRKLIIVSGHGGNN-FKGMIRDLAFSYPDF 139

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
           L+++T W      +    + E EI  H GE ETS+M+   P LV ++ A +  S+     
Sbjct: 140 LIIATDWFSLVPTK---DYFEAEIDDHAGEQETSVMMHYHPELVNLNEAGDGDSK----- 191

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGV---VGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
               +  +  +   GW+ +  +   V   VGN   A+ +KGE  +        +L  ++ 
Sbjct: 192 ---PFAISSLNEKLGWAPRHWDKATVDSGVGNPKKASAEKGERYVKPIIEKLAKLFTEVG 248

Query: 255 S 255
            
Sbjct: 249 Q 249


>gi|284172773|ref|YP_003406155.1| Creatininase [Haloterrigena turkmenica DSM 5511]
 gi|284017533|gb|ADB63482.1| Creatininase [Haloterrigena turkmenica DSM 5511]
          Length = 245

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 101/220 (45%), Gaps = 14/220 (6%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           DA +  + +LP+G+ EQHGPH P+ TDT+ A  +AE           V   P  P+G + 
Sbjct: 12  DAVETDLALLPVGSTEQHGPHAPLGTDTLNAEAVAEAAAERYEG--TVAVAPAVPVGIAE 69

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EH    GT   + +    +   I+ ++   G  +IV++N HGGN+  +  V+     R  
Sbjct: 70  EHRQFTGTLWTSESTFKAYVRDIVSSLAHHGFDRIVLVNGHGGNTSALQEVAGRITRRDD 129

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
              V  +W         +    + +G HGG +ET+++    P  V+ D  E  +   SE 
Sbjct: 130 AYTVPFTWF------DEVGEHSSRMG-HGGPLETALVQHANPGAVREDRLEEAAENGSER 182

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
             +++     G  +  +   +    GVVG+  +A+ + GE
Sbjct: 183 WGDWQ-----GRVNLAFDSAEFTENGVVGDPREASAELGE 217


>gi|288562898|pdb|3A6G|A Chain A, W154f Mutant Creatininase
 gi|288562899|pdb|3A6G|B Chain B, W154f Mutant Creatininase
 gi|288562900|pdb|3A6G|C Chain C, W154f Mutant Creatininase
 gi|288562901|pdb|3A6G|D Chain D, W154f Mutant Creatininase
 gi|288562902|pdb|3A6G|E Chain E, W154f Mutant Creatininase
 gi|288562903|pdb|3A6G|F Chain F, W154f Mutant Creatininase
          Length = 260

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 88/183 (48%), Gaps = 20/183 (10%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A  D +++LP+GA EQHG H+ MN D ++   + +R+      R+    MP    GY  +
Sbjct: 20  AAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAE----RIGALVMPGLQYGYKSQ 75

Query: 78  HM-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTE 130
                  +  GT +L  A        II  + + G R++V++N H  NS  +   I    
Sbjct: 76  QKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYENSMFIVEGIDLAL 135

Query: 131 ARMRFSML----VVSTSWSRFTIPQGIIS--FPETEIGI---HGGEIETSMMLALAPHLV 181
             +R++ +    VV  S+  F     +I   +PE  +G    HGG  ETS+MLAL P LV
Sbjct: 136 RELRYAGIQDFKVVVLSYFDFVKDPAVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLV 195

Query: 182 KMD 184
            +D
Sbjct: 196 DLD 198


>gi|239627177|ref|ZP_04670208.1| creatininase [Clostridiales bacterium 1_7_47_FAA]
 gi|239517323|gb|EEQ57189.1| creatininase [Clostridiales bacterium 1_7_47FAA]
          Length = 251

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 83/180 (46%), Gaps = 16/180 (8%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI----KSILPPRLPVTCMPVEPIG 73
            RKD IV+LP+GA EQHGPHLP+  DT++A   + RI      I+ P L   C   +   
Sbjct: 17  GRKDGIVILPIGATEQHGPHLPLCVDTVLAEEFSYRIAGQVDGIVAPSL---CYGYKSKP 73

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTEA 131
           +S       GT  L           +ID   + G  +I++ NAH  N P V  ++    A
Sbjct: 74  FSGGGPLFPGTIDLNGQTLQNLVQDVIDEFVRDGFSRILLFNAHFENEPFVVEAMDLCSA 133

Query: 132 RMRFSMLVVSTSWSRFTIPQGI------ISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
           R    + ++  +W     P  I      + FP   +  H    ETS+M+  AP LV+ DL
Sbjct: 134 RHGDGVKLLLMNWWDPMSPNMIERIFDQVPFPGWALE-HAAITETSLMMYFAPELVRQDL 192


>gi|20093623|ref|NP_613470.1| hypothetical protein MK0183 [Methanopyrus kandleri AV19]
 gi|19886489|gb|AAM01400.1| Uncharacterized protein, putative amidase [Methanopyrus kandleri
           AV19]
          Length = 224

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 95/237 (40%), Gaps = 34/237 (14%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +V+LP+G+ EQHG HLP+ TD +IA  L   +      R      P  P G S  HM   
Sbjct: 17  VVLLPVGSTEQHGLHLPLGTDHLIAEALCREVSK----RTGAPWYPAIPYGVSRHHMGFP 72

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L     +     +  +    G    + +N HGGN   +  V+ E   RF  +    
Sbjct: 73  GTVSLRTKTMVALLTDVHRSFLHHGAAATLAVNGHGGNEAALGTVAEEEE-RFHWI---- 127

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW +       I   ET+ G H  E+ETS+ML L P LV  +                  
Sbjct: 128 SWWKLA----PIDELETDWGGHADELETSVMLYLHPELVGEE------------------ 165

Query: 203 LRAHGSHSFGWSMKD---LNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
            +  G  +  W   D   ++  G  G+   AT  KG+ +        + ++ ++   
Sbjct: 166 RKVDGRPTKPWEFPDYHEISETGTKGDPRPATADKGKRIFKTVVERLVDIVEELREM 222


>gi|305664436|ref|YP_003860723.1| hypothetical protein FB2170_16431 [Maribacter sp. HTCC2170]
 gi|88708453|gb|EAR00689.1| hypothetical protein FB2170_16431 [Maribacter sp. HTCC2170]
          Length = 254

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/264 (27%), Positives = 122/264 (46%), Gaps = 29/264 (10%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLA-ERIKSILPPRLPV 64
           I  + +     +A+ D + +LP GA E H  HLP  TD   +  LA E  +        V
Sbjct: 6   ILAETNWKALENAKFD-LAILPWGATEAHNYHLPYATDVYESDALAAESARLAWEKGSKV 64

Query: 65  TCMPVEPIGYSI--EHMYVDGTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGNS 121
             +P  P G +     +Y+D     T   AI   LA +I+ + + GI+K++I N+HGGN+
Sbjct: 65  IVLPSIPFGVNTGQSDIYLDINLNPTTQLAI---LADVIEVLNRQGIKKLLIFNSHGGNN 121

Query: 122 --PLVSIVSTEARMRF-SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
             PLV     E  ++F  M +  ++W  F        F E   G H  E+ETS+ML L P
Sbjct: 122 FKPLVR----ELGLKFPEMFICFSNW--FQSLNKTEYFDEE--GDHADEMETSLMLYLRP 173

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMK---DLNPKGVVGNAMDATVKKG 235
            LV         S +   +++F       S  + W+ +   +++    +GN M +T +KG
Sbjct: 174 DLVLPKKIWGLGSSKKFKIKSF-------SEGWVWAERKWSEVSEDTGIGNPMQSTTEKG 226

Query: 236 EGLLSYFANCFIQLLNDINSFDVS 259
           E           Q ++++++ D++
Sbjct: 227 ERFFKDVTIKIGQFIHELSNSDLA 250


>gi|330507491|ref|YP_004383919.1| creatininase [Methanosaeta concilii GP-6]
 gi|328928299|gb|AEB68101.1| creatininase [Methanosaeta concilii GP-6]
          Length = 239

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 106/244 (43%), Gaps = 44/244 (18%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSI--E 77
           V+LP+GA E+HGPHLP  TDTI     A  +A++ +  L P          PI Y +   
Sbjct: 22  VILPVGATEEHGPHLPTITDTIQAMETARTVAQKREVFLAP----------PIHYGVCRS 71

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST------EA 131
                GT T+ +     +   ++ +    G   ++IL  H G+  + ++         E 
Sbjct: 72  TRGFPGTITVGHDALRSYVKEVLISFTDSGFENVLILTGHAGSQHMSALKEACQMALEER 131

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSS 191
             R S++    S      PQ      ET    H GEIETSMM+ +   LVK    E+F  
Sbjct: 132 EFRVSLV----SLFDLIDPQAA----ETPHDGHAGEIETSMMMVIRKDLVKGLPEEHFPP 183

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
           R       F  ++          ++ L   G++GN   AT+KKG+  L+  A   I+ L 
Sbjct: 184 RP-----RFLIMK---------DVRHLMGNGIMGNPAPATIKKGQNFLAMAAEGLIEALE 229

Query: 252 DINS 255
           ++ S
Sbjct: 230 ELES 233


>gi|292494083|ref|YP_003533225.1| creatininase [Haloferax volcanii DS2]
 gi|291369069|gb|ADE01299.1| creatininase [Haloferax volcanii DS2]
          Length = 231

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 99/242 (40%), Gaps = 36/242 (14%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP+G+ EQHGPH P+ TDTIIA  LA          L    +P  P+G +  H +  
Sbjct: 18  VALLPVGSTEQHGPHAPVGTDTIIAQELASEAGR--RSDLNSVVLPTIPVGIAPYHSHFP 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP----LVSIVSTEARMRFSML 138
           GT +++      +   I+ ++    +  +V +N HGGN      L   V+ ++ +   + 
Sbjct: 76  GTLSVSAETLRRYSYEILTSLSNSSVETVVFVNGHGGNGETLRNLTRTVADDSTVDLEVF 135

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV----KMDLAENFSSRQS 194
           +    W   +     ++        H GE+ETSM L + P  V      D A    +   
Sbjct: 136 L----WEWMSAVDDHVN--------HAGELETSMHLHICPDEVGSPTDGDAATWDDTVDG 183

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
             +  F               ++ +  G VG+A  A+ ++GE L     +     L  ++
Sbjct: 184 GVVNRF--------------TEEFSKNGAVGDATSASAEQGEQLFETATDALCSFLRRVD 229

Query: 255 SF 256
             
Sbjct: 230 DL 231


>gi|76800861|ref|YP_325869.1| hypothetical protein NP0414A [Natronomonas pharaonis DSM 2160]
 gi|76556726|emb|CAI48298.1| conserved hypothetical protein [Natronomonas pharaonis DSM 2160]
          Length = 242

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 103/246 (41%), Gaps = 29/246 (11%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAE----RIKSILPPRLPVTCMPVEPI 72
           DA  D + VLP+G+ EQHGPH P+  D + A  +AE    R       +  V   P  P+
Sbjct: 13  DATTD-LAVLPVGSTEQHGPHAPLGVDWLTAEAIAEAGVDRYADTHGEKPLVG--PTIPV 69

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           G + EH   DGT  ++      +    + ++   G  ++VI+N HGGN   ++ V     
Sbjct: 70  GVAEEHRDFDGTLWVSPDTFRSYVGETVASLASHGFERVVIVNGHGGNVDALNEVCARLT 129

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD----LAEN 188
                  V  +W         + F    +G HGG  ET++M  L P LV+ D     AE 
Sbjct: 130 RDGDAYAVQYTWFD------AVDF--ASLG-HGGPAETAVMRHLHPELVREDRTDTAAEG 180

Query: 189 FSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
            +    E++       A  S SF          G VG+  +     GE L    A   ++
Sbjct: 181 AADSWGEWVSGTNL--AVDSSSF-------TESGAVGDPREGDADLGEELFEKAAAALVE 231

Query: 249 LLNDIN 254
           LL+ + 
Sbjct: 232 LLDAVE 237


>gi|262203638|ref|YP_003274846.1| creatininase [Gordonia bronchialis DSM 43247]
 gi|262086985|gb|ACY22953.1| Creatininase [Gordonia bronchialis DSM 43247]
          Length = 237

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/227 (29%), Positives = 104/227 (45%), Gaps = 24/227 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLGA EQHGPHLP++TDT IA  + + ++      L     P    G S EH    G
Sbjct: 22  VLVPLGALEQHGPHLPLDTDTRIATAVVDGVRGHGDATLYRA--PELAYGASGEHEGFPG 79

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T ++ + EA+   L            ++V +N HGGN P  ++ S   R+R+    V  +
Sbjct: 80  TVSIGH-EALYQVLLEYGRSACRWADRLVFVNGHGGNGP--TLRSAVTRLRYEGRDV--A 134

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
           W     P     F       H G  ETS++L+L+P LV+ D  E  +  ++        +
Sbjct: 135 W----FP---CVFDGARADAHAGYTETSVLLSLSPQLVRQDRLE--AGNRASVATLLPAM 185

Query: 204 RAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL-SYFANCFIQL 249
           R  G       +  ++  GV+G+   A+ + G  LL +  A C   L
Sbjct: 186 REGG-------VAAVSANGVLGDPTTASAEDGTRLLAATIARCEAAL 225


>gi|160936440|ref|ZP_02083809.1| hypothetical protein CLOBOL_01332 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440723|gb|EDP18461.1| hypothetical protein CLOBOL_01332 [Clostridium bolteae ATCC
           BAA-613]
          Length = 304

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 120/268 (44%), Gaps = 32/268 (11%)

Query: 5   IIFTDNSLPL-CADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           + F DN+  + CA A++   I +LP+GA EQHGPH P  +D+  A G+AE +      R 
Sbjct: 15  VWFQDNTAAVNCAYAKEVCDIAILPIGAIEQHGPHCPCGSDSFNAMGIAEAV-----ARK 69

Query: 63  PVTCMPVEPI--GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
               +   P+   +   H  + GT  LT+   +     I+      G  K +I++AHG  
Sbjct: 70  SGAMILACPMYGSHPAHHWGMPGTIPLTFETHVGLLTDIVRGAANAGFNKFLIISAHGQT 129

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRF--TIPQGIISFPETEIGIHGGEIETSMMLALAP 178
             +   V       +    + ++W  F     + + +F       H  E ETS+ L+L P
Sbjct: 130 MSMFEAVHKLGIEGY--FTIGSTWYDFLRDNKKTLDTFM-----WHADEAETSVALSLYP 182

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRA-----------HGSHSFGWSMKDLNPKGVVGNA 227
             V MDLA      ++  L + K+  A           H   +F    KD    GV+G+ 
Sbjct: 183 DKVHMDLA---VPGKAHGLIDSKWKIAPGQAAGEGMLYHFEGTFSLMEKDDLDTGVIGDP 239

Query: 228 MDATVKKGEGLLSYFANCFIQLLNDINS 255
            +A+ +KG+ ++   A+ + +LL ++ +
Sbjct: 240 TNASKEKGDKIVERCADLYCELLEEVKT 267


>gi|288562910|pdb|3A6J|A Chain A, E122q Mutant Creatininase Complexed With Creatine
 gi|288562911|pdb|3A6J|B Chain B, E122q Mutant Creatininase Complexed With Creatine
 gi|288562912|pdb|3A6J|C Chain C, E122q Mutant Creatininase Complexed With Creatine
 gi|288562913|pdb|3A6J|D Chain D, E122q Mutant Creatininase Complexed With Creatine
 gi|288562914|pdb|3A6J|E Chain E, E122q Mutant Creatininase Complexed With Creatine
 gi|288562915|pdb|3A6J|F Chain F, E122q Mutant Creatininase Complexed With Creatine
 gi|288562916|pdb|3A6K|A Chain A, The E122q Mutant Creatininase, Mn-Zn Type
 gi|288562917|pdb|3A6K|B Chain B, The E122q Mutant Creatininase, Mn-Zn Type
 gi|288562918|pdb|3A6K|C Chain C, The E122q Mutant Creatininase, Mn-Zn Type
 gi|288562919|pdb|3A6K|D Chain D, The E122q Mutant Creatininase, Mn-Zn Type
 gi|288562920|pdb|3A6K|E Chain E, The E122q Mutant Creatininase, Mn-Zn Type
 gi|288562921|pdb|3A6K|F Chain F, The E122q Mutant Creatininase, Mn-Zn Type
 gi|288562922|pdb|3A6L|A Chain A, E122q Mutant Creatininase, Zn-Zn Type
 gi|288562923|pdb|3A6L|B Chain B, E122q Mutant Creatininase, Zn-Zn Type
 gi|288562924|pdb|3A6L|C Chain C, E122q Mutant Creatininase, Zn-Zn Type
 gi|288562925|pdb|3A6L|D Chain D, E122q Mutant Creatininase, Zn-Zn Type
 gi|288562926|pdb|3A6L|E Chain E, E122q Mutant Creatininase, Zn-Zn Type
 gi|288562927|pdb|3A6L|F Chain F, E122q Mutant Creatininase, Zn-Zn Type
          Length = 260

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 88/183 (48%), Gaps = 20/183 (10%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A  D +++LP+GA EQHG H+ MN D ++   + +R+      R+    MP    GY  +
Sbjct: 20  AAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAE----RIGALVMPGLQYGYKSQ 75

Query: 78  HM-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTE 130
                  +  GT +L  A        II  + + G R++V++N H  NS  +   I    
Sbjct: 76  QKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYQNSMFIVEGIDLAL 135

Query: 131 ARMRFSML----VVSTSWSRFTIPQGIIS--FPETEIGI---HGGEIETSMMLALAPHLV 181
             +R++ +    VV  S+  F     +I   +PE  +G    HGG  ETS+MLAL P LV
Sbjct: 136 RELRYAGIQDFKVVVLSYWDFVKDPAVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLV 195

Query: 182 KMD 184
            +D
Sbjct: 196 DLD 198


>gi|15612789|ref|NP_241092.1| creatinine amidohydrolase [Bacillus halodurans C-125]
 gi|10172838|dbj|BAB03945.1| creatinine amidohydrolase [Bacillus halodurans C-125]
          Length = 249

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 115/254 (45%), Gaps = 30/254 (11%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  +     +  I +LP+GA E HGPHLP+ TD +    LAER+  ++  R+    +P
Sbjct: 6   ENSFEVKQKISEKQIAILPIGAIEAHGPHLPLETDNL----LAERLSILVAKRVGAFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
             P G         G+ T++    +   + + +++   G     ++N H GNS  +   +
Sbjct: 62  TLPYGQVWSLKNFPGSITVSNESLVNMLVDLGESLYNQGFSIFSMVNGHLGNSVALKEAA 121

Query: 129 TEARMRFSMLVVSTSWSRFTIP---QGIISFPET----EIGIHGGEIETSMMLALAPHLV 181
            +   R+  L V      F  P   + + S  ET        H  EIETS+ML LAP  V
Sbjct: 122 RKLYERYPDLQV----LYFFYPGMSEVVSSIRETPSSHNTYFHACEIETSLMLYLAPEYV 177

Query: 182 KMDLAENFSSRQSEFLRNFKY--LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            M+ A          + +     L A  + +  W  ++     V+G+A  AT +KGE ++
Sbjct: 178 DMERA----------ICDIPVIPLSADATPT-PW--EEFTDTAVLGDATLATKEKGEKVI 224

Query: 240 SYFANCFIQLLNDI 253
           S   +  +Q++ ++
Sbjct: 225 SVVLDNIVQVIEEV 238


>gi|333028912|ref|ZP_08456976.1| hypothetical protein STTU_6416 [Streptomyces sp. Tu6071]
 gi|332748764|gb|EGJ79205.1| hypothetical protein STTU_6416 [Streptomyces sp. Tu6071]
          Length = 266

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 89/188 (47%), Gaps = 19/188 (10%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP------P 60
            T+ +     +A  D I +LP+G+ EQH  HLP+ TDT++A  + ER  + L        
Sbjct: 6   LTETTWRETREAAPDAIALLPIGSQEQHAAHLPLGTDTLLAEAVTERALAHLAGRAAEGE 65

Query: 61  RLP-VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLA-----IIDAIRKMGIRKIVIL 114
           R+P V  +P  P G+S  H++      LT +    H L      I+D++   G R+++++
Sbjct: 66  RVPHVVRLPTLPYGHSPHHLFA---AALTLS---AHTLGLVLDEILDSLAATGHRRVLVV 119

Query: 115 NAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMML 174
           N HGGN  ++ +      +R  +   + S+                 G H G  ETS+ML
Sbjct: 120 NGHGGNDEIMRLAVKRFALRAEVTAAACSYWSLGEAAADAEHAALVPG-HAGWYETSLML 178

Query: 175 ALAPHLVK 182
           A  P LV+
Sbjct: 179 AAHPGLVR 186


>gi|75345307|sp|P83772|CRNA_PSEPU RecName: Full=Creatinine amidohydrolase; AltName: Full=Creatininase
 gi|42542992|pdb|1J2T|A Chain A, Creatininase Mn
 gi|42542993|pdb|1J2T|B Chain B, Creatininase Mn
 gi|42542994|pdb|1J2T|C Chain C, Creatininase Mn
 gi|42542995|pdb|1J2T|D Chain D, Creatininase Mn
 gi|42542996|pdb|1J2T|E Chain E, Creatininase Mn
 gi|42542997|pdb|1J2T|F Chain F, Creatininase Mn
 gi|42542998|pdb|1J2U|A Chain A, Creatininase Zn
 gi|42542999|pdb|1J2U|B Chain B, Creatininase Zn
 gi|42543000|pdb|1J2U|C Chain C, Creatininase Zn
 gi|42543001|pdb|1J2U|D Chain D, Creatininase Zn
 gi|42543002|pdb|1J2U|E Chain E, Creatininase Zn
 gi|42543003|pdb|1J2U|F Chain F, Creatininase Zn
 gi|42543898|pdb|1V7Z|A Chain A, Creatininase-Product Complex
 gi|42543899|pdb|1V7Z|B Chain B, Creatininase-Product Complex
 gi|42543900|pdb|1V7Z|C Chain C, Creatininase-Product Complex
 gi|42543901|pdb|1V7Z|D Chain D, Creatininase-Product Complex
 gi|42543902|pdb|1V7Z|E Chain E, Creatininase-Product Complex
 gi|42543903|pdb|1V7Z|F Chain F, Creatininase-Product Complex
 gi|288562880|pdb|3A6D|A Chain A, Creatininase Complexed With 1-Methylguanidine
 gi|288562881|pdb|3A6D|B Chain B, Creatininase Complexed With 1-Methylguanidine
 gi|288562882|pdb|3A6D|C Chain C, Creatininase Complexed With 1-Methylguanidine
 gi|288562883|pdb|3A6D|D Chain D, Creatininase Complexed With 1-Methylguanidine
 gi|288562884|pdb|3A6D|E Chain E, Creatininase Complexed With 1-Methylguanidine
 gi|288562885|pdb|3A6D|F Chain F, Creatininase Complexed With 1-Methylguanidine
 gi|662294|dbj|BAA08265.1| creatinine amidohydrolase [Pseudomonas sp. PS-7]
          Length = 260

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 88/183 (48%), Gaps = 20/183 (10%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A  D +++LP+GA EQHG H+ MN D ++   + +R+      R+    MP    GY  +
Sbjct: 20  AAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAE----RIGALVMPGLQYGYKSQ 75

Query: 78  HM-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTE 130
                  +  GT +L  A        II  + + G R++V++N H  NS  +   I    
Sbjct: 76  QKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYENSMFIVEGIDLAL 135

Query: 131 ARMRFSML----VVSTSWSRFTIPQGIIS--FPETEIGI---HGGEIETSMMLALAPHLV 181
             +R++ +    VV  S+  F     +I   +PE  +G    HGG  ETS+MLAL P LV
Sbjct: 136 RELRYAGIQDFKVVVLSYWDFVKDPAVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLV 195

Query: 182 KMD 184
            +D
Sbjct: 196 DLD 198


>gi|318058955|ref|ZP_07977678.1| hypothetical protein SSA3_13481 [Streptomyces sp. SA3_actG]
          Length = 266

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 89/188 (47%), Gaps = 19/188 (10%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP------P 60
            T+ +     +A  D I +LP+G+ EQH  HLP+ TDT++A  + ER  + L        
Sbjct: 6   LTETTWRETREAAPDAIALLPIGSQEQHAAHLPLGTDTLLAEAVTERALAHLAGRAADGE 65

Query: 61  RLP-VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLA-----IIDAIRKMGIRKIVIL 114
           R+P V  +P  P G+S  H++      LT +    H L      I+D++   G R+++++
Sbjct: 66  RVPHVVRLPTLPYGHSPHHLFA---AALTLS---AHTLGLVLDEILDSLAATGHRRVLVV 119

Query: 115 NAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMML 174
           N HGGN  ++ +      +R  +   + S+                 G H G  ETS+ML
Sbjct: 120 NGHGGNDEIMRLAVKRFALRAEVTAAACSYWSLGEAAADAEHAALVPG-HAGWYETSLML 178

Query: 175 ALAPHLVK 182
           A  P LV+
Sbjct: 179 AAHPGLVR 186


>gi|255026903|ref|ZP_05298889.1| hypothetical protein LmonocytFSL_12236 [Listeria monocytogenes FSL
           J2-003]
          Length = 235

 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 67/226 (29%), Positives = 106/226 (46%), Gaps = 22/226 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA EQHG HLP+  D  +A  LAE    ++  +     +P  P GYS     + 
Sbjct: 25  VAILPLGATEQHGHHLPLGVDIFLADHLAE----LVSEKTGAVVIPPMPFGYSWVWRDIP 80

Query: 83  GTKTLT--YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           GT ++   + EAI   +A   ++ + G++ +V++N H  N+  +     E      M V+
Sbjct: 81  GTISIQQHHVEAIIKDVA--HSVSRYGVKMLVLINGHDSNNNSMKYAVRELADELEMPVM 138

Query: 141 STSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
              +   +          T  G IH  E ETS+MLA    LV+M  A          +R 
Sbjct: 139 YLFYPSLSEVMEKNCESGTWHGMIHACEFETSLMLATKKELVQMKKA----------VRE 188

Query: 200 F-KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
           + +    +G  +   S+ DL+  GV G+A  AT +KGE ++  FA 
Sbjct: 189 YPEKPTLYGKTTI--SLGDLSKSGVYGDASLATEEKGERMVQLFAE 232


>gi|78486140|ref|YP_392065.1| creatininase [Thiomicrospira crunogena XCL-2]
 gi|78364426|gb|ABB42391.1| Creatinine amidohydrolase [Thiomicrospira crunogena XCL-2]
          Length = 255

 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 106/246 (43%), Gaps = 22/246 (8%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM-YVD 82
            +LP+GA EQHGPHL    D+ IA  LAE++      +  V  +P  P G SI H     
Sbjct: 23  ALLPVGATEQHGPHLGCGMDSEIANQLAEKVSG----QTDVALLPTLPYGCSIGHSERWP 78

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSMLVVS 141
           GT  L     I+    I D +   G +++ ILN+H  N +PL   +          +V  
Sbjct: 79  GTIALQPKTLIDVVKEIGDWVHASGFKRLFILNSHVSNFAPLRCALEMLRAEHDGFMVAL 138

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
            + S  +       F + E   H  E ETS+M+ALAP LV+ D  ++             
Sbjct: 139 VNSSTVSERVKARHFEDAE-DWHANEAETSLMMALAPQLVRDDKLQDSDDPD-------- 189

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA---NCFIQL-LNDINSFD 257
             R  G   F   +   +  GV G    ATV+KG  L  +     +C ++  +++ +   
Sbjct: 190 --RTEGC-VFSHPVNRTSMNGVTGCPSLATVEKGHELFDWMVEDLSCVVKKGMSETSPLP 246

Query: 258 VSIFDK 263
              FDK
Sbjct: 247 YGYFDK 252


>gi|284042712|ref|YP_003393052.1| creatininase [Conexibacter woesei DSM 14684]
 gi|283946933|gb|ADB49677.1| Creatininase [Conexibacter woesei DSM 14684]
          Length = 299

 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 80/160 (50%), Gaps = 4/160 (2%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + ++P+G+ EQHGPH+ ++ D  IA G A R+   L     V C P    G S  H+   
Sbjct: 63  VALVPIGSCEQHGPHMTLDADLAIATGFAGRLADALGDEA-VVC-PGVAYGMSEHHLAFP 120

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA-RMRFSMLVVS 141
           GT TL     +     +++++   G+ +++++N HGGN   + + + EA R R  +LV +
Sbjct: 121 GTLTLRAETLLAIVRDLVESLAHWGVTRVLLVNGHGGNLDALRLAAREAVRDRPGVLVGA 180

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             WS       I          H  EIETS+ LA+AP  V
Sbjct: 181 VMWSVLAA-DAIAPHAVGPRYGHACEIETSVALAVAPQAV 219


>gi|302517408|ref|ZP_07269750.1| creatinine amidohydrolase [Streptomyces sp. SPB78]
 gi|302426303|gb|EFK98118.1| creatinine amidohydrolase [Streptomyces sp. SPB78]
          Length = 241

 Score = 72.4 bits (176), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 89/188 (47%), Gaps = 19/188 (10%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP------P 60
            T+ +     +A  D I +LP+G+ EQH  HLP+ TDT++A  + ER  + L        
Sbjct: 6   LTETTWRETREAAPDAIALLPIGSQEQHAAHLPLGTDTLLAEAVTERALAHLAGRAADGE 65

Query: 61  RLP-VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLA-----IIDAIRKMGIRKIVIL 114
           R+P V  +P  P G+S  H++      LT +    H L      I+D++   G R+++++
Sbjct: 66  RVPHVVRLPTLPYGHSPHHLFA---AALTLS---AHTLGLVLDEILDSLAATGHRRVLVV 119

Query: 115 NAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMML 174
           N HGGN  ++ +      +R  +   + S+                 G H G  ETS+ML
Sbjct: 120 NGHGGNDEIMRLAVKRFALRAEVTAAACSYWSLGEAAADAEHAALVPG-HAGWYETSLML 178

Query: 175 ALAPHLVK 182
           A  P LV+
Sbjct: 179 AAHPGLVR 186


>gi|255008574|ref|ZP_05280700.1| hypothetical protein Bfra3_05493 [Bacteroides fragilis 3_1_12]
 gi|313146303|ref|ZP_07808496.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313135070|gb|EFR52430.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 253

 Score = 72.4 bits (176), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 103/245 (42%), Gaps = 24/245 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI------ 76
           +++LP GA E H  HLP  TD I+   +A     +   R  V CM + P+ +        
Sbjct: 22  VIILPWGATEPHNLHLPYLTDCILPHDIAVEAAEMALARSGVRCMVMPPVPFGAHNPGQR 81

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           E  +   T+  T    +E    I+ ++   G RK+VIL  HGGN+    ++   A     
Sbjct: 82  ELPFCIHTRYATQQAILED---IVSSLYVQGFRKLVILCGHGGNN-FKGMIRDLAFEYPD 137

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
            L+ + +W     P+G     E E+  H GE ET++M+   P LV  +LAE    +   F
Sbjct: 138 FLIAAANWFEVVSPKGYF---EAEVDDHAGESETAVMMHYHPELV--NLAEAGDGKSKPF 192

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGV---VGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                   A  +    W  +  +       VG+   AT +KGE  +        +L  ++
Sbjct: 193 ------AIASLNEKVAWVPRHWDKATADSGVGDPRKATAEKGERYVKPIVEKLARLFEEM 246

Query: 254 NSFDV 258
              D+
Sbjct: 247 VKHDL 251


>gi|145591227|ref|YP_001153229.1| creatininase [Pyrobaculum arsenaticum DSM 13514]
 gi|145282995|gb|ABP50577.1| Creatininase [Pyrobaculum arsenaticum DSM 13514]
          Length = 242

 Score = 72.4 bits (176), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 103/235 (43%), Gaps = 20/235 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+G  E HGPHLP+ TD ++A  +AE+          V  +P  PI Y   ++   
Sbjct: 18  VAVLPVGVIEAHGPHLPLGTDALMALYVAEKAAE----EAGVLLLP--PIWYGSTYVLEK 71

Query: 83  --GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT +++       +  +   + + G+R +V++N HGGN   + + + +      + +V
Sbjct: 72  FPGTISISGETLYRLYKEVFMEVARNGVRYLVVVNGHGGNIDALKMAAKDVAKSTYLNIV 131

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
             +W      +      ET  G H  E ETS ++A  PHLVK         R ++     
Sbjct: 132 LVNWWIDLAKEARRKVLETPEG-HAAEDETSEVMAAYPHLVKE------IPRDADEWAEA 184

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           KY   +G+  +    K    K V G    A+ +KGE +L         LL D+  
Sbjct: 185 KYA-VYGARVYAMMYK----KAVQGYPSRASREKGEAILKAAVEELKSLLEDLKK 234


>gi|302348427|ref|YP_003816065.1| Creatininase [Acidilobus saccharovorans 345-15]
 gi|302328839|gb|ADL19034.1| Creatininase [Acidilobus saccharovorans 345-15]
          Length = 264

 Score = 72.4 bits (176), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 99/227 (43%), Gaps = 16/227 (7%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I V+P+G+ E+HG HLP+ TD I AA +A+R+   L   L     P    G S       
Sbjct: 19  IAVIPIGSVERHGDHLPLGTDAIEAAWVAQRVADALGADL----FPTIWYGVSPALARFP 74

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  +     I +  +++  I + G R IVI+N HGGN+  + +   +A        V  
Sbjct: 75  GTINVETDAFIAYVRSVLKEIARNGYRLIVIINGHGGNTTAIRVAMKDAAYSTGATFVMF 134

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF----LR 198
            W R    + +     T  G H GE ETS ML +    V M  A  + S  S       R
Sbjct: 135 DWWRDAGREALRQL-FTSPG-HAGEDETSAMLYIDGAHVDMSAARAYPSGWSPSSEGEAR 192

Query: 199 NFKYLRAHGSHSFGWSMKD------LNPKGVVGNAMDATVKKGEGLL 239
           + K +R    +  G +++       L P  V+G+   A+  +G   L
Sbjct: 193 DLKSMRNSMIYVQGVAVESQAVDQALYPYAVLGDPTKASADRGAKWL 239


>gi|149174717|ref|ZP_01853342.1| hypothetical protein PM8797T_26315 [Planctomyces maris DSM 8797]
 gi|148846411|gb|EDL60749.1| hypothetical protein PM8797T_26315 [Planctomyces maris DSM 8797]
          Length = 267

 Score = 72.4 bits (176), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 99/236 (41%), Gaps = 17/236 (7%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVTCMPVEPIGYSIEHMYV 81
           + VLP+GA E H  HLP  TDT  A  ++ R+      R   V  +P  P G        
Sbjct: 27  VAVLPMGATEPHNLHLPYGTDTYEADAISSRVCEAAHQRGAKVVMLPPIPYGTETNQAAF 86

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS--PLVSIVSTEARMRFSMLV 139
             +  +  +   +  + ++D++   G+ K++ILN+HGGN   PL+     E     S+ +
Sbjct: 87  PLSMNVNPSTLGQMIMDLVDSLANHGVNKLLILNSHGGNDFKPLLR----ELHGSTSVQI 142

Query: 140 VSTSWSRFT---IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
               W R T   +   I   P+     H GE+ETS+ LA  P LV  D AE  +    + 
Sbjct: 143 FLADWFRGTSADVKAEIFENPDD----HAGEMETSLALAYFPQLVNRD-AETGALHADDG 197

Query: 197 LRNFKYLRA--HGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
             N     A   G  S       L      GN   AT +KGE L+    +   Q +
Sbjct: 198 ATNATRFSAVNEGWVSITRPWHLLTTNSGSGNPHQATAEKGERLMQILVDRLSQFV 253


>gi|326391419|ref|ZP_08212956.1| Creatininase [Thermoanaerobacter ethanolicus JW 200]
 gi|325992554|gb|EGD51009.1| Creatininase [Thermoanaerobacter ethanolicus JW 200]
          Length = 241

 Score = 72.4 bits (176), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 108/247 (43%), Gaps = 42/247 (17%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +K  IV++P+G+ E HG HLP+ TD        E I+  +     V   P  P G S + 
Sbjct: 16  QKSDIVIIPVGSVEAHGHHLPLGTDIFSPRLFCEMIERKIGDY--VWIAPEIPYGQSYDL 73

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT  +      E+  A+  ++ + G++K++ LN HGGN   +++ S E  ++  M+
Sbjct: 74  SVYPGTIHVPSEVLAEYVYAVGKSLYENGLKKLIFLNGHGGNINALNLAS-EKLVQLGMV 132

Query: 139 VVSTSW------SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
           V++ +W         TI QG           H GE ETS +L     LV+MD A      
Sbjct: 133 VLTINWWLDFTKEILTITQG---------QGHAGEDETSAILYYNEKLVQMDKA------ 177

Query: 193 QSEFLRNFK------YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                +N K      Y +  G   +  +M         G+A  AT +KGE +        
Sbjct: 178 ----TKNLKKPLYRVYFKDRGKVFYENAMS--------GDATLATKEKGEKIFELLTEKI 225

Query: 247 IQLLNDI 253
           I+++ DI
Sbjct: 226 IKIILDI 232


>gi|71905720|ref|YP_283307.1| creatininase [Dechloromonas aromatica RCB]
 gi|71845341|gb|AAZ44837.1| Creatininase [Dechloromonas aromatica RCB]
          Length = 252

 Score = 72.0 bits (175), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 102/246 (41%), Gaps = 22/246 (8%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH-MYVD 82
            +LP+GA EQHGPHL    DT+IA  L   +      R  V  +P  P G S+ H     
Sbjct: 22  AILPVGATEQHGPHLGCGVDTVIADQLCRAVAK----RTGVPMLPPLPYGCSLGHSRRWP 77

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  +T    IE    I D     G+R++ I+NAH  N+  +       R     L+V+ 
Sbjct: 78  GTIAVTPVVLIEFVKQIGDWAYHSGVRRLFIVNAHVTNAAPLRCALEMLRAEHDDLMVAV 137

Query: 143 SWSRFTIPQGIISFPETE-IGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
             +  ++ Q +  F   +    H  + ETS+MLA+AP  V+            E L    
Sbjct: 138 I-NTASLSQRVREFHAADGDDWHANDAETSLMLAIAPEGVR-----------PEKLPEAD 185

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL----NDINSFD 257
                G   F   +   +  GV G    AT  KGE   ++ ++   +L+     +    D
Sbjct: 186 DPDRTGCCVFAHPVNRTSRNGVTGQPSAATAAKGEQWFAWLSDDLAELIARGCQETPPLD 245

Query: 258 VSIFDK 263
            S F +
Sbjct: 246 FSYFSQ 251


>gi|284165675|ref|YP_003403954.1| creatininase [Haloterrigena turkmenica DSM 5511]
 gi|284015330|gb|ADB61281.1| Creatininase [Haloterrigena turkmenica DSM 5511]
          Length = 245

 Score = 72.0 bits (175), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 106/240 (44%), Gaps = 34/240 (14%)

Query: 25  VLPLGAYEQHGPHLPMNTDTII------AAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +LP+G+ EQHGPH P+ TDTI+      AA  A   +SI+ P +PV   P         H
Sbjct: 20  LLPVGSTEQHGPHAPVGTDTIVARAIADAADRASDAESIVGPTIPVGIAPY--------H 71

Query: 79  MYVDGTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
               GT     AE    ++  ++++I    +  +V +N HGGN   +S ++ E     ++
Sbjct: 72  GNFPGT-CFVSAETFRRYVRDVVESIADSSVETVVFVNGHGGNGETLSHLAREVTAEDAI 130

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
              +  W         +   +  +G H GE+ET+++L L P  V   +A + ++      
Sbjct: 131 ECEAYLWE-------WMRAVDEHVG-HAGELETAVLLHLCPDDVGDPVAGDAATWADTVD 182

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
                      H F     + +  G VG+A DA+ ++GE +     +  +  L  + S D
Sbjct: 183 GGVV-------HQF---TDEFSENGAVGDATDASPEQGERVFETAVDALVSFLERVRSED 232


>gi|34810367|pdb|1Q3K|A Chain A, Crystal Structure Of Creatinine Amidohydrolase
           (Creatininase)
 gi|34810368|pdb|1Q3K|B Chain B, Crystal Structure Of Creatinine Amidohydrolase
           (Creatininase)
 gi|34810369|pdb|1Q3K|C Chain C, Crystal Structure Of Creatinine Amidohydrolase
           (Creatininase)
 gi|34810370|pdb|1Q3K|D Chain D, Crystal Structure Of Creatinine Amidohydrolase
           (Creatininase)
 gi|34810371|pdb|1Q3K|E Chain E, Crystal Structure Of Creatinine Amidohydrolase
           (Creatininase)
 gi|34810372|pdb|1Q3K|F Chain F, Crystal Structure Of Creatinine Amidohydrolase
           (Creatininase)
          Length = 259

 Score = 72.0 bits (175), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 89/183 (48%), Gaps = 20/183 (10%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A  D +++LP+GA EQHG H+ MN D ++   + +R+      R+    +P    GY  +
Sbjct: 19  AAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCQRVAE----RIGALVLPGLQYGYKSQ 74

Query: 78  HM-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTE 130
                  +  GT +L  A        II  + + G+R++V++N H  NS  +   I    
Sbjct: 75  QKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGVRRLVLMNGHYENSMFIVEGIDLAL 134

Query: 131 ARMRFSML----VVSTSWSRFTIPQGIIS--FPETEIGI---HGGEIETSMMLALAPHLV 181
             +R++ +    VV  S+  F     +I   +PE  +G    HGG  ETS+MLAL P LV
Sbjct: 135 RELRYAGIHDFKVVVLSYWDFVKDPAVIQRLYPEGFLGWDIEHGGVFETSLMLALYPDLV 194

Query: 182 KMD 184
            ++
Sbjct: 195 DLE 197


>gi|240102642|ref|YP_002958951.1| Creatinine amidohydrolase (creatininase) [Thermococcus
           gammatolerans EJ3]
 gi|239910196|gb|ACS33087.1| Creatinine amidohydrolase (creatininase) [Thermococcus
           gammatolerans EJ3]
          Length = 242

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 106/230 (46%), Gaps = 19/230 (8%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVTCMPVEPIGYSIEHMYVD 82
           V+LP+G+ E HG HLP+ TD      +AE ++  +  R   V  MP    G+S       
Sbjct: 24  VILPVGSVEAHGRHLPLGTDVFAPLKIAELVEQKVRERGKEVLVMPPIWYGHSFALNAYP 83

Query: 83  GTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSMLVV 140
           GT  +   E++  ++  ++  +   G +KIV+LN HGGN  PL       A +   + V 
Sbjct: 84  GTINVR-PESLRMYVGDVLAELAAEGFKKIVLLNGHGGNVYPLTEAAEDVAELYPDVEVY 142

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
             +W      + I+S    +   H GE ETS+MLA+ P LV M       +R     R  
Sbjct: 143 LINWW-LDFREDILSVCSGQ--GHAGEDETSVMLAIRPELVNMR-----EARGRRVKRKI 194

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           + ++       G   K++ P G+  +   AT +KGE +L   +    +++
Sbjct: 195 RVIK----KDIG---KEVFPDGLNDDPSSATAEKGERILQIVSESIARII 237


>gi|270293998|ref|ZP_06200200.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270275465|gb|EFA21325.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 253

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 105/242 (43%), Gaps = 24/242 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI------ 76
           +V+LP GA E H  HLP  TD I+   +A    ++      V CM + P+ +        
Sbjct: 23  VVILPWGATEPHNLHLPYLTDCILPHDIAVDAAALALQNSGVRCMVMPPVPFGAHNPGQR 82

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           E  +   T+  T    +E    I+ ++   G+RK++IL+ HGGN+    ++   A +   
Sbjct: 83  ELPFCIHTRYSTQQAILED---IVASLYAQGMRKLIILSGHGGNN-FKGMIRDLAFVYPD 138

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
            L+++  W     P+    + E  +  H GE ETS+M+   P LV +  A +  S+    
Sbjct: 139 FLIIAADWFSIVPPK---DYFEAVVDDHAGESETSVMMHYHPELVNLAEAGDGESQ---- 191

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGV---VGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                +     +   GW+ +  N   V   VGN   A+ +KGE  +        +L  ++
Sbjct: 192 ----PFAIPSLNEKVGWAPRHWNKATVDSGVGNPKKASAEKGERYMKPVVEKLSKLFTEV 247

Query: 254 NS 255
             
Sbjct: 248 GQ 249


>gi|297154836|gb|ADI04548.1| creatininase [Streptomyces bingchenggensis BCW-1]
          Length = 294

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 97/209 (46%), Gaps = 28/209 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEP---IGYSIEHMY 80
           V++P+GA EQHGPHLP+  DT I   +A  + ++       T +PV P    G S  H  
Sbjct: 65  VIIPVGATEQHGPHLPLAVDTRICEAVALGVSAL-------TGVPVLPPLSFGVSASHGD 117

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT  L     I     +ID++   GIR+ + LN H  N+  + + + + R+R      
Sbjct: 118 FAGTVALRPETMIAVVEDVIDSLYASGIRQFIQLNGHIWNNGALDVSAEKLRVRHRD--- 174

Query: 141 STSWSRFTIPQGIISFPETEIG---------IHGGEIETSMMLALAPHLVKMDLAENFSS 191
               +R      +  +P  E+          +H    ETS+ML LAP LV+M+LA +   
Sbjct: 175 ----ARVRALGYVTMYPGPEVDGHVTYGRALMHANYFETSVMLHLAPELVRMELATSHVD 230

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNP 220
             S +  +++  +   +  +G  + D +P
Sbjct: 231 LDSFW--DYRMDQVSETGVWGRDVTDADP 257


>gi|311746121|ref|ZP_07719906.1| putative amidase [Algoriphagus sp. PR1]
 gi|126576341|gb|EAZ80619.1| putative amidase [Algoriphagus sp. PR1]
          Length = 253

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/257 (27%), Positives = 114/257 (44%), Gaps = 18/257 (7%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAE-RIKSILP 59
           M P ++   N   L  D  +  + VLP GA E H  H+P  TD   A  +AE   K    
Sbjct: 1   MKPYLLKEANWKNLKTDRFE--LAVLPWGATEAHNYHMPYGTDVYEADAIAEIGAKKAWE 58

Query: 60  PRLPVTCMPVEPIGYSI-EH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
               V  +P  P G +  +H +Y+D     +   AI     +I+ + + G++K++ILN+H
Sbjct: 59  KGSKVIVLPTIPFGVNTGQHDIYLDMNLNPSTQMAILR--DLIEVLDRQGLKKLLILNSH 116

Query: 118 GGNSPLVSIVSTEARMRF-SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           GGN      +  E  + F  ML+ + +W  F      + F   E+G H  E+ETS+++ L
Sbjct: 117 GGND--FKTILRELGLEFPDMLLFTCNW--FQSLDKTLYF--EEMGDHADEMETSLIMYL 170

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P LV         S +   +   +   A       WS  +++    +GN   A+ +KG+
Sbjct: 171 HPELVSPLEEAGLGSEKKSVITGLQEKWAWAERR--WS--EVSEDTGIGNPKKASPEKGK 226

Query: 237 GLLSYFANCFIQLLNDI 253
                  N   QL+ +I
Sbjct: 227 LYFEDATNKVAQLMTEI 243


>gi|261420299|ref|YP_003253981.1| creatininase [Geobacillus sp. Y412MC61]
 gi|319767108|ref|YP_004132609.1| creatininase [Geobacillus sp. Y412MC52]
 gi|261376756|gb|ACX79499.1| Creatininase [Geobacillus sp. Y412MC61]
 gi|317111974|gb|ADU94466.1| Creatininase [Geobacillus sp. Y412MC52]
          Length = 243

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 86/184 (46%), Gaps = 13/184 (7%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  +     K  I ++P+GA E HGPHLP+ TDTI    LAER+   L  ++    +P
Sbjct: 6   ENSFEISNKITKSSIAIMPIGAVEAHGPHLPLCTDTI----LAERLACRLAEKVEGFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ +++    I   + I  ++ K G R   ++N H GN    + + 
Sbjct: 62  VIPYGQVWSLRDFPGSISISNETLIRLLVEIGTSLYKQGFRIWAMVNGHLGNQ---TALK 118

Query: 129 TEARMRFSMLVVSTSWSRFT--IPQGIISFPETE----IGIHGGEIETSMMLALAPHLVK 182
             AR+ +       ++  F   + + +    ETE    +  H  EIETS+ML LA   V 
Sbjct: 119 EAARILYDQFPNFKTFYFFYPGMNKVVNEIRETEAIHSVYFHACEIETSIMLYLAEEYVD 178

Query: 183 MDLA 186
           M  A
Sbjct: 179 MSKA 182


>gi|18309739|ref|NP_561673.1| creatinase [Clostridium perfringens str. 13]
 gi|168209870|ref|ZP_02635495.1| creatininase [Clostridium perfringens B str. ATCC 3626]
 gi|18144417|dbj|BAB80463.1| creatinase [Clostridium perfringens str. 13]
 gi|170711961|gb|EDT24143.1| creatininase [Clostridium perfringens B str. ATCC 3626]
          Length = 251

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 83/179 (46%), Gaps = 18/179 (10%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +KD +++LP+G+ EQHGPHLP   DT+IA G A RI      ++     P    GY  + 
Sbjct: 18  KKDDVIILPIGSTEQHGPHLPTCVDTVIANGFAYRIAE----KINGVVAPALSYGYKSKP 73

Query: 79  M-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTEA 131
           +        GT  L  A      + IID   + G  KI IL+AH  N   +  ++    A
Sbjct: 74  LSGGGPLFPGTIDLNGATLQALVMDIIDEFVRDGFTKIFILSAHFENEAFIVEAMDLCSA 133

Query: 132 RMRFSMLVVSTSWSRFTIPQGI------ISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           +    + ++ T+W     P  I      + FP   +  H    ETS+M+  AP LV+ D
Sbjct: 134 KYGDKVQLLLTNWWDPMSPDVIDKVFDEVPFPGWALE-HAAVTETSLMMYFAPELVRED 191


>gi|170289915|ref|YP_001736731.1| creatininase [Candidatus Korarchaeum cryptofilum OPF8]
 gi|170173995|gb|ACB07048.1| Creatininase [Candidatus Korarchaeum cryptofilum OPF8]
          Length = 229

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 85/168 (50%), Gaps = 11/168 (6%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           ++PLG+ EQHG H P+ TD+++A  LAE        R  V   P    G+S  HM   GT
Sbjct: 1   MIPLGSTEQHGRHAPLGTDSLLAIALAEDASE----RTGVLIAPPIWYGWSPHHMVAPGT 56

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG-GNSPLVSIVSTEAR--MRFSMLVVS 141
            ++     IE     I ++ + G RK V++N H   N P + I S  A+  ++ S+ +  
Sbjct: 57  VSVRPEVLIELLYDAIRSLSRHGFRKFVLINGHRLANLPWIQIASERAQRELKVSIFIFD 116

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENF 189
             +    + + +   P    G HG ++ETS ++   P LV+M+ A+++
Sbjct: 117 PLYMSLDLRKKVDFGP---FG-HGDDMETSHLMHKFPELVRMEEAKDY 160


>gi|160936179|ref|ZP_02083552.1| hypothetical protein CLOBOL_01075 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440989|gb|EDP18713.1| hypothetical protein CLOBOL_01075 [Clostridium bolteae ATCC
           BAA-613]
          Length = 253

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 114/256 (44%), Gaps = 48/256 (18%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +V+LP+G+ E HG H+P+ TDT+I   + + I+        +   P+ P G         
Sbjct: 20  MVILPIGSTECHGRHMPLGTDTLIPDKILDLIEE---KNDNILIAPMIPYGACQSLADYP 76

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  +      ++   I+D + K G RKI++LN HGGN   +  +  E   + +M+V+  
Sbjct: 77  GTINIDSDVLYQYVYQIVDGLYKHGARKILVLNGHGGNIKTIERIGLEFDKKGAMVVMLN 136

Query: 143 SWSRFTIPQGIISF---PETEIGIHGGEIETSMMLALAPHLVKM----------DLAEN- 188
            W        ++++   PE + G HGG  ET+ ++A+ P LV M          +L EN 
Sbjct: 137 WW--------LMAWDMKPEWK-GGHGGGEETAGIMAVDPSLVDMSKIDLPLEMTNLTENL 187

Query: 189 ---------FSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
                    F   + E LRN   +  +     GW   D        +   ATV+ G+ ++
Sbjct: 188 VATGFRTVRFKGVEIEILRNTPKVTDN-----GWIGPD--------HPNTATVEWGQEMV 234

Query: 240 SYFANCFIQLLNDINS 255
              A+  + L+ ++  
Sbjct: 235 QTTADYILDLIEELKK 250


>gi|110801095|ref|YP_695202.1| creatininase [Clostridium perfringens ATCC 13124]
 gi|168204534|ref|ZP_02630539.1| creatininase [Clostridium perfringens E str. JGS1987]
 gi|168214350|ref|ZP_02639975.1| creatininase [Clostridium perfringens CPE str. F4969]
 gi|168217419|ref|ZP_02643044.1| creatininase [Clostridium perfringens NCTC 8239]
 gi|169344486|ref|ZP_02865455.1| creatininase [Clostridium perfringens C str. JGS1495]
 gi|182624093|ref|ZP_02951880.1| creatininase [Clostridium perfringens D str. JGS1721]
 gi|110675742|gb|ABG84729.1| creatininase [Clostridium perfringens ATCC 13124]
 gi|169297406|gb|EDS79515.1| creatininase [Clostridium perfringens C str. JGS1495]
 gi|170663802|gb|EDT16485.1| creatininase [Clostridium perfringens E str. JGS1987]
 gi|170714170|gb|EDT26352.1| creatininase [Clostridium perfringens CPE str. F4969]
 gi|177910709|gb|EDT73069.1| creatininase [Clostridium perfringens D str. JGS1721]
 gi|182380520|gb|EDT77999.1| creatininase [Clostridium perfringens NCTC 8239]
          Length = 251

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 83/179 (46%), Gaps = 18/179 (10%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +KD +++LP+G+ EQHGPHLP   DT+IA G A RI      ++     P    GY  + 
Sbjct: 18  KKDDVIILPIGSTEQHGPHLPTCVDTVIANGFAYRIAE----KINGVVAPALSYGYKSKP 73

Query: 79  M-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTEA 131
           +        GT  L  A      + IID   + G  KI IL+AH  N   +  ++    A
Sbjct: 74  LSGGGPLFPGTIDLNGATLQALVMDIIDEFVRDGFTKIFILSAHFENEAFIVEAMDLCSA 133

Query: 132 RMRFSMLVVSTSWSRFTIPQGI------ISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           +    + ++ T+W     P  I      + FP   +  H    ETS+M+  AP LV+ D
Sbjct: 134 KYGDKVQLLLTNWWDPMSPDVIDKVFDEVPFPGWALE-HAAVTETSLMMYFAPELVRED 191


>gi|260906903|ref|ZP_05915225.1| creatinine amidohydrolase [Brevibacterium linens BL2]
          Length = 268

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 102/230 (44%), Gaps = 18/230 (7%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIK-SILPPRLPVTCMPVEPIGY 74
            D +++LP+GA EQHG  LP++TD+I    +A  +AE +  S   P   V  +P    G 
Sbjct: 30  NDALLILPVGACEQHGDGLPLSTDSIRADHVAMAVAEELAGSTESPNAFV--LPSIDYGV 87

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI-----VST 129
           S  H  + GT +L     ++    +   +   G  +I+++  HGGN   + +     +S+
Sbjct: 88  SPHHGNLPGTVSLDPRTFVDIVTTVAGQLCDSGFTRILVITGHGGNIAALGVAQQVLLSS 147

Query: 130 EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENF 189
              + F+   VS   +  T        P TE+  H GE ETS MLA+   LV        
Sbjct: 148 HPDLAFAYSPVSGLATETT-----AQLPRTEVSGHSGESETSQMLAIDDSLVDSPRLTAG 202

Query: 190 SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           ++   E     +  R   S S   +       GV+G+   ATV  GE +L
Sbjct: 203 ATALDELSPRARLTRTK-SPSSAVTFDRYADNGVLGDPRTATVTAGENIL 251


>gi|160889671|ref|ZP_02070674.1| hypothetical protein BACUNI_02098 [Bacteroides uniformis ATCC 8492]
 gi|317478712|ref|ZP_07937866.1| creatinine amidohydrolase [Bacteroides sp. 4_1_36]
 gi|156860663|gb|EDO54094.1| hypothetical protein BACUNI_02098 [Bacteroides uniformis ATCC 8492]
 gi|316905142|gb|EFV26942.1| creatinine amidohydrolase [Bacteroides sp. 4_1_36]
          Length = 253

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 105/241 (43%), Gaps = 24/241 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI------ 76
           +V+LP GA E H  HLP  TD I+   +A    ++      V CM + P+ +        
Sbjct: 23  VVILPWGATEPHNLHLPYLTDCILPHDIAVDAAALALQNSGVRCMVMPPVPFGAHNPGQR 82

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           E  +   T+  T    +E    I+ ++   G+RK++IL+ HGGN+    ++   A +   
Sbjct: 83  ELPFCIHTRYSTQQAILED---IVASLYAQGMRKLIILSGHGGNN-FKGMIRDLAFVYPD 138

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
            L+++  W     P+    + E  +  H GE ETS+M+   P LV +  A +  S+    
Sbjct: 139 FLIIAADWFSIVPPK---DYFEAVVDDHAGESETSVMMHYHPELVNLAEAGDGESQ---- 191

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGV---VGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                +     +   GW+ +  +   V   VGN   A+ +KGE  +        +L  ++
Sbjct: 192 ----PFAIPSLNEKVGWAPRHWDKATVDSGVGNPKKASAEKGERYMKPVVEKLAKLFTEV 247

Query: 254 N 254
            
Sbjct: 248 G 248


>gi|222478519|ref|YP_002564756.1| Creatininase [Halorubrum lacusprofundi ATCC 49239]
 gi|222451421|gb|ACM55686.1| Creatininase [Halorubrum lacusprofundi ATCC 49239]
          Length = 249

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 105/237 (44%), Gaps = 25/237 (10%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTI-----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           +  +P+G+ EQHGPH P+ TDT+       AG A            V   P  P+G + E
Sbjct: 18  VAFVPVGSTEQHGPHAPLGTDTLNAVAVAEAGAAAYEAVETESSADVVVTPPIPVGVAEE 77

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           H   DGT  ++      +     +++   GI ++V +N HGGN   ++ V+     RFS 
Sbjct: 78  HRAFDGTMWISPDTFRAYVREAAESLPHHGIDRVVFVNGHGGNVEALAEVA----RRFSR 133

Query: 138 LVVSTSWS-RFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD----LAENFSSR 192
                 ++  FT  + +      ++G H G +ET+++ A  P LV+ D      E  + R
Sbjct: 134 DDGHDGYAVAFTWFEAVGEHA-GDMG-HAGPLETALLRATNPDLVREDRIEAAREGAADR 191

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
             E++       AH S  F       +  GVVG+      ++GE LL   ++   +L
Sbjct: 192 WGEWVSGVNL--AHDSDEF-------SDNGVVGDPTAGDAERGEVLLDLASDALAEL 239


>gi|120402608|ref|YP_952437.1| creatininase [Mycobacterium vanbaalenii PYR-1]
 gi|119955426|gb|ABM12431.1| Creatininase [Mycobacterium vanbaalenii PYR-1]
          Length = 247

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 90/235 (38%), Gaps = 18/235 (7%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           AR   + VLP+GA EQHG HLP  TDT++A        +          +P    G S+ 
Sbjct: 16  ARSGAVAVLPVGAIEQHGAHLPTGTDTLLATAAVSAATARTGD----VGLPAVSYGCSLG 71

Query: 78  HM-YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           H  +  GT +L+ +        I   +   G RK+VI+NAH  N P         R  F 
Sbjct: 72  HTAHWPGTLSLSVSTMTALVTDIGRWVYTSGFRKLVIVNAHATNGPPTQGALLTLRHEFP 131

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
            L    +      PQ    +       H    ETSM+L LA  LV +D A +   R +  
Sbjct: 132 SLRTCFASLYDITPQARSGYFSDADDPHANVAETSMLLHLAAGLVALDRAVDEEDRTARR 191

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
           +  +             +M D+   GVVG    A    G  L     +    LL 
Sbjct: 192 VLTY-------------AMPDVTRSGVVGRPTTADAGSGARLFDAIVDGVTHLLR 233


>gi|254479571|ref|ZP_05092885.1| creatininase subfamily protein [Carboxydibrachium pacificum DSM
           12653]
 gi|214034493|gb|EEB75253.1| creatininase subfamily protein [Carboxydibrachium pacificum DSM
           12653]
          Length = 240

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 109/243 (44%), Gaps = 30/243 (12%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +K   V++P+G+ E HG HLP+ TD        + I+  +     V   P  P G S + 
Sbjct: 16  QKSDTVIVPVGSVEAHGHHLPLGTDIFSPRLFCQMIEEKIGDY--VWIAPEIPYGQSYDL 73

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT  +      E+  A+  ++ + G++K++ LN HGGN   +++ S E   +  M 
Sbjct: 74  SVYPGTIHVPSEVLAEYVYAVGKSLYENGLKKLIFLNGHGGNINALNLAS-EKLAQLGMT 132

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           V++ +W      + I++  E +   H GE ETS +L     LV+MD A           +
Sbjct: 133 VLTINW-WLDFSKEILTITEGQ--GHAGEDETSAILYYDERLVQMDKA----------TK 179

Query: 199 NFK------YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           NFK      Y +  G        K L    + G+A  AT +KGE +        ++++ +
Sbjct: 180 NFKKPLYRVYFKDRG--------KILYENAMSGDATLATKEKGEKIFKLLTEKIVEIILN 231

Query: 253 INS 255
           + +
Sbjct: 232 VRN 234


>gi|302339504|ref|YP_003804710.1| creatininase [Spirochaeta smaragdinae DSM 11293]
 gi|301636689|gb|ADK82116.1| Creatininase [Spirochaeta smaragdinae DSM 11293]
          Length = 250

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 79/172 (45%), Gaps = 9/172 (5%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           ++D I+V+P G+ EQHGP   + TD ++   LA+R+      +  V   P  P G    H
Sbjct: 16  KQDPIIVIPTGSTEQHGPQCALGTDFLVPQHLADRVSG----KKNVIVAPAIPFGVCPYH 71

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
           M   G+  + Y         I  ++   G R+ +++N HGGN+P +   + +      ++
Sbjct: 72  MSFAGSIDIGYEGLYTLMSGITRSLMHHGARRFLVINGHGGNNPALDKAALDVYHAGGIM 131

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
                WS   + Q    F     G HG  +ETS M+A+    V + L+ + +
Sbjct: 132 ASIDWWS--VVGQIDERFAN---GGHGDILETSAMMAVDESCVDLSLSRDMA 178


>gi|153814200|ref|ZP_01966868.1| hypothetical protein RUMTOR_00409 [Ruminococcus torques ATCC 27756]
 gi|317499996|ref|ZP_07958232.1| hypothetical protein HMPREF1026_00174 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331087773|ref|ZP_08336699.1| hypothetical protein HMPREF1025_00282 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145848596|gb|EDK25514.1| hypothetical protein RUMTOR_00409 [Ruminococcus torques ATCC 27756]
 gi|316898713|gb|EFV20748.1| hypothetical protein HMPREF1026_00174 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330409754|gb|EGG89190.1| hypothetical protein HMPREF1025_00282 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 247

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 98/224 (43%), Gaps = 18/224 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +V++P+G+ EQHG HLP+ TD  +A  LAE+       +      P    GYS       
Sbjct: 22  VVIVPIGSTEQHGYHLPIGTDVYLAEALAEKTAE----KTGALVYPSIHFGYSWSWRDRI 77

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT T+      E    ++ ++ + G++ ++ +N H  N  ++     E +    + V+  
Sbjct: 78  GTVTIRQDILREILKDVVRSVERYGVKILIFMNGHEANRSVIKYAIREIQDETDVKVLGM 137

Query: 143 SWSRF-TIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA-ENFSSRQSEFLRNF 200
            +     I    +  P      H  E ETS+MLA+ P  V M+ A + +  R + +  + 
Sbjct: 138 FYPGMEEIYDKYMETPTWGGMFHACEFETSLMLAVKPETVHMERAVQEYPVRPTTYGMD- 196

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
                        S+ +L+  G  GN + AT +KGE +L  F  
Sbjct: 197 -----------NTSIGELSVSGTYGNPVPATEEKGEMMLEQFTE 229


>gi|315304988|ref|ZP_07875062.1| creatinine amidohydrolase [Listeria ivanovii FSL F6-596]
 gi|313626642|gb|EFR95701.1| creatinine amidohydrolase [Listeria ivanovii FSL F6-596]
          Length = 249

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 114/254 (44%), Gaps = 25/254 (9%)

Query: 5   IIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +++ D NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +       
Sbjct: 1   MLYADGNSFDIGAKITKTTPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETN 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
              +PV P G         G+ T++     +  + I +++ + G R  V ++ H GN   
Sbjct: 57  AFVLPVLPYGQVWSLQDFPGSLTVSNETVTKMVVEIGESLYRQGFRLFVPVSGHLGNMAA 116

Query: 124 VSIVSTEARMRF-SMLVVSTSWSRFTIPQGIISFPETEIG----IHGGEIETSMMLALAP 178
           +   + E   +F  M+ +   +    I +  +   E +      IH  EIETS+ML L+P
Sbjct: 117 LKDAARELYAKFPDMITLHIFYPN--IQKLAMDVREGKANHHTYIHACEIETSLMLYLSP 174

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHS-FGWSMKDLNPKGVVGNAMDATVKKGEG 237
             V M+ A          + +   L     ++   W  ++     V+G A  AT KKGE 
Sbjct: 175 ENVDMNRA----------IDDPPILPIDADYTPTPW--QNFTKTAVLGEATLATAKKGEY 222

Query: 238 LLSYFANCFIQLLN 251
           L+       ++L+ 
Sbjct: 223 LIEKTLKTCVELIK 236


>gi|296168549|ref|ZP_06850353.1| creatininase [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295896612|gb|EFG76251.1| creatininase [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 261

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 104/240 (43%), Gaps = 49/240 (20%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++PLG+ EQHGPHLP++TDT IA  +A   ++ L     V   P    G S EH    G
Sbjct: 48  ILIPLGSTEQHGPHLPLDTDTRIATAVARGARARLDGDWSVA--PAIAYGASGEHQSFAG 105

Query: 84  TKT----------LTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           T +          L Y  +   W            R++V +N HGGN  + ++ +  +R+
Sbjct: 106 TISIGTDALTLLLLEYGRSAAGW-----------ARRLVFVNGHGGN--VAALAAAISRL 152

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD--LAENFSS 191
           R         W       G           H G  ETS++L ++P  V+ D  LA N   
Sbjct: 153 RDEGR--DAGWCPCEAAGG---------DAHAGHTETSLLLHISPGDVRTDRWLAGN--- 198

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
            +S        LR  G       +  ++P GV+G+   AT ++G  +L+   +  ++ ++
Sbjct: 199 -RSPLPELLPSLRRGG-------VAAVSPVGVLGDPTTATAEEGRRILAEMVDGSVRRVS 250


>gi|307265841|ref|ZP_07547391.1| Creatininase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919116|gb|EFN49340.1| Creatininase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 241

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 104/228 (45%), Gaps = 30/228 (13%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +K  IV++P+G+ E HG HLP+ TD        E I+  +     V   P  P G S + 
Sbjct: 16  KKSDIVIIPVGSVEAHGHHLPLGTDIFSPRLFCEMIERKIGDY--VWIAPEIPYGQSYDL 73

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT  +      E+  A+  ++ + G++K++ LN HGGN   +++ S E  ++  M+
Sbjct: 74  SVYPGTIHVPSEVLAEYVYAVGKSLYENGLKKLIFLNGHGGNINALNLAS-EKLVQLGMV 132

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           V++ +W      + I++  + +   H GE ETS +L     LV+MD A           +
Sbjct: 133 VLTINW-WLDFTKEILTITQGQ--GHAGEDETSAILYYDERLVQMDKA----------TK 179

Query: 199 NFK------YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           N K      Y +  G        K L    + G+A  AT +KGE +  
Sbjct: 180 NLKKPLYRIYFKDRG--------KILYENAMSGDATLATKEKGEKIFE 219


>gi|77919240|ref|YP_357055.1| putative amidase [Pelobacter carbinolicus DSM 2380]
 gi|77545323|gb|ABA88885.1| putative amidase [Pelobacter carbinolicus DSM 2380]
          Length = 239

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 107/259 (41%), Gaps = 27/259 (10%)

Query: 5   IIFTDNSLP-LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +I  D ++P   A   K   V +P GA E+HGPHLP++TDT+ A  +  R    L  R P
Sbjct: 1   MIIEDMTMPEFIAGLEKTRTVYIPFGATEEHGPHLPLSTDTLQAKAVGYR----LAERRP 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLA--IIDAIRKMGIRKIVILNAHGGNS 121
           +   P   + Y +         TLT        L   I+ ++ K G+R  ++L  H G +
Sbjct: 57  IFVAPA--VSYGVCRSTSQHPGTLTITTGTLKALTCDIVASLYKHGLRNFILLTGHAGGT 114

Query: 122 PLVSIVSTEARM--RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
              +++     +  RF+ L ++         +      ET    H GEIETS +L   P 
Sbjct: 115 HNAALIDAGEELLERFADLKIAVLTEYQLAAEEGKGLIETAGDSHAGEIETSRVLYSHPQ 174

Query: 180 LVKMDLAENFSS-RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
           LVK      F S      +RN +           W      P GV G+   AT +KG  +
Sbjct: 175 LVKGQAEREFPSFPMGMLVRNKQKY---------W------PGGVWGDPTKATAQKGAQI 219

Query: 239 LSYFANCFIQLLNDINSFD 257
                +   + ++   +++
Sbjct: 220 ERLVVDALERFVDKFEAWE 238


>gi|319655075|ref|ZP_08009142.1| hypothetical protein HMPREF1013_05765 [Bacillus sp. 2_A_57_CT2]
 gi|317393239|gb|EFV74010.1| hypothetical protein HMPREF1013_05765 [Bacillus sp. 2_A_57_CT2]
          Length = 269

 Score = 69.7 bits (169), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 97/219 (44%), Gaps = 11/219 (5%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++P+G+ EQHG HLP+ TD+ +A  +AE        R      P    G++  HM   G
Sbjct: 24  IIVPVGSVEQHGKHLPLGTDSFVAIKVAEEAGK----RTETLVAPPNWTGWAPHHMAYPG 79

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH-GGNSPLVSIVSTEARMRFSMLVVST 142
           T TL           +  ++   G  KI+I+N H   N P + I  T+ R       +S 
Sbjct: 80  TITLRPETLTNLMYDVCKSLIYHGFEKIIIVNGHREANLPPLKIAITKLRNETGAF-LSI 138

Query: 143 SWSRFTIPQGIISFPETEIG--IHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           +   +   Q      ++E G   H  E+ETS ML L P L +MD A    S +  FL++ 
Sbjct: 139 ADPFYIADQVARKVKKSEPGGVGHAAEMETSHMLFLHPELCEMDKAVKNVSEKHRFLQHD 198

Query: 201 KYL---RAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            ++   R       G   +     G+VG+   +T + GE
Sbjct: 199 PFVEGDRIFVPSDVGVYREGSLNVGIVGDPTVSTKENGE 237


>gi|323485673|ref|ZP_08091011.1| hypothetical protein HMPREF9474_02762 [Clostridium symbiosum
           WAL-14163]
 gi|323695149|ref|ZP_08109288.1| hypothetical protein HMPREF9475_04153 [Clostridium symbiosum
           WAL-14673]
 gi|323401023|gb|EGA93383.1| hypothetical protein HMPREF9474_02762 [Clostridium symbiosum
           WAL-14163]
 gi|323500807|gb|EGB16730.1| hypothetical protein HMPREF9475_04153 [Clostridium symbiosum
           WAL-14673]
          Length = 241

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 102/241 (42%), Gaps = 21/241 (8%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++P GA E +GP LP+ +D+I++  + E +      +      P   +G S       G
Sbjct: 19  VIIPGGAIEVYGPQLPLGSDSIVSKAICEMVAE----KTNAMIGPFIEVGESAALYGFPG 74

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T  +           +++++   G +  + +N H GN P++  +  E +    +      
Sbjct: 75  TIKIMPQTYYLMMRDVMESLIHWGFKNFMFINMHAGNVPIIGQLCREYQRSSGIKCAQID 134

Query: 144 WSRFTIPQGIISFPETEIGIHG--GEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           W RFT P  +     T    HG   E  TS+ML L P  V  DL +    R  E    + 
Sbjct: 135 WWRFTQPNSVGICENTGWMAHGHASECGTSVMLYLHPEYV--DLTKTECIRMPEEYTKYP 192

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
            +  +         +D  P G++G+A   + +KGE ++        + ++ I +F +S F
Sbjct: 193 DIITYT------EFRDKTPNGILGDATIGSREKGEAIVR-------KCVDKIAAFMMSEF 239

Query: 262 D 262
           +
Sbjct: 240 N 240


>gi|225571110|ref|ZP_03780127.1| hypothetical protein CLOHYLEM_07216 [Clostridium hylemonae DSM
           15053]
 gi|225160191|gb|EEG72810.1| hypothetical protein CLOHYLEM_07216 [Clostridium hylemonae DSM
           15053]
          Length = 268

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 82/168 (48%), Gaps = 8/168 (4%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R   + ++P+G+ EQHGP LP+ TD IIA  LAE +       L     PV P G+++ H
Sbjct: 18  RTKKLAIIPVGSTEQHGPALPVGTDWIIAQYLAEMVGKRTDKGL---VTPVIPFGHALYH 74

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT  ++      +   +   +   G    + +N HGGN+  +  V  + R++ ++ 
Sbjct: 75  ADFPGTMAVSQTTLTAYVSEVCQQLISYGFTHFLFINGHGGNNNALYDVGQQLRLQ-NIP 133

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
             +  W  F +  G +      IG HG   ETS+M+ +AP  VK++ A
Sbjct: 134 AANIQW--FEVA-GDLDSKWGLIG-HGDITETSVMMHIAPDTVKVERA 177


>gi|296116067|ref|ZP_06834687.1| creatininase (creatinine amidohydrolase) protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977421|gb|EFG84179.1| creatininase (creatinine amidohydrolase) protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 272

 Score = 69.3 bits (168), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 99/215 (46%), Gaps = 17/215 (7%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVTCMPVEPIGYSIEHMYV 81
           +++LPLG++E  GPH PM  D + A  +A R+      R +     PV P G +     V
Sbjct: 27  VIILPLGSHEDQGPHAPMG-DYLCADAIARRVALATRARGIGTYVAPVLPYGGADYFGSV 85

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            G   L  A        I+  +R+ G+ +I+I N HGGN+  V  V+    MR +  VV 
Sbjct: 86  IGGIALGQATLRAVLTDIMSCLRRNGLTRIIIFNGHGGNAQAVHDVTLS--MRHTHGVVI 143

Query: 142 TSWSRFTIPQGII-------SFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
            S   ++I  G++          E   G HGG   +S+ +AL P LV+ DL    ++   
Sbjct: 144 PSVYLWSIAAGMLPEVMGNRDVAERSAG-HGGNPLSSVAMALFPDLVRPDLLPAPATHPQ 202

Query: 195 EFL----RNFKYLRAHGSH-SFGWSMKDLNPKGVV 224
           +F+      F   R  GS   F   + ++  +GV+
Sbjct: 203 QFMGLPVNGFATARFEGSSIHFPLEIDEIATQGVM 237


>gi|168184781|ref|ZP_02619445.1| creatininase [Clostridium botulinum Bf]
 gi|229587299|ref|YP_002860337.1| creatininase [Clostridium botulinum Ba4 str. 657]
 gi|182672183|gb|EDT84144.1| creatininase [Clostridium botulinum Bf]
 gi|229260238|gb|ACQ51275.1| creatininase [Clostridium botulinum Ba4 str. 657]
          Length = 248

 Score = 69.3 bits (168), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 109/250 (43%), Gaps = 26/250 (10%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS----ILPP 60
           I + D + P+  +   +  +VLP+G  EQHGPHLP++ D  I   + +++      ++ P
Sbjct: 6   INYLDQTSPVVMELLNNNSLVLPVGTIEQHGPHLPLSVDIDITVDICKKLCCRKNWVMGP 65

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           ++      +   G   +     GT ++     I++++ II +  +MG++ + I+N H  N
Sbjct: 66  QIMYAARSLPQSGGGSD---FPGTISINGKVLIDYFVDIISSFCQMGLKNLYIINGHYEN 122

Query: 121 SPLVSIVSTEARMRF---SMLVVSTSWSRFTIPQGI-ISFPETEIGI---HGGEIETSMM 173
              +       R R     M +V+ SW      + I   F    +G    H G +ETS+M
Sbjct: 123 EAFIFEAIEICRQRNLLKGMSIVALSWWSAIDDEFIKKKFNNNFVGWHAEHAGFVETSLM 182

Query: 174 LALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVK 233
           L L P  V+  + E  S+           +   G + +    KD N  G + ++  AT K
Sbjct: 183 LYLRPEKVRF-INEECSN-----------IPMAGIYYYSDEKKDENANGTLSSSKGATSK 230

Query: 234 KGEGLLSYFA 243
            GE    +  
Sbjct: 231 AGEEFFDHIC 240


>gi|253570804|ref|ZP_04848212.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251839753|gb|EES67836.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 254

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 105/249 (42%), Gaps = 41/249 (16%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC--MPVEPIG------- 73
           + +LP GA E H  HLP  TD I++  +A         R  V C  MP   +G       
Sbjct: 22  LAILPWGAIEPHNLHLPYLTDCILSHDIAVDAALKAWERYGVRCMVMPFVSMGSQNPGQR 81

Query: 74  ---YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
              + +   Y      LT          ++ ++   G+R++VI+N HGGNS   +++   
Sbjct: 82  ELPFCVHSRYETQKAILT---------DVVSSLYTQGMRRLVIVNGHGGNS-FKNMIRDL 131

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
           +      L+ S+ W R    Q     P    G H  E+ETS+ML     +V M+LA N  
Sbjct: 132 SVDYPDFLIASSEWFRVLPVQDYFECP----GDHADEVETSVMLHYHSEMVDMELAGN-- 185

Query: 191 SRQSEFLRNFKYLRAHGSHSFGW---SMKDLNPKGVVGNAMDATVKKG----EGLLSYFA 243
            + + F  N   LR     +  W   + + ++    +GN   AT  KG    E +   +A
Sbjct: 186 GKYTPFAIN--SLRT----NVAWIPRNWQKVSTDTGIGNPQSATANKGKRFAEAISERYA 239

Query: 244 NCFIQLLND 252
             F +L+ D
Sbjct: 240 QLFKELVRD 248


>gi|290790290|pdb|3LUB|A Chain A, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790291|pdb|3LUB|B Chain B, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790292|pdb|3LUB|C Chain C, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790293|pdb|3LUB|D Chain D, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790294|pdb|3LUB|E Chain E, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790295|pdb|3LUB|F Chain F, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790296|pdb|3LUB|G Chain G, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790297|pdb|3LUB|H Chain H, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790298|pdb|3LUB|I Chain I, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790299|pdb|3LUB|J Chain J, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790300|pdb|3LUB|K Chain K, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790301|pdb|3LUB|L Chain L, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
          Length = 254

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 93/223 (41%), Gaps = 24/223 (10%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI------ 76
           +++LP GA E H  HLP  TD I+   +A     +   R  V C    P+ +        
Sbjct: 23  VIILPWGATEPHNLHLPYLTDCILPHDIAVEAAELALSRSGVRCXVXPPVPFGAHNPGQR 82

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           E  +   T+  T    +E    I+ ++   G RK++IL+ HGGN+     +   A     
Sbjct: 83  ELPFCIHTRYATQQAILED---IVSSLHVQGFRKLLILSGHGGNN-FKGXIRDLAFEYPD 138

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
            L+ + +W     P+G     E EI  H GE ETS+     P LV +  A +  S+    
Sbjct: 139 FLIAAANWFEVVSPKGYF---EAEIDDHAGESETSVXXHYHPELVNLAEAGDGESK---- 191

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGV---VGNAMDATVKKGE 236
                +  A  +    W  +  +   V   VGN   AT +KGE
Sbjct: 192 ----PFAIASLNEKVAWVPRHWDKATVDSGVGNPKKATAEKGE 230


>gi|28211518|ref|NP_782462.1| creatininase [Clostridium tetani E88]
 gi|28203959|gb|AAO36399.1| creatininase [Clostridium tetani E88]
          Length = 251

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 82/181 (45%), Gaps = 18/181 (9%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           + +KD +++LP+G+ EQHGPHLP   DT++A G A RI      ++     P    GY  
Sbjct: 16  EKKKDNVIILPIGSTEQHGPHLPTCVDTVLANGFAYRIAE----KIDGVVAPALSYGYKS 71

Query: 77  EHM-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
           + +        GT  L  A      + I+D   + G  KI +L+AH  N   +       
Sbjct: 72  KPLSGGGPLFPGTIDLNGATLQALIMDIVDEFVRDGFTKIFLLSAHFENEAFIVEAMDLC 131

Query: 132 RMRF--SMLVVSTSWSRFTIPQGI------ISFPETEIGIHGGEIETSMMLALAPHLVKM 183
             ++   + ++ T+W     P  I      + FP   +  H    ETS+M+  AP LV+ 
Sbjct: 132 SQKYGDKVQILLTNWWDPMSPDVIDKIFTEVPFPGWALE-HAAVTETSLMMYFAPELVRE 190

Query: 184 D 184
           D
Sbjct: 191 D 191


>gi|298384194|ref|ZP_06993754.1| amidase [Bacteroides sp. 1_1_14]
 gi|298262473|gb|EFI05337.1| amidase [Bacteroides sp. 1_1_14]
          Length = 254

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 105/249 (42%), Gaps = 41/249 (16%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC--MPVEPIG------- 73
           + +LP GA E H  HLP  TD I++  +A         R  V C  MP   +G       
Sbjct: 22  LAILPWGAIEPHNLHLPYLTDCILSHDIAVDAALKAWERYGVRCMVMPFVSMGSQNPGQR 81

Query: 74  ---YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
              + +   Y      LT          ++ ++   G+R++VI+N HGGNS   +++   
Sbjct: 82  ELPFCVHSRYETQKAILT---------DVVSSLYTQGMRRLVIVNGHGGNS-FKNMIRDL 131

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
           +      L+ S+ W R    Q     P    G H  E+ETS+ML     +V M+LA N  
Sbjct: 132 SVDYPDFLIASSEWFRVLPVQDYFECP----GDHADEVETSVMLHYHSEMVDMELAGN-- 185

Query: 191 SRQSEFLRNFKYLRAHGSHSFGW---SMKDLNPKGVVGNAMDATVKKG----EGLLSYFA 243
            + + F  N   LR     +  W   + + ++    +GN   AT  KG    E +   +A
Sbjct: 186 GKYTPFAIN--SLRT----NVAWVPRNWQKVSTDTGIGNPQSATANKGKRFAEAISERYA 239

Query: 244 NCFIQLLND 252
             F +L+ D
Sbjct: 240 QLFKELVRD 248


>gi|212224470|ref|YP_002307706.1| Hypothetical amidase [Thermococcus onnurineus NA1]
 gi|212009427|gb|ACJ16809.1| Hypothetical amidase [Thermococcus onnurineus NA1]
          Length = 238

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 107/235 (45%), Gaps = 29/235 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS-ILPPRLPVTCMPVEPIGYSIEHMYVD 82
           V++P+G+ E HG HLP+ TD      L  R++  +      V   P  PI Y   H +V 
Sbjct: 21  VLIPVGSVEAHGRHLPLGTDVFAPLELCRRVEERVRNAGKDVLIAP--PIWYG--HTFVL 76

Query: 83  GTKTLT---YAEAIEHWL-AIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSM 137
                T    A+A + ++  +I    + G +++V++N HGGN  PL+      A    + 
Sbjct: 77  NVYPGTIDVRADAFKAYVREVISEFVEEGFKRVVLMNGHGGNVYPLIEAAEEVAESYPNA 136

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA--ENFSSRQSE 195
            +   +W      + I+S   ++   H G+ ETS+MLA+ P LVKMD A  E  +SR   
Sbjct: 137 EIWLINWW-IDFREDILSICSSQ--GHAGQDETSVMLAIRPELVKMDKAVGEKRTSRVRV 193

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
             ++                ++L P GV  +   AT + GE +L   +    +LL
Sbjct: 194 IRKDIG--------------RELFPDGVNDDPGSATRENGEAILGVISEKIARLL 234


>gi|331699420|ref|YP_004335659.1| Creatininase [Pseudonocardia dioxanivorans CB1190]
 gi|326954109|gb|AEA27806.1| Creatininase [Pseudonocardia dioxanivorans CB1190]
          Length = 241

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 104/235 (44%), Gaps = 28/235 (11%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           DAR    +V+P+G+ EQHGPHLP++TD  IA  +A  + +  P    +   P    G + 
Sbjct: 14  DARP--TLVVPVGSVEQHGPHLPLDTDVRIADAVAAGLLAAEP---ALVVAPAVAYGAAG 68

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EH    GT ++ + EA+   L            +++ +N HGGN  + ++V     +R+ 
Sbjct: 69  EHEGFPGTVSIGH-EALRSLLVEYGRSACRWAARLLFVNGHGGN--VATLVEAVDLLRYE 125

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
              V           G I         H G  ETS++ ALAP  V+ D A   ++  +  
Sbjct: 126 GRDV-----------GWIPCAAPGADAHAGRTETSLLAALAPDAVRGDRAAPGAT--APL 172

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                 LRA G+ +       ++  GV+G+   A+  +G  LL+   +  +  L 
Sbjct: 173 AELLPALRAGGTAA-------VSANGVLGDPTGASGDEGRALLATVVDTALAALR 220


>gi|324997220|ref|ZP_08118332.1| hypothetical protein PseP1_00584 [Pseudonocardia sp. P1]
          Length = 239

 Score = 68.9 bits (167), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 108/244 (44%), Gaps = 32/244 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV+P+G+ EQHGPHLP+ TDT+ A+ LA  +    P    +   P    G + EH    G
Sbjct: 18  VVVPVGSVEQHGPHLPLGTDTLFASVLAAALHDADP---ELVLAPALAYGAAGEHEGFPG 74

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T ++   EA+   L            ++V++N HGGN  + ++ S    +R+       +
Sbjct: 75  TVSIGE-EALRTVLVEYGRSACRWASRLVLVNGHGGN--VAALRSAVTLLRYEGR--DAA 129

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN-FKY 202
           W   + P      P   +  H G  ETS++  + P LV+ + A    +R    LR     
Sbjct: 130 WLPCSAP-----VPGVPLDAHAGRYETSLLEHVDPALVRREHAAAGDTRP---LREVIGE 181

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFD 262
           LRA G       +  ++P GV+G+   A+  +G  +L+           D  S  +  +D
Sbjct: 182 LRAGG-------VAAVSPNGVLGDPSGASAAEGGRVLTAIV--------DAASAAIDAWD 226

Query: 263 KDVQ 266
            D +
Sbjct: 227 PDPE 230


>gi|253700699|ref|YP_003021888.1| creatininase [Geobacter sp. M21]
 gi|251775549|gb|ACT18130.1| Creatininase [Geobacter sp. M21]
          Length = 239

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 101/237 (42%), Gaps = 26/237 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V +P G+ E+HG HLP++TDTI A  + +R       R+P+   P    G         G
Sbjct: 21  VYIPFGSVEEHGSHLPLSTDTIEAYEVGKRAAE----RIPLFVAPPVHYGSCRSTSCHPG 76

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM-----RFSML 138
           T +++ A        I+ ++   G+   + L  H G S  +++      +       +M 
Sbjct: 77  TISISTATLKSLLKDIVRSLHSHGLTNFIALTGHAGGSHKMALQDAGEELIRELPEINMA 136

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           VV+          G+I   ET    H GEIETS ++   PHLVK      + S  +  L 
Sbjct: 137 VVTEYDLAKEAGAGLI---ETRGDAHAGEIETSRIMHSHPHLVKGLAEAEYPSFPTGILV 193

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
             K        SF W      P GV G+   AT KKG  L S  A+  ++L+  + S
Sbjct: 194 RDK-------RSF-W------PGGVWGDPGKATAKKGRQLESLVADKVVELVKTLES 236


>gi|197118520|ref|YP_002138947.1| creatinine amidohydrolase superfamily protein [Geobacter
           bemidjiensis Bem]
 gi|197087880|gb|ACH39151.1| creatinine amidohydrolase superfamily protein [Geobacter
           bemidjiensis Bem]
          Length = 239

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 101/237 (42%), Gaps = 26/237 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V +P G+ E+HG HLP++TDTI A  + +R       R+P+   P    G         G
Sbjct: 21  VYIPFGSVEEHGSHLPLSTDTIEAYEVGKRAAE----RIPLFVAPPIHYGSCRSTSCHPG 76

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM-----RFSML 138
           T +++ A        I+ ++   G+   + L  H G S  +++      +       +M 
Sbjct: 77  TVSISTATLKSLLKDIVRSLHAHGLTNFIALTGHAGGSHKMALQDAGEELIRELPEINMA 136

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           VV+          GII   ET    H GEIETS ++   PHLVK      + S  +  L 
Sbjct: 137 VVTEYDLAKEAGAGII---ETRGDAHAGEIETSRIMHSHPHLVKGLAEAEYPSFPTGILV 193

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
             K        SF W      P GV G+   AT KKG  L S  A+  ++L+  + S
Sbjct: 194 RDK-------RSF-W------PGGVWGDPGKATAKKGRMLESLVADKVVELVKALES 236


>gi|313127445|ref|YP_004037715.1| hypothetical protein Hbor_27250 [Halogeometricum borinquense DSM
           11551]
 gi|312293810|gb|ADQ68270.1| uncharacterized protein, putative amidase [Halogeometricum
           borinquense DSM 11551]
          Length = 248

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 93/209 (44%), Gaps = 24/209 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +  LP+G+ EQHGPH P+ TD   A  +A+           V   P  PIG + EH    
Sbjct: 20  LAFLPVGSTEQHGPHAPLGTDAFTAEAVADAGSEAYDGE--VVVAPTLPIGVAAEHRQFP 77

Query: 83  GTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
           GT  L   T+ + +   +A   ++   G  ++V++N HGGN+  +  V+           
Sbjct: 78  GTLWLSPDTFRDTVRETVA---SLASHGFDRVVVVNGHGGNTDALREVTGTITREDDAYA 134

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           V+ +W         +    +++G HGG +ET+++  +AP  V+ +  E      ++   +
Sbjct: 135 VAFTWFE------AVGEHSSKMG-HGGPLETALLRHVAPESVREERIETAREGGADRWGD 187

Query: 200 F--KYLRAHGSHSFGWSMKDLNPKGVVGN 226
           +  K   AH S  F          GVVG+
Sbjct: 188 WVSKVNLAHDSAEF-------TANGVVGD 209


>gi|315505371|ref|YP_004084258.1| creatininase [Micromonospora sp. L5]
 gi|315411990|gb|ADU10107.1| Creatininase [Micromonospora sp. L5]
          Length = 273

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 81/172 (47%), Gaps = 17/172 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI-----KSILPPRLPVTCMPVEPIGYSIE 77
           + VLP+GA E HGPHLP+ TD I+A G A  +     +++L P  P    P +   +   
Sbjct: 34  LAVLPVGAVEWHGPHLPIGTDLILAEGFAGELATGSARAVLFPATPYAACPGQTRPWP-- 91

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTEARMRF 135
                GT  L    A+ +   ++  I + G  +++++N H  N   V  ++     R R 
Sbjct: 92  -----GTVALRPEIAVGYLADVLAGIVEAGFTRVLVVNGHDANMSTVRAAMEWVSGRHRA 146

Query: 136 SMLVVSTSWSRFTIPQGIIS-FPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
           SM++V  +W +   P      F E     HGG  E+S +L   P  V++D A
Sbjct: 147 SMMLV--NWFQLVGPDETTEMFGELPARGHGGAYESSAVLGFDPAAVRLDAA 196


>gi|323486686|ref|ZP_08092007.1| hypothetical protein HMPREF9474_03758 [Clostridium symbiosum
           WAL-14163]
 gi|323400067|gb|EGA92444.1| hypothetical protein HMPREF9474_03758 [Clostridium symbiosum
           WAL-14163]
          Length = 248

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/239 (28%), Positives = 109/239 (45%), Gaps = 11/239 (4%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M+ LII       L A+     + ++P+G+ EQHGP+    TD   AA  AE++   +  
Sbjct: 1   MDKLIINNMTWPELEAEMEHIKVALVPVGSCEQHGPNTTFATDAARAAAYAEKLA--VRC 58

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIID-AIRKMGIRKIVILNAHGG 119
           +  V   P    G S+ HM   GT TL   E + H L  I  +I + GIRKI+ LNAHGG
Sbjct: 59  KNKVVVFPCVNYGLSLHHMDFPGTVTLQ-VETMMHLLVDIGVSIAQHGIRKILFLNAHGG 117

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N P +       +    +    ++        G+   P  ++  H  E+ETS  L L P 
Sbjct: 118 NFPALEGAVISLKQNHEIDAYWSAVGSEISLGGLTGLP--KLNGHACEVETSSCLYLCPE 175

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            V+ +        Q   L +  +++  G  ++ W   D +  G +G+A  AT + G+ +
Sbjct: 176 TVRSERVPGII--QDSMLTHDSFVK--GGAAWSWK-NDASLNGALGDARKATYEIGKKM 229


>gi|170289672|ref|YP_001736488.1| creatininase [Candidatus Korarchaeum cryptofilum OPF8]
 gi|170173752|gb|ACB06805.1| Creatininase [Candidatus Korarchaeum cryptofilum OPF8]
          Length = 248

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 86/180 (47%), Gaps = 20/180 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           + +LP+G  E HGPHLP+ TD +    IA  LAER+ +++ P          PI Y +  
Sbjct: 23  LAILPVGVCEAHGPHLPLGTDFLIPEWIALNLAERLNALIAP----------PINYGVTL 72

Query: 79  MYVDGTKTLTYAEAIEHWL---AIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  TL  +E+    L    ++D +R  G  K++++N HGG+  + +I     R   
Sbjct: 73  GLTGYFGTLRVSESTMESLMYDVLVDLMRN-GFEKVIVMNGHGGSGQVEAISRAMRRAWL 131

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK--MDLAENFSSRQ 193
              + S   + + + + +        G H G  ET+M+L + P LVK  M+  E + +R+
Sbjct: 132 DYGLKSAMINWWNLARDLTEEIFGGSGGHAGVDETAMILEIDPSLVKGEMEREEIYRTRE 191


>gi|171912648|ref|ZP_02928118.1| Creatininase [Verrucomicrobium spinosum DSM 4136]
          Length = 263

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 102/236 (43%), Gaps = 27/236 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEP-IGYSIEHMYV 81
           +++LP+GA EQHGPHLP++TDT+IA    +   ++       T  PV P +GYS+   + 
Sbjct: 35  VLLLPVGAMEQHGPHLPLHTDTVIAESTCQLASAL-------TGAPVLPALGYSVSLGHT 87

Query: 82  ---DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM- 137
               GT +L +   +     I       G  +++I+N+H GN    ++     R+R  + 
Sbjct: 88  VKWPGTFSLFHETLMLTVREIAQWAADTGWNRLLIVNSHYGND--AALRCAVDRLRHDLG 145

Query: 138 --LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
             L+ +T  +    P+    F       H  E ETS+ML L P  V  +           
Sbjct: 146 GNLLTATRNTWDLTPEIAGRFTHDAADWHANEAETSLMLFLDPAAVVKERLSTADDPDRT 205

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
               F +  AH S         LN  GV G     TV++G  L+S   +    L+ 
Sbjct: 206 MGCVFPHRVAHTS---------LN--GVTGRPSLGTVEQGALLISRMGDALADLIQ 250


>gi|117165069|emb|CAJ88622.1| putative creatinase [Streptomyces ambofaciens ATCC 23877]
          Length = 273

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 117/256 (45%), Gaps = 27/256 (10%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS----ILPPRL 62
           + D + P    A +   +V P+G  EQHGPHLP++ D  I   LA ++ +    +L P  
Sbjct: 11  YGDLTSPEVPRALRGATLVWPVGGLEQHGPHLPLSVDMDIPEALARQVAAEVGGLLLPGQ 70

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           PV+   +   G     ++  GT  L  A  + +    + A+ ++G+ ++V++N H  N  
Sbjct: 71  PVSARSLPQSGGG---LHFPGTVHLGGATFLAYLTDCLTALSRLGLGRLVVINGHYENEG 127

Query: 123 LV--SIVSTEARMRF--SMLVVSTSWSRFT---IPQGIISFPETEIGIHGGEIETSMMLA 175
           L+  +I        F  + +V  + WS  T   + + I  FP      H G  ETS+M+ 
Sbjct: 128 LLFEAIDGCAPGTVFPDTEVVAFSWWSLVTEDWLGEHIPRFPGWHA-EHAGLTETSLMMY 186

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           L P +V+ +   + S   +   R+               +  ++ +GV+ +A  A+V+ G
Sbjct: 187 LRPEVVRAERPSHASPPPAGVYRHPV------------DVGKISNQGVLSSATGASVELG 234

Query: 236 EGLLSYFANCFIQLLN 251
           E L  +  +  ++LL 
Sbjct: 235 ERLFWHLVDGIVELLG 250


>gi|284046552|ref|YP_003396892.1| creatininase [Conexibacter woesei DSM 14684]
 gi|283950773|gb|ADB53517.1| Creatininase [Conexibacter woesei DSM 14684]
          Length = 245

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 80/163 (49%), Gaps = 9/163 (5%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +VVLP+GA EQHGPHL    DT+ A  +A    +       V   P  P G S  H+   
Sbjct: 22  VVVLPIGATEQHGPHLVTAMDTLAAEAVAAAGAARATRPERVVLAPTLPFGASHHHLPFG 81

Query: 83  GTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
           GT +LT A  + H LA ++++    G R++++LN HGGNS   +  + +A     ++V +
Sbjct: 82  GTLSLT-AATLAHVLADLLESAAASGARRLLLLNGHGGNSATCAQAAADAARLHGIVVAA 140

Query: 142 TSWSRFTIPQGIIS--FPETEIGIHGGEIETSMMLALAPHLVK 182
             +       G     FP      H G  ETS+M AL P  V+
Sbjct: 141 ADYWALAPVDGAWGEHFPG-----HAGAFETSLMGALRPDGVR 178


>gi|313127299|ref|YP_004037569.1| hypothetical protein Hbor_25700 [Halogeometricum borinquense DSM
           11551]
 gi|312293664|gb|ADQ68124.1| uncharacterized protein, putative amidase [Halogeometricum
           borinquense DSM 11551]
          Length = 252

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 104/237 (43%), Gaps = 29/237 (12%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           V+ +GA EQHGPHLP+  DT+    LA RI   L         P    G S  HM   GT
Sbjct: 29  VVAVGAIEQHGPHLPLIMDTLAGDELARRIAEKLGDAF---AAPTIRPGCSGHHMEFPGT 85

Query: 85  KTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            T+   T  + I  +   +D   + G   I ++  HGGN   V+ V+ E        VV+
Sbjct: 86  ITVPPETLMDVIRSYCRSLD---EHGFEHIALVPTHGGNFAPVNTVAPEIGREIDANVVA 142

Query: 142 TS-------WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
            +         +  +  G + + E+   IH G +ET+M+LA+   LV+ D     +    
Sbjct: 143 VADLHEYMDRQKAGLHAGGVEYEESV--IHAGAVETAMVLAVDEGLVRTD---ELAVGHE 197

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
             +   + L      S G++   +   GV+G+   AT + GE +    A+ +++ + 
Sbjct: 198 GEVSTARLL------SDGFA--SITENGVLGDPRAATAEAGEEIFEAVADAYVERIE 246


>gi|238926578|ref|ZP_04658338.1| creatininase [Selenomonas flueggei ATCC 43531]
 gi|238885524|gb|EEQ49162.1| creatininase [Selenomonas flueggei ATCC 43531]
          Length = 251

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 100/240 (41%), Gaps = 23/240 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
            VL +GA E HG HL    DTI++  L + I   L   L    +P  P+GYS  +     
Sbjct: 21  AVLAVGACEAHGQHLAEGCDTIVSYKLGKAIADELGDML---VLPPIPVGYSGHYDSFPF 77

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF--SMLVVS 141
           T TL Y    +    I++++ + GI  I+I+N H GN   + + S + + ++  + +   
Sbjct: 78  TLTLQYDTVTQVIYDIVESVLRNGIDTILIINGHDGNIAPIEVASRKIKEKYPGARIAAL 137

Query: 142 TSW---SRFTIPQGIISFPETEIGI-HGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
             W   +   +P+G     E   G+ H GE ETS+   L P   + + A     +    L
Sbjct: 138 DQWWVTAGELLPKGTF---EVWNGLGHAGEGETSIAYYLFPEWCEPEQATCRVPKNLPEL 194

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
              K           W   +L      G+A   T +KGE +         + +  +++ D
Sbjct: 195 MGIK-----------WDFSELTNTAQTGDATKGTAEKGEKMFKVLIEYCTKTIKALDAVD 243


>gi|284043671|ref|YP_003394011.1| creatininase [Conexibacter woesei DSM 14684]
 gi|283947892|gb|ADB50636.1| Creatininase [Conexibacter woesei DSM 14684]
          Length = 256

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 75/162 (46%), Gaps = 8/162 (4%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           D +  + +GA EQHGPHLPM TDT IA  L   + + +   +P+   PV   G S  H+ 
Sbjct: 20  DAVGFVAIGATEQHGPHLPMGTDTEIARALTRAVGARVA--VPLAATPVISCGLSDHHLG 77

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR---FSM 137
             GT +L+         A +  + +MG+R++ +++ HGGN   +   +     R    ++
Sbjct: 78  FPGTISLSEETVAGVLDAHLAGLARMGVRRVALVSGHGGNFAFLGRYAQRCGERHPDLAV 137

Query: 138 LVVSTSWS---RFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           +     W+     T               H G++ETS+ LA+
Sbjct: 138 VAFDDLWAFLEAMTAAGRAHGLDPVACDSHAGQLETSVALAI 179


>gi|291561148|emb|CBL39947.1| Uncharacterized protein, putative amidase [butyrate-producing
           bacterium SS3/4]
          Length = 242

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 98/228 (42%), Gaps = 33/228 (14%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPV---TCMPVEPIGYSI 76
           V++P GA E +GP LPM +D I    IA  +AE+  +++ P +     + +   P  +++
Sbjct: 23  VIIPTGACEIYGPQLPMGSDLIAAKRIAELVAEKTGALIAPTIEAGESSALASFPCTFAM 82

Query: 77  EHMYVDGTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                         + +E WL  ++  + K G +  V +  H GN   V+ +  +     
Sbjct: 83  PR------------KILEDWLDWLVGKLIKDGAKNFVFITGHAGNVDTVNYIGKKYMNEH 130

Query: 136 SMLVVSTSWSRFTIPQG--IISFPETEIGIHGGEIETSMMLALAPHLVKMD-LAENFSSR 192
            + +V   W RFT   G  I  +       H  E  TS+ + L P LV MD L+      
Sbjct: 131 DIKLVQIDWWRFTNANGSDIFQYSGQMAHGHASECGTSVFMYLFPELVDMDELSRVEPLP 190

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
            SEF     + R            +  P G +G+A  AT +KGE +++
Sbjct: 191 ASEFPDFIGFQR----------FTEKTPNGTIGDATVATKEKGEKIVT 228


>gi|266622793|ref|ZP_06115728.1| putative creatinine amidohydrolase [Clostridium hathewayi DSM
           13479]
 gi|288865456|gb|EFC97754.1| putative creatinine amidohydrolase [Clostridium hathewayi DSM
           13479]
          Length = 252

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 96/233 (41%), Gaps = 19/233 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA E HGPH+ ++ D  I      R+ +       +  MP  P+G         
Sbjct: 21  VCLLPLGAIEAHGPHMKLDVDNHICEEQCRRVCA----ETGIILMPTIPVGQVWSLNRFP 76

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF---SMLV 139
           GT TL+Y   I     ++ + RK G   + I + H GN P V     E    F    M++
Sbjct: 77  GTLTLSYHTLIAVIKDLLYSFRKRGFELVFIHSHHYGNVPAVKQAVRECYDEFRDMKMVI 136

Query: 140 VSTSWSRFTIPQGIISFPETE-IGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           +    S     + + + P    +  H  E+ETS  L   P  V M+ A        +F  
Sbjct: 137 LEERQSMRDKAKEVCTSPFAHPVFWHACEVETSQALECCPDRVYMERA---ICDYPKFPE 193

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
           +F       S    W   ++   GV+G+A   T +KG+ L     N  ++L+ 
Sbjct: 194 DF------DSTPTYWD--EVTSTGVMGDAKAGTKEKGKVLTEAEVNAMVRLVT 238


>gi|332799950|ref|YP_004461449.1| Creatininase [Tepidanaerobacter sp. Re1]
 gi|332697685|gb|AEE92142.1| Creatininase [Tepidanaerobacter sp. Re1]
          Length = 239

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 105/240 (43%), Gaps = 28/240 (11%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           K  I +LP+GA E HGPHLP+ TD      LAER+   +  ++    +P    G      
Sbjct: 17  KKPIAILPIGAVEAHGPHLPIGTDNY----LAERLSRKVAEKVDALVLPTFSYGQVWSLR 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS--- 136
            V G+  ++          I  ++ K G+R  VI+N H GN   ++ +   AR  +    
Sbjct: 73  NVPGSINVSNEHLTGVLTDIGKSLYKFGVRYFVIINTHVGN---MTAIKEAARNLYDFYK 129

Query: 137 ----MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA-ENFSS 191
                  +    ++ T  +   S P      H  EIETS ML LAP  VKMD A ++F  
Sbjct: 130 DLKVFYFIYPGTAKIT-KEVRESKPMPGGYFHACEIETSYMLYLAPDYVKMDKALDDF-- 186

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
              +   +F+Y          W   ++    V+G+A  AT +KG+ ++       +++L 
Sbjct: 187 --PDLPEDFEYTPT------PWD--EITDTIVLGSATLATEEKGQKIIDVAVETIVKILE 236


>gi|118616559|ref|YP_904891.1| creatinine amidohydrolase [Mycobacterium ulcerans Agy99]
 gi|118568669|gb|ABL03420.1| Creatinine amidohydrolase [Mycobacterium ulcerans Agy99]
          Length = 250

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 103/239 (43%), Gaps = 39/239 (16%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP----VEPIGY--SIE 77
           +++PLG+ EQHGPHLP++TDT IA  +   + + +  RL   C P      PI Y  S E
Sbjct: 30  ILIPLGSTEQHGPHLPLDTDTRIATAVGRAVATRMHGRL-TQCQPGWLLAPPIAYGASGE 88

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           H    GT ++  AEA+   L            ++V +N HGGN   +     + R     
Sbjct: 89  HQSFAGTISIG-AEALRVLLLEYGRSAACWADRLVFVNGHGGNVEALRGAVRQLRAEGR- 146

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD-LAENFSSRQSEF 196
                 WS      G           H G  ETS++L ++P +V  D L+   ++  +E 
Sbjct: 147 ---DAGWSACGSAGG---------DAHAGHTETSVLLHISPEVVLTDRLSAGNAAPLAEL 194

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           L + +             +  ++P GV+G+   AT  +G          F ++++D  S
Sbjct: 195 LPSLRR----------GGVAAVSPIGVLGDPTTATAVEGR-------RIFAEMVDDCVS 236


>gi|16804684|ref|NP_466169.1| hypothetical protein lmo2647 [Listeria monocytogenes EGD-e]
 gi|224499320|ref|ZP_03667669.1| hypothetical protein LmonF1_06347 [Listeria monocytogenes Finland
           1988]
 gi|224503707|ref|ZP_03672014.1| hypothetical protein LmonFR_14609 [Listeria monocytogenes FSL
           R2-561]
 gi|254830920|ref|ZP_05235575.1| hypothetical protein Lmon1_06149 [Listeria monocytogenes 10403S]
 gi|16412147|emb|CAD00860.1| lmo2647 [Listeria monocytogenes EGD-e]
          Length = 249

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 86/182 (47%), Gaps = 9/182 (4%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +    +     +P
Sbjct: 6   ENSFDIGAKITKTKPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----KTDGFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ TL+     +  + I +++ K G R  V ++ H GN   +   +
Sbjct: 62  VLPYGQVWSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAA 121

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG----IHGGEIETSMMLALAPHLVKMD 184
            E   +F  +V+   +    I +  +   E +      IH  EIETS+ML L+P    M 
Sbjct: 122 RELYAKFPDMVILHIFYP-NIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENTDMS 180

Query: 185 LA 186
            A
Sbjct: 181 RA 182


>gi|327311762|ref|YP_004338659.1| Creatininase [Thermoproteus uzoniensis 768-20]
 gi|326948241|gb|AEA13347.1| Creatininase [Thermoproteus uzoniensis 768-20]
          Length = 243

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 101/235 (42%), Gaps = 20/235 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY-- 80
           + VLP+G  E HGPHLP+ TD ++A      I            + + PI Y   ++   
Sbjct: 18  VAVLPVGVVEAHGPHLPLGTDALMA------IYVAERAAEEAGALLLPPIWYGTTYVLDR 71

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT +++       +  +   + + G++ +V++N HGGN   + + + +      M +V
Sbjct: 72  FPGTISISAETLYRLYRDVFAEVARNGVKNLVVVNGHGGNIDALRMAAKDVARSADMTIV 131

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
             +W      +      ET  G H  E ETS ++A  PHLVK         R ++     
Sbjct: 132 VVNWWIDLAKEARRRVLETPEG-HAAEDETSEVIAAYPHLVKA------VPRDADEWVEM 184

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           +Y   +G  ++    + +  K V G    A+ +KGE +L         L+ D+ +
Sbjct: 185 RYA-VYGRRAY----EAMYAKAVQGYPSRASREKGEEILRAAVEELKSLILDLKA 234


>gi|292494059|ref|YP_003533201.1| probable amidase [Haloferax volcanii DS2]
 gi|291369251|gb|ADE01481.1| probable amidase [Haloferax volcanii DS2]
          Length = 246

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 86/185 (46%), Gaps = 9/185 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVTCMPVEPIGYSIEHMYV 81
            VVLP GA EQH  HLP + D+I A  L   + +  P   L +  +PV P GYS  H+  
Sbjct: 27  FVVLPCGATEQHSTHLPTSVDSIRAENLTAELAAAAPEHDLNLLVLPVLPYGYSEHHINY 86

Query: 82  DGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
            GT +L   TY E I   + +  ++++ G  + ++ N HGGN+    +     +    + 
Sbjct: 87  AGTISLGADTYQEII---IDVGRSVQRHGGTRFLVANFHGGNTEPHKLALDRLQRDHGLD 143

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
                W+ F   Q    F  TE G H GE ETS++    P LV+ D     + +    +R
Sbjct: 144 SYYAHWTDFARDQLEARFG-TEWG-HAGEYETSVIEHCHPDLVRGDRKTPQTKKNRYEVR 201

Query: 199 NFKYL 203
            + + 
Sbjct: 202 QYAHF 206


>gi|20807500|ref|NP_622671.1| uncharacterized protein, putative amidase [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516029|gb|AAM24275.1| uncharacterized protein, putative amidase [Thermoanaerobacter
           tengcongensis MB4]
          Length = 240

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 108/243 (44%), Gaps = 30/243 (12%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +K   V++P+G+ E HG HLP+ TD        + I+  +     V   P  P G S + 
Sbjct: 16  QKSDTVIVPIGSVEAHGHHLPLGTDIFSPRLFCQMIEEKIGDY--VWIAPEIPYGQSYDL 73

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT  +      E+  A+  ++ +  ++K++ LN HGGN   +++ S E   +  M 
Sbjct: 74  SVYPGTIHVPSEVLAEYVYAVGKSLYENELKKLIFLNGHGGNINALNLAS-EKLAQLGMT 132

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           V++ +W      + I++  E +   H GE ETS +L     LV+MD A           +
Sbjct: 133 VLTINW-WLDFSKEILTITEGQ--GHAGEDETSAILYYDERLVQMDKA----------TK 179

Query: 199 NFK------YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           NFK      Y +  G        K L    + G+A  AT +KGE +        ++++ +
Sbjct: 180 NFKKPLYRVYFKDRG--------KILYENAMSGDATLATKEKGEKIFKLLTEKIVEIILN 231

Query: 253 INS 255
           + +
Sbjct: 232 VRN 234


>gi|239826882|ref|YP_002949506.1| creatininase [Geobacillus sp. WCH70]
 gi|239807175|gb|ACS24240.1| Creatininase [Geobacillus sp. WCH70]
          Length = 243

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 85/184 (46%), Gaps = 13/184 (7%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  +     K  I ++P+GA E HGPHLP+ TDTI    LAER+   L  ++    +P
Sbjct: 6   ENSFEIGKKITKSRIAIMPIGAVEAHGPHLPLCTDTI----LAERLAYRLAEKVEGFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
             P G         G+ +++    I   + I   + K G R   ++N H GN    + + 
Sbjct: 62  AMPYGQVWSLRDFPGSISISNETLIRFLVEIGKNLYKQGFRIWAMVNGHLGNQ---TALK 118

Query: 129 TEARMRFSMLVVSTSWSRFT--IPQGIISFPETE----IGIHGGEIETSMMLALAPHLVK 182
             AR+ +        +  F   + + +    ET+    +  H  EIETS+ML LA   V+
Sbjct: 119 EAARVLYDQFPDFKIFYFFYPGMNKIVNEIRETDSVHPVYFHACEIETSIMLYLAEEYVE 178

Query: 183 MDLA 186
           M+ A
Sbjct: 179 MNKA 182


>gi|37527772|ref|NP_931117.1| hypothetical protein plu3916 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787208|emb|CAE16288.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 256

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 86/179 (48%), Gaps = 29/179 (16%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTII----AAGLAERIKSILPPRLPVTCMPVEPIGYSIEH- 78
           ++ P+G  EQHGPHLP+N D++I    A  LAE I     P  PV+   +   G  +E  
Sbjct: 33  LIWPIGGIEQHGPHLPLNVDSVIPEAFARVLAEDINGFTLPVQPVSARSLPQSGGGLEFP 92

Query: 79  --MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTEARMR 134
             +Y+DG+    Y          I ++  +  +++VI+N H  N   +  ++ +  A   
Sbjct: 93  GTVYLDGSTFTAYIS------RTIKSLCSLPFKQLVIINGHFENEGFIFEAVDALRAEGH 146

Query: 135 F---SMLV------VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           F   S++V      VS  W+R    + ++ FP      H G  ETS+ML L P LV+ +
Sbjct: 147 FNDRSVIVFSWWSLVSDDWTR----EHLVDFPGWH-AEHAGLTETSLMLHLRPDLVRAE 200


>gi|87307228|ref|ZP_01089373.1| hypothetical protein DSM3645_16935 [Blastopirellula marina DSM
           3645]
 gi|87289968|gb|EAQ81857.1| hypothetical protein DSM3645_16935 [Blastopirellula marina DSM
           3645]
          Length = 266

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 113/256 (44%), Gaps = 42/256 (16%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI---------KSILPPRLPV---TCMPVE 70
           + VLPLGA E H  HLP  TD      + ERI         K +L P +P    T M   
Sbjct: 24  VAVLPLGATEPHNLHLPYGTDMYEGTVIGERICAAAHQQGAKVVLLPTMPYGTETNMNQF 83

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKM---GIRKIVILNAHGGNS--PLVS 125
           P+  ++         TL        +L + D ++ +   GIRK+V+LN+HGGN   PL+ 
Sbjct: 84  PLAMNV------NPSTL--------FLLVTDLVKSLVESGIRKVVLLNSHGGNEFKPLLR 129

Query: 126 IV--STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
            +   TEA++         +W R   P+      E  +  H GE+ETS+++A   HLV+ 
Sbjct: 130 ELYGKTEAQLFLC------NWFRILSPEDYYEIFE-HMDDHAGEMETSLIMACQGHLVEK 182

Query: 184 DLAENFSSRQ-SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           +     ++   S+    F+ L+  G  S       L      G    +T +KGE LL   
Sbjct: 183 NADGTLNADAGSQRAMQFEALQ-QGWVSITRPWHLLTTNSGSGYPHASTAEKGEKLLEKM 241

Query: 243 ANCFIQLLNDINSFDV 258
                + L ++++ ++
Sbjct: 242 TERLAKFLVELSAAEI 257


>gi|260911249|ref|ZP_05917850.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260634622|gb|EEX52711.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 260

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 111/255 (43%), Gaps = 37/255 (14%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKS-------ILPPRLPVTCMPVE- 70
           +VVLP GA E H  HLP  TD I    IA   A+R+ S       ++PP    +  P + 
Sbjct: 22  LVVLPWGATEPHNYHLPYLTDCILSHDIAVDAAQRLLSKHGMHAMVMPPVTMGSQNPGQR 81

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
            + + +   Y      LT          I+D++   G RK+VI+N HGGN+   S++   
Sbjct: 82  ELPFCVHTRYETQKAILT---------DIVDSLYHQGFRKLVIVNGHGGNT-FKSMIRDL 131

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
                  L+ ++ W +    +     P    G H  EIETS+M+   P LV  +LA+   
Sbjct: 132 LTRYPDFLIAASDWFKMRKAKDFFDNP----GDHADEIETSVMMHYHPELV--NLAKAGE 185

Query: 191 SRQSEF-LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
           ++ + F +   +  R     ++    KD      +G+   +T +KG+       + ++  
Sbjct: 186 AKSNAFAIDALQEGRVWMPRNWTKVSKDTG----IGSPALSTAEKGKRFADAVCDAYVDF 241

Query: 250 LNDINSFDVSIFDKD 264
             D     +S+ D+D
Sbjct: 242 FADF----ISVKDED 252


>gi|16801857|ref|NP_472125.1| hypothetical protein lin2796 [Listeria innocua Clip11262]
 gi|16415332|emb|CAC98022.1| lin2796 [Listeria innocua Clip11262]
 gi|313622182|gb|EFR92724.1| creatinine amidohydrolase [Listeria innocua FSL J1-023]
          Length = 249

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 109/249 (43%), Gaps = 24/249 (9%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +P
Sbjct: 6   ENSFDIGAKITKTKPVLLPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETDGFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ TL+     +  + I +++ K G R  V ++ H GN   +   +
Sbjct: 62  VLPYGQVWSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAA 121

Query: 129 TEARMRF-SMLVVSTSWSRFTIPQGIISFPETEIG----IHGGEIETSMMLALAPHLVKM 183
            E   +F  M+V+   +    I +  +   E +      IH  EIETS+ML L+P    M
Sbjct: 122 RELYAKFPDMIVLHIFYPN--IQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADM 179

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHS-FGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
                     S  + +   L      +   W  ++     V+G A  AT +KGE L+   
Sbjct: 180 ----------SRAIDDPPILPIDADFTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKT 227

Query: 243 ANCFIQLLN 251
               ++L+ 
Sbjct: 228 LKTCVELIK 236


>gi|161527730|ref|YP_001581556.1| creatininase [Nitrosopumilus maritimus SCM1]
 gi|160339031|gb|ABX12118.1| Creatininase [Nitrosopumilus maritimus SCM1]
          Length = 240

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 109/224 (48%), Gaps = 22/224 (9%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           RK  + V+P+G+ EQHGPHLP++TDT I   ++E+I      +     +P    G S EH
Sbjct: 18  RKRQVAVIPIGSIEQHGPHLPISTDTDIVTAVSEKI----CEKNGYLLLPTLSYGVSFEH 73

Query: 79  M-YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             + + +   T  E +     I  ++ +  I+ + I+N H GN    SI + + +++   
Sbjct: 74  APFFNLSIRKTTLETV--LTDICVSLLENKIKTVFIINGHHGNQN--SIKNIDVKLK--- 126

Query: 138 LVVSTSWSRFTI-PQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
                S +R  + P     +   +   H G +ETS+MLA++ + VKM LA+     +   
Sbjct: 127 ---KISKNRLEVFPFSYWHYMGRDFD-HAGFVETSLMLAVSKN-VKMKLAKKGLITEKMT 181

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
            +  K +    + SF  + K+    GV G+   A+ K G+ +L+
Sbjct: 182 KQEIKKVVKLATKSFPKATKN----GVWGDPTKASKKDGQEILA 221


>gi|78222868|ref|YP_384615.1| creatininase [Geobacter metallireducens GS-15]
 gi|78194123|gb|ABB31890.1| Creatininase [Geobacter metallireducens GS-15]
          Length = 239

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 106/249 (42%), Gaps = 36/249 (14%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY-SIE 77
           ++   V +P G+ E+HG HLP++TDTI A  + ++        L ++     PI Y S  
Sbjct: 16  KRTRTVFVPFGSVEEHGCHLPLSTDTIQAYEVGKKAA------LQISLFVAPPIHYGSCR 69

Query: 78  HMYVD-GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM--- 133
                 GT ++T A        I+ ++   G+R  +IL  H G S  +++      +   
Sbjct: 70  STSCHPGTISITTATLKCLMKDIVRSLYAQGMRNFIILTGHAGGSHRMALQDAGEELLPE 129

Query: 134 ----RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENF 189
               R +++      SR    +GII   ETE   H GEIETS +L   PHLV+      F
Sbjct: 130 IPDIRIAVVTEYELASREG--KGII---ETEGDAHAGEIETSRILHTHPHLVQGRGEREF 184

Query: 190 SSRQSEFL-RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
            S  +  L RN +           W      P GV G+   AT +KG+ L        ++
Sbjct: 185 PSFPTGILVRNKRKY---------W------PNGVWGDPAKATAEKGKRLEELVVKKIVE 229

Query: 249 LLNDINSFD 257
           L   +  F 
Sbjct: 230 LAAALEQFQ 238


>gi|302868248|ref|YP_003836885.1| creatininase [Micromonospora aurantiaca ATCC 27029]
 gi|302571107|gb|ADL47309.1| Creatininase [Micromonospora aurantiaca ATCC 27029]
          Length = 273

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 81/172 (47%), Gaps = 17/172 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI-----KSILPPRLPVTCMPVEPIGYSIE 77
           + VLP+GA E HGPHLP+ TD I+A G A  +     +++L P  P    P +   +   
Sbjct: 34  LAVLPVGAVEWHGPHLPIGTDLILAEGFAGELATGSARAVLFPATPYAACPGQTRPWP-- 91

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTEARMRF 135
                GT  L    A+ +   ++  I + G  +++++N H  N   V  ++     R R 
Sbjct: 92  -----GTVALRPEIAVGYLADVLAGIVEAGFTRVLVVNGHDANMSTVRAAMEWVSGRHRA 146

Query: 136 SMLVVSTSWSRFTIPQGIIS-FPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
           SM++V  +W +   P      F +     HGG  E+S +L   P  V++D A
Sbjct: 147 SMMLV--NWFQLVGPDETAEMFGDLPARGHGGAYESSAVLGFDPAAVRLDAA 196


>gi|254514973|ref|ZP_05127034.1| creatininase [gamma proteobacterium NOR5-3]
 gi|219677216|gb|EED33581.1| creatininase [gamma proteobacterium NOR5-3]
          Length = 487

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 83/168 (49%), Gaps = 6/168 (3%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           K  +V++P+ + EQH  HLP+ TD I      ER K I   R  +   P+   G S  HM
Sbjct: 233 KTDLVIIPIASLEQHAAHLPIGTDFINGV---ERAKLIAQQR-DLLVAPILMAGQSPYHM 288

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              G+ TL     ++  L  ++++ + G ++ +I+NAHGGN  + + +  +     + + 
Sbjct: 289 GFAGSVTLKAQTIVDVHLQAVESLIQHGFKRFIIMNAHGGNRAISTYLVDQINQTTAGVA 348

Query: 140 VSTSWS-RFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
           VS   + R  +    ++     +  HGG  ETS  L L P LV++D A
Sbjct: 349 VSYGEAVRPFLAPSTVALSNV-LDRHGGTGETSNSLYLMPDLVQLDKA 395


>gi|294777862|ref|ZP_06743306.1| creatininase [Bacteroides vulgatus PC510]
 gi|294448316|gb|EFG16872.1| creatininase [Bacteroides vulgatus PC510]
          Length = 251

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 81/172 (47%), Gaps = 14/172 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +V+LP GA E H  HLP  TD I++  +A     +      + CM +  I    ++    
Sbjct: 22  LVLLPWGATEPHNLHLPYLTDCILSHDIALDAAKLAKTHYGIRCMVMPYITAGSQN---P 78

Query: 83  GTKTLTYA-----EAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           G + L +      E  +  L+ I+ ++   G RK+VI+N HGGN+   S++   +     
Sbjct: 79  GQRELDFCIHYRYETQKAILSDIVASLYAQGYRKMVIINGHGGNT-FKSMIRDLSLDYPD 137

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
            L+ S+ W  F   +     P    G H  E+ETS+M+   P LV +D A N
Sbjct: 138 FLIASSEWFAFVPAKEYFDEP----GDHADELETSVMMHYHPELVNLDEAGN 185


>gi|15607835|ref|NP_215209.1| hypothetical protein Rv0695 [Mycobacterium tuberculosis H37Rv]
 gi|15840100|ref|NP_335137.1| hypothetical protein MT0722 [Mycobacterium tuberculosis CDC1551]
 gi|31791879|ref|NP_854372.1| hypothetical protein Mb0714 [Mycobacterium bovis AF2122/97]
 gi|121636616|ref|YP_976839.1| hypothetical protein BCG_0744 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148660470|ref|YP_001281993.1| hypothetical protein MRA_0703 [Mycobacterium tuberculosis H37Ra]
 gi|148821900|ref|YP_001286654.1| hypothetical protein TBFG_10709 [Mycobacterium tuberculosis F11]
 gi|167967934|ref|ZP_02550211.1| hypothetical protein MtubH3_07813 [Mycobacterium tuberculosis
           H37Ra]
 gi|215402478|ref|ZP_03414659.1| hypothetical protein Mtub0_02058 [Mycobacterium tuberculosis
           02_1987]
 gi|215410249|ref|ZP_03419057.1| hypothetical protein Mtub9_02770 [Mycobacterium tuberculosis
           94_M4241A]
 gi|215425936|ref|ZP_03423855.1| hypothetical protein MtubT9_05941 [Mycobacterium tuberculosis T92]
 gi|215429535|ref|ZP_03427454.1| hypothetical protein MtubE_02305 [Mycobacterium tuberculosis
           EAS054]
 gi|215444817|ref|ZP_03431569.1| hypothetical protein MtubT_02395 [Mycobacterium tuberculosis T85]
 gi|218752346|ref|ZP_03531142.1| hypothetical protein MtubG1_02395 [Mycobacterium tuberculosis GM
           1503]
 gi|219556545|ref|ZP_03535621.1| hypothetical protein MtubT1_04255 [Mycobacterium tuberculosis T17]
 gi|224989088|ref|YP_002643775.1| hypothetical protein JTY_0714 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253797637|ref|YP_003030638.1| hypothetical protein TBMG_00708 [Mycobacterium tuberculosis KZN
           1435]
 gi|254231016|ref|ZP_04924343.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|254363643|ref|ZP_04979689.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|260185576|ref|ZP_05763050.1| hypothetical protein MtubCP_06030 [Mycobacterium tuberculosis
           CPHL_A]
 gi|260199704|ref|ZP_05767195.1| hypothetical protein MtubT4_06150 [Mycobacterium tuberculosis T46]
 gi|260203865|ref|ZP_05771356.1| hypothetical protein MtubK8_06089 [Mycobacterium tuberculosis K85]
 gi|289442095|ref|ZP_06431839.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289446254|ref|ZP_06435998.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A]
 gi|289552951|ref|ZP_06442161.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289568638|ref|ZP_06448865.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289573303|ref|ZP_06453530.1| conserved hypothetical protein [Mycobacterium tuberculosis K85]
 gi|289744419|ref|ZP_06503797.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289749202|ref|ZP_06508580.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289752743|ref|ZP_06512121.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gi|289756783|ref|ZP_06516161.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|289760821|ref|ZP_06520199.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|294996189|ref|ZP_06801880.1| hypothetical protein Mtub2_17221 [Mycobacterium tuberculosis 210]
 gi|297633193|ref|ZP_06950973.1| hypothetical protein MtubK4_03675 [Mycobacterium tuberculosis KZN
           4207]
 gi|297730173|ref|ZP_06959291.1| hypothetical protein MtubKR_03730 [Mycobacterium tuberculosis KZN
           R506]
 gi|298524187|ref|ZP_07011596.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|306774805|ref|ZP_07413142.1| hypothetical protein TMAG_02577 [Mycobacterium tuberculosis
           SUMu001]
 gi|306781462|ref|ZP_07419799.1| hypothetical protein TMBG_03390 [Mycobacterium tuberculosis
           SUMu002]
 gi|306783346|ref|ZP_07421668.1| hypothetical protein TMCG_03507 [Mycobacterium tuberculosis
           SUMu003]
 gi|306787715|ref|ZP_07426037.1| hypothetical protein TMDG_02420 [Mycobacterium tuberculosis
           SUMu004]
 gi|306794482|ref|ZP_07432784.1| hypothetical protein TMEG_02068 [Mycobacterium tuberculosis
           SUMu005]
 gi|306796448|ref|ZP_07434750.1| hypothetical protein TMFG_03366 [Mycobacterium tuberculosis
           SUMu006]
 gi|306802308|ref|ZP_07438976.1| hypothetical protein TMHG_03722 [Mycobacterium tuberculosis
           SUMu008]
 gi|306806518|ref|ZP_07443186.1| hypothetical protein TMGG_03714 [Mycobacterium tuberculosis
           SUMu007]
 gi|306966716|ref|ZP_07479377.1| hypothetical protein TMIG_01602 [Mycobacterium tuberculosis
           SUMu009]
 gi|306970909|ref|ZP_07483570.1| hypothetical protein TMJG_02441 [Mycobacterium tuberculosis
           SUMu010]
 gi|307078637|ref|ZP_07487807.1| hypothetical protein TMKG_03981 [Mycobacterium tuberculosis
           SUMu011]
 gi|313657500|ref|ZP_07814380.1| hypothetical protein MtubKV_03720 [Mycobacterium tuberculosis KZN
           V2475]
 gi|1806161|emb|CAB06458.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv]
 gi|13880250|gb|AAK44951.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551]
 gi|31617466|emb|CAD93576.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97]
 gi|121492263|emb|CAL70730.1| Conserved hypothetical protein [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|124600075|gb|EAY59085.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|134149157|gb|EBA41202.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148504622|gb|ABQ72431.1| hypothetical protein MRA_0703 [Mycobacterium tuberculosis H37Ra]
 gi|148720427|gb|ABR05052.1| conserved hypothetical protein [Mycobacterium tuberculosis F11]
 gi|224772201|dbj|BAH25007.1| hypothetical protein JTY_0714 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253319140|gb|ACT23743.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           1435]
 gi|289415014|gb|EFD12254.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289419212|gb|EFD16413.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A]
 gi|289437583|gb|EFD20076.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289537734|gb|EFD42312.1| conserved hypothetical protein [Mycobacterium tuberculosis K85]
 gi|289542392|gb|EFD46040.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289684947|gb|EFD52435.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289689789|gb|EFD57218.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289693330|gb|EFD60759.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gi|289708327|gb|EFD72343.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|289712347|gb|EFD76359.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|298493981|gb|EFI29275.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|308216698|gb|EFO76097.1| hypothetical protein TMAG_02577 [Mycobacterium tuberculosis
           SUMu001]
 gi|308325760|gb|EFP14611.1| hypothetical protein TMBG_03390 [Mycobacterium tuberculosis
           SUMu002]
 gi|308331842|gb|EFP20693.1| hypothetical protein TMCG_03507 [Mycobacterium tuberculosis
           SUMu003]
 gi|308335628|gb|EFP24479.1| hypothetical protein TMDG_02420 [Mycobacterium tuberculosis
           SUMu004]
 gi|308337245|gb|EFP26096.1| hypothetical protein TMEG_02068 [Mycobacterium tuberculosis
           SUMu005]
 gi|308343109|gb|EFP31960.1| hypothetical protein TMFG_03366 [Mycobacterium tuberculosis
           SUMu006]
 gi|308346994|gb|EFP35845.1| hypothetical protein TMGG_03714 [Mycobacterium tuberculosis
           SUMu007]
 gi|308350974|gb|EFP39825.1| hypothetical protein TMHG_03722 [Mycobacterium tuberculosis
           SUMu008]
 gi|308355570|gb|EFP44421.1| hypothetical protein TMIG_01602 [Mycobacterium tuberculosis
           SUMu009]
 gi|308359529|gb|EFP48380.1| hypothetical protein TMJG_02441 [Mycobacterium tuberculosis
           SUMu010]
 gi|308363433|gb|EFP52284.1| hypothetical protein TMKG_03981 [Mycobacterium tuberculosis
           SUMu011]
 gi|323720919|gb|EGB29985.1| hypothetical protein TMMG_03402 [Mycobacterium tuberculosis
           CDC1551A]
 gi|326905083|gb|EGE52016.1| hypothetical protein TBPG_03010 [Mycobacterium tuberculosis W-148]
 gi|328457418|gb|AEB02841.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           4207]
          Length = 251

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 77/171 (45%), Gaps = 28/171 (16%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVT-----CMPVEPIGYSIE 77
           +V+PLG+ EQHGPHLP++TDT IA  +A  + + L    LP+        P    G S E
Sbjct: 30  IVIPLGSTEQHGPHLPLDTDTRIATAVARTVTARLHAEDLPIAQEEWLMAPAIAYGASGE 89

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN----SPLVSIVSTEARM 133
           H    GT ++   EA+   L           R++V +N HGGN    +  V ++  E R 
Sbjct: 90  HQRFAGTISIG-TEALTMLLVEYGRSAACWARRLVFVNGHGGNVGALTRAVGLLRAEGR- 147

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
                     W   T P G           H G  ETS++L L+P  V+ +
Sbjct: 148 -------DAGWCPCTCPGG---------DPHAGHTETSVLLHLSPADVRTE 182


>gi|254168221|ref|ZP_04875067.1| creatininase subfamily [Aciduliprofundum boonei T469]
 gi|254168421|ref|ZP_04875266.1| creatininase subfamily [Aciduliprofundum boonei T469]
 gi|289595839|ref|YP_003482535.1| Creatininase [Aciduliprofundum boonei T469]
 gi|197622702|gb|EDY35272.1| creatininase subfamily [Aciduliprofundum boonei T469]
 gi|197622730|gb|EDY35299.1| creatininase subfamily [Aciduliprofundum boonei T469]
 gi|289533626|gb|ADD07973.1| Creatininase [Aciduliprofundum boonei T469]
          Length = 239

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 107/226 (47%), Gaps = 29/226 (12%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +K  +V+LP+G+ E HG HLP+NTD +    LAE I      R+    +P    G++   
Sbjct: 19  KKQPLVILPVGSVEAHGHHLPLNTDMLQPLWLAEEIAK----RINALILPPIHYGWTQGL 74

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI-VSTEARMR--- 134
               GT ++++         I+  + K  IRKI++L+ H   + + ++ ++ E  ++   
Sbjct: 75  SSFPGTISISFDSLRGFVKDILSEVAKHEIRKIMVLSGHASTNHMAALRLACEDVLKEYK 134

Query: 135 -FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
              ++++S  +  +     ++  PE +   H G IETS ++A+ P LVK           
Sbjct: 135 DLKIMLLSDYYIAYQYRGKLV--PEDD--SHAGIIETSRIMAIRPELVK----------- 179

Query: 194 SEFLRNFKYLRAH-GSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
               +N+K+ + H G ++     K++ P     N   A+ + GE L
Sbjct: 180 ----KNYKFKKNHAGKYTVQVDYKEMVPYATFSNPEGASKELGEKL 221


>gi|313631741|gb|EFR98941.1| creatinine amidohydrolase [Listeria seeligeri FSL N1-067]
 gi|313636090|gb|EFS01970.1| creatinine amidohydrolase [Listeria seeligeri FSL S4-171]
          Length = 249

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 109/249 (43%), Gaps = 24/249 (9%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +P
Sbjct: 6   ENSFDIGAKITKTTPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETNAFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ T++     +  + I +++ + G R  V ++ H GN   +   +
Sbjct: 62  VLPYGQVWSLQDFPGSLTVSNETVTKMVVEIGESLYRQGFRLFVPVSGHLGNMAALKDAA 121

Query: 129 TEARMRF-SMLVVSTSWSRFTIPQGIISFPETEIG----IHGGEIETSMMLALAPHLVKM 183
            E   +F  M+ +   +    I +  +   E +      IH  EIETS+ML L+P    M
Sbjct: 122 RELYAKFPDMITLHIFYPN--IQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADM 179

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHS-FGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
             A          + +   L     ++   W  ++     V+G A  AT +KGE L+   
Sbjct: 180 TRA----------IDDPPILPIDADYTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKT 227

Query: 243 ANCFIQLLN 251
               ++L+ 
Sbjct: 228 LKTCVELIK 236


>gi|254549655|ref|ZP_05140102.1| hypothetical protein Mtube_04200 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
          Length = 251

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 77/171 (45%), Gaps = 28/171 (16%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL-PPRLPVT-----CMPVEPIGYSIE 77
           +V+PLG+ EQHGPHLP++TDT IA  +A  + + L    LP+        P    G S E
Sbjct: 30  IVIPLGSTEQHGPHLPLDTDTRIATAVARTVTARLHADDLPIAQEEWLMAPAIAYGASGE 89

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN----SPLVSIVSTEARM 133
           H    GT ++   EA+   L           R++V +N HGGN    +  V ++  E R 
Sbjct: 90  HQRFAGTISIG-TEALTMLLVEYGRSAACWARRLVFVNGHGGNVGALTRAVGLLRAEGR- 147

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
                     W   T P G           H G  ETS++L L+P  V+ +
Sbjct: 148 -------DAGWCPCTCPGG---------DPHAGHTETSVLLHLSPADVRTE 182


>gi|212695261|ref|ZP_03303389.1| hypothetical protein BACDOR_04801 [Bacteroides dorei DSM 17855]
 gi|212662171|gb|EEB22745.1| hypothetical protein BACDOR_04801 [Bacteroides dorei DSM 17855]
          Length = 251

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 77/178 (43%), Gaps = 26/178 (14%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV------------E 70
           +V+LP GA E H  HLP  TD I++  +A     +      + CM +             
Sbjct: 22  LVLLPWGATEPHNLHLPYLTDCILSHDIALDAAKMAKTHYGIRCMVLPYVTAGSQNPGQR 81

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
            + + I + Y      L+          I+ ++   G RK+VI+N HGGN+   S++   
Sbjct: 82  ELDFCIHYRYETQKAILS---------DIVASLYAQGYRKMVIINGHGGNT-FKSMIRDL 131

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
           +      L+ S+ W  F   +     P    G H  E+ETS+M+   P LV +D A N
Sbjct: 132 SLDYPDFLIASSEWFAFVPAKEYFDEP----GDHADELETSVMMHYHPELVNLDEAGN 185


>gi|47097130|ref|ZP_00234698.1| creatinine amidohydrolase, putative [Listeria monocytogenes str.
           1/2a F6854]
 gi|254829096|ref|ZP_05233783.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|254899902|ref|ZP_05259826.1| hypothetical protein LmonJ_08811 [Listeria monocytogenes J0161]
 gi|254912892|ref|ZP_05262904.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254937273|ref|ZP_05268970.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|284800467|ref|YP_003412332.1| hypothetical protein LM5578_0213 [Listeria monocytogenes 08-5578]
 gi|284993653|ref|YP_003415421.1| hypothetical protein LM5923_0213 [Listeria monocytogenes 08-5923]
 gi|47014497|gb|EAL05462.1| creatinine amidohydrolase, putative [Listeria monocytogenes str.
           1/2a F6854]
 gi|258601507|gb|EEW14832.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|258609879|gb|EEW22487.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|284056029|gb|ADB66970.1| hypothetical protein LM5578_0213 [Listeria monocytogenes 08-5578]
 gi|284059120|gb|ADB70059.1| hypothetical protein LM5923_0213 [Listeria monocytogenes 08-5923]
 gi|293590892|gb|EFF99226.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 249

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 85/182 (46%), Gaps = 9/182 (4%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +P
Sbjct: 6   ENSFDIGAKITKTKPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETDGFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ TL+     +  + I +++ K G R  V ++ H GN   +   +
Sbjct: 62  VLPYGQVWSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAA 121

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG----IHGGEIETSMMLALAPHLVKMD 184
            E   +F  +V+   +    I +  +   E +      IH  EIETS+ML L+P    M 
Sbjct: 122 RELYAKFPDMVILHIFYP-NIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENTDMS 180

Query: 185 LA 186
            A
Sbjct: 181 RA 182


>gi|225388074|ref|ZP_03757798.1| hypothetical protein CLOSTASPAR_01808 [Clostridium asparagiforme
           DSM 15981]
 gi|225045875|gb|EEG56121.1| hypothetical protein CLOSTASPAR_01808 [Clostridium asparagiforme
           DSM 15981]
          Length = 326

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 118/261 (45%), Gaps = 39/261 (14%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS--- 75
           +++ I++LP+G+ E HG H     DT +   +AE++           C   +PI +    
Sbjct: 39  KENDILILPIGSTECHGAHACYGEDTFLVTRMAEQVAK------KTGCTVSQPIWFGSHP 92

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR-MR 134
             HM + GT  +      ++   ++      G RKI++LN HG    + + +   AR  +
Sbjct: 93  YHHMGMPGTIPINENTFCDYIAQVLAGFWNAGYRKIILLNGHGQEYVIPTAIHQFARKYQ 152

Query: 135 FSMLVVSTSWSRFTIPQGI-ISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAEN-- 188
              ++++ +W  + IP+ + +  P+ +      H  E ETS  LAL P ++ M+ A +  
Sbjct: 153 VPAVMMNVNW-YYAIPEYLKVGDPKCKFETPFNHADEQETSFSLALFPEMIHMEDAPDTD 211

Query: 189 ---------FSSRQSEFLRNFKYLRAHGSHSFGWSMKDL-NPKGVVGNAMDATVKKG--- 235
                      +  + + R  K+      H+   +++ + NP+GVVG A  AT  K    
Sbjct: 212 LHTFLPPGHIDNAGNIYGRAVKWY----CHAGAGTIEVVGNPEGVVGKAKLATAGKAIPA 267

Query: 236 -EGLLSYFANCFIQLLNDINS 255
            E LL Y      +L+NDI+ 
Sbjct: 268 TEALLDYLE----KLVNDIHE 284


>gi|332653303|ref|ZP_08419048.1| creatininase subfamily [Ruminococcaceae bacterium D16]
 gi|332518449|gb|EGJ48052.1| creatininase subfamily [Ruminococcaceae bacterium D16]
          Length = 243

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 102/244 (41%), Gaps = 19/244 (7%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++P G+ E +GPHLPM TD + A G+AERI      R      P   +G S        
Sbjct: 16  VIIPTGSCEIYGPHLPMGTDLLAAQGIAERIAQ----RTGFLIAPAIEMGESSALRAFPC 71

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T  +      ++   ++  +   G+++IV L  H GN   VS ++ +      +      
Sbjct: 72  TFAMPRHILEDYLDFLVGKLVSDGVKRIVFLTGHAGNVDTVSYIAKKYLHTHGLQSCQID 131

Query: 144 WSRF--TIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS-SRQSEFLRNF 200
           W RF  T   GI++   +    H  E  TS+ML L P LV    A   +      F    
Sbjct: 132 WWRFARTHSDGILTNTGSMAHGHASECGTSVMLHLYPDLVDRRSALPVTVPTDDAFPDVI 191

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
           +Y          +S +  N  G +G A DA+ +KG  L+       +  L  +  +D+++
Sbjct: 192 QYAP--------FSARTEN--GCIGAAADASAEKGAQLVEVCVERILAYLETV--WDITV 239

Query: 261 FDKD 264
              D
Sbjct: 240 APGD 243


>gi|14601098|ref|NP_147624.1| hypothetical protein APE_0954 [Aeropyrum pernix K1]
 gi|5104623|dbj|BAA79938.1| conserved hypothetical protein [Aeropyrum pernix K1]
          Length = 237

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 76/155 (49%), Gaps = 12/155 (7%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM--PVEPIGYSIEHMYVD 82
           VLP G+ EQH   LP+ TD ++A   A     +L     V C+  P    G+S E     
Sbjct: 23  VLPFGSVEQH-CSLPLATDALLAEAAARGACELLEREHGVACLLLPTMYYGFSPEWAGYP 81

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L+ +        +++++R  G  +  I+N HGGN+ ++   + EA    SM+V   
Sbjct: 82  GTLSLSLSTISGVVRDLLESLRSWGFDRAAIINGHGGNTSVLEAAAREASRSLSMVVGVA 141

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
           S+  F         P  ++G HGG++E S++  LA
Sbjct: 142 SYWAF--------LPAQDLG-HGGDVEASLLKHLA 167


>gi|289435912|ref|YP_003465784.1| creatinine amidohydrolase [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289172156|emb|CBH28702.1| creatinine amidohydrolase [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 249

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 109/249 (43%), Gaps = 24/249 (9%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +P
Sbjct: 6   ENSFDIGAKITKTTPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETNAFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ T++     +  + I +++ + G R  V ++ H GN   +   +
Sbjct: 62  VLPYGQVWSLQDFPGSLTVSNETVAKMVVEIGESLYRQGFRLFVPVSGHLGNMAALKDAA 121

Query: 129 TEARMRF-SMLVVSTSWSRFTIPQGIISFPETEIG----IHGGEIETSMMLALAPHLVKM 183
            E   +F  M+ +   +    I +  +   E +      IH  EIETS+ML L+P    M
Sbjct: 122 RELYAKFPDMITLHIFYPN--IQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADM 179

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHS-FGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
             A          + +   L     ++   W  ++     V+G A  AT +KGE L+   
Sbjct: 180 TRA----------IDDPPILPIDADYTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKT 227

Query: 243 ANCFIQLLN 251
               ++L+ 
Sbjct: 228 LKTCVELIK 236


>gi|118580204|ref|YP_901454.1| creatininase [Pelobacter propionicus DSM 2379]
 gi|118502914|gb|ABK99396.1| Creatininase [Pelobacter propionicus DSM 2379]
          Length = 241

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 98/241 (40%), Gaps = 26/241 (10%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +   V++P G+ E+HGPHLP++TDT+ A  +A +   +     P+   P    G      
Sbjct: 17  RSRTVLIPFGSVEEHGPHLPLSTDTLEACEVARKAALL----TPLFVAPPIHYGNCRSTS 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS--- 136
              GT +++       +  I+ A+   G+R  + L  H G +   ++      M  S   
Sbjct: 73  CHPGTISISTTTLKMLFKDIVQALYSHGLRNFIALTGHAGGAHCSALQDAGEEMLSSYPD 132

Query: 137 --MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
               VV+         +G+I   ET    H GEIETS +L   PHLVK      F +  +
Sbjct: 133 ANFAVVTEYLLARDEGRGLI---ETPGDAHAGEIETSRILHSHPHLVKGSAPREFPAFPA 189

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
             L   K              +   P GV G+   AT +KG  L        ++L+  + 
Sbjct: 190 GILVRDK--------------RRYWPGGVWGDPAKATAEKGARLEELVVKKLVELIQTVE 235

Query: 255 S 255
           +
Sbjct: 236 T 236


>gi|217966154|ref|YP_002351832.1| creatinine amidohydrolase [Listeria monocytogenes HCC23]
 gi|217335424|gb|ACK41218.1| creatinine amidohydrolase [Listeria monocytogenes HCC23]
 gi|307572236|emb|CAR85415.1| creatinine amidohydrolase [Listeria monocytogenes L99]
          Length = 249

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 108/248 (43%), Gaps = 22/248 (8%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +P
Sbjct: 6   ENSFDIGAKITKTKPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAT----ETDGFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ TL+     +  + I +++ K G R  V ++ H GN   +   +
Sbjct: 62  VLPYGQVWSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAA 121

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG----IHGGEIETSMMLALAPHLVKMD 184
            E   ++  +V+   +    I +  +   E +      IH  EIETS+ML L+P    M 
Sbjct: 122 RELYAKYPDMVILHIFYP-NIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADM- 179

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHS-FGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
                    S  + +   L      +   W  ++     V+G A  AT +KGE L+    
Sbjct: 180 ---------SRAIDDPPILPIDADFTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKTL 228

Query: 244 NCFIQLLN 251
              ++L+ 
Sbjct: 229 KTCVELIK 236


>gi|33596750|ref|NP_884393.1| putative creatinine amidohydrolase [Bordetella parapertussis 12822]
 gi|33573451|emb|CAE37436.1| putative creatinine amidohydrolase [Bordetella parapertussis]
          Length = 264

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 104/235 (44%), Gaps = 30/235 (12%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           K   +++P+GA EQ+G HL   T+  I  G+A  I +    R  +   P+ P+ YS   M
Sbjct: 17  KHDTILIPVGAVEQYGAHLATGTELRICEGIATEIGA----RTGLAVAPIVPVNYSA--M 70

Query: 80  YVDGTKTLTYA-EAIEHWLAII-DAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           ++D   TL+     IE +L  I D++   G R    +N H G+   +  V    R R+  
Sbjct: 71  FLDYPGTLSVEMRTIEDYLKEIGDSLAGQGFRHFFFINIHAGSLGPIESVCRHLRRRYD- 129

Query: 138 LVVSTSWSRFTI----PQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
             V      F+I      G +   ++  G H  E+ TS+ LA  P LV M+ A     R 
Sbjct: 130 -AVGGLIDVFSIMRDMAAGRLKTRQSPSG-HASEMVTSVALAKFPELVFMERA-----RA 182

Query: 194 SEFLRNF----------KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
           ++ LR+F          K      S S    + D +P G  G+   A+ ++G+ +
Sbjct: 183 AQSLRSFTEGVNTVSSGKVTLGGSSFSVFSDISDYSPIGTQGDPTQASAEQGQAI 237


>gi|118465285|ref|YP_883611.1| creatininase subfamily protein [Mycobacterium avium 104]
 gi|254776912|ref|ZP_05218428.1| creatininase subfamily protein [Mycobacterium avium subsp. avium
           ATCC 25291]
 gi|118166572|gb|ABK67469.1| creatininase subfamily protein [Mycobacterium avium 104]
          Length = 243

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 103/233 (44%), Gaps = 41/233 (17%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM--PVEPIGYSIEHMYV 81
           +++PLG+ EQHGPHLP++TDT IA+ +A R      PRL    +  P    G S EH   
Sbjct: 30  LLVPLGSTEQHGPHLPLDTDTRIASAVAGRAA----PRLGDGWLVAPAIAYGASGEHQSF 85

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMG--IRKIVILNAHGGN----SPLVSIVSTEARMRF 135
            GT ++   EA+   L +I+  R      +++V +N HGGN       V  +  E R   
Sbjct: 86  AGTVSIGT-EALT--LLLIEYGRSAAGWAQRVVFVNGHGGNVAALGRAVGTLRAEGR--- 139

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
                   W       G           H G  ETS++L ++P  V+    +  +  ++ 
Sbjct: 140 -----DAGWCPCVAAGGD---------AHAGHTETSVLLHISPAEVRT--GQWQAGNRAP 183

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
                  +R  G       +  ++P GV+G+   AT  +GE +LS   N  ++
Sbjct: 184 LPELLGSMRRGG-------VAAVSPVGVLGDPTTATAAEGERILSEMVNECVR 229


>gi|116874012|ref|YP_850793.1| creatinine amidohydrolase [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116742890|emb|CAK22014.1| creatinine amidohydrolase [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 249

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 109/249 (43%), Gaps = 24/249 (9%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +P
Sbjct: 6   ENSFDIGAKITKTKPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETDGFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ TL+     +  + I +++ K G R  V ++ H GN   +   +
Sbjct: 62  VLPYGQVWSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAA 121

Query: 129 TEARMRF-SMLVVSTSWSRFTIPQGIISFPETEIG----IHGGEIETSMMLALAPHLVKM 183
            E   ++  M+++   +    I +  +   E +      IH  EIETS+ML L+P    M
Sbjct: 122 RELYAKYPDMIILHIFYPN--IQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADM 179

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHS-FGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
                     S  + +   L      +   W  ++     V+G A  AT +KGE L+   
Sbjct: 180 ----------SRAIDDPPILPIDADFTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKT 227

Query: 243 ANCFIQLLN 251
               ++L+ 
Sbjct: 228 LKTCVELIK 236


>gi|183981044|ref|YP_001849335.1| creatinine amidohydrolase [Mycobacterium marinum M]
 gi|183174370|gb|ACC39480.1| Creatinine amidohydrolase [Mycobacterium marinum M]
          Length = 250

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 102/239 (42%), Gaps = 39/239 (16%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP----VEPIGY--SIE 77
           +++PLG+ EQHGPHLP++TDT IA  +   + + +  RL   C P      PI Y  S E
Sbjct: 30  ILIPLGSTEQHGPHLPLDTDTRIATAVGRAVATRMHGRL-TQCQPGWLLAPPIAYGASGE 88

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           H    GT ++   EA+   L            ++V +N HGGN   +     + R     
Sbjct: 89  HQSFAGTISIG-TEALRVLLLEYGRSAACWADRLVFVNGHGGNVEALRGAVRQLRAEGR- 146

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD-LAENFSSRQSEF 196
                 WS      G           H G  ETS++L ++P +V  D L+   ++  +E 
Sbjct: 147 ---DAGWSACGSAGG---------DAHAGHTETSVLLHISPEVVLTDRLSAGNAAPLAEL 194

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           L + +             +  ++P GV+G+   AT  +G          F ++++D  S
Sbjct: 195 LPSLRR----------GGVAAVSPIGVLGDPTTATAVEGR-------RIFAEMVDDCVS 236


>gi|290891832|ref|ZP_06554829.1| creatinine amidohydrolase [Listeria monocytogenes FSL J2-071]
 gi|290558426|gb|EFD91943.1| creatinine amidohydrolase [Listeria monocytogenes FSL J2-071]
          Length = 249

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 108/248 (43%), Gaps = 22/248 (8%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +P
Sbjct: 6   ENSFDIGAKITKTKPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETDGFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ TL+     +  + I +++ K G R  V ++ H GN   +   +
Sbjct: 62  VLPYGQVWSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAA 121

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG----IHGGEIETSMMLALAPHLVKMD 184
            E   ++  +V+   +    I +  +   E +      IH  EIETS+ML L+P    M 
Sbjct: 122 RELYAKYPDMVILHIFYP-NIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADM- 179

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHS-FGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
                    S  + +   L      +   W  ++     V+G A  AT +KGE L+    
Sbjct: 180 ---------SRAIDDPPILPIDADFTPTPW--QNFTKTAVLGEATLATAEKGEYLIGKTL 228

Query: 244 NCFIQLLN 251
              ++L+ 
Sbjct: 229 KTCVELIK 236


>gi|46190377|ref|ZP_00121574.2| COG1402: Uncharacterized protein, putative amidase [Bifidobacterium
           longum DJO10A]
          Length = 246

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 86/190 (45%), Gaps = 21/190 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           V++P+G+ EQHG HLP+ TD +    LA R+   L  R+  T +P    GY  + +    
Sbjct: 17  VIVPIGSTEQHGQHLPIGTDAV----LATRVAEDLAERIDGTVLPTLSYGYKSKPLSGGG 72

Query: 80  -YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP-LVSIVSTEARMRFSM 137
               GT  +     I     ++  +   G  KIV++NAH  N   +V  +    R    +
Sbjct: 73  PLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMNAHFENEAFIVEAIDLVTRETGGV 132

Query: 138 -LVVSTSWSRFTIPQGIIS-------FPETEIGIHGGEIETSMMLALAPHLVKMD-LAEN 188
             +V T+W    +PQ +I        FP   +  H    ETS+ML  AP LV MD + E 
Sbjct: 133 ATIVETNWWD-PVPQSVIDKVFDGLVFPGWALE-HAAVTETSLMLHYAPELVHMDRMVEE 190

Query: 189 FSSRQSEFLR 198
             +    ++R
Sbjct: 191 AGATAKSYVR 200


>gi|284993277|ref|YP_003411832.1| Creatininase [Geodermatophilus obscurus DSM 43160]
 gi|284066523|gb|ADB77461.1| Creatininase [Geodermatophilus obscurus DSM 43160]
          Length = 240

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 106/238 (44%), Gaps = 33/238 (13%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           ++++PLGA EQHG HLP+ TDT +A  +AE     L     V   P    G S EH    
Sbjct: 26  LLLVPLGAVEQHGHHLPLGTDTSVACAVAEAAVDDLD---GVLLAPALAYGASGEHEDFP 82

Query: 83  GTKTLTYAEAIEHWLAII--DAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           GT ++   EA+   L      A R  G  ++V++N HGGN   +    T+ R        
Sbjct: 83  GTVSIGT-EALTGLLVEYGRSACRWAG--RLVLVNGHGGNLDALRTAGTQLRAEAR---- 135

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
             +W     P G+          H G  ETS ML + P  V+ D A   +   +      
Sbjct: 136 EVAW----FPCGVAG-----ADAHAGRTETSAMLHVEPDAVRADRA--VAGDPTPIAELL 184

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
             LRA G       ++ ++P GV+G+   A+ ++G  LL+  A    +L   + ++DV
Sbjct: 185 PRLRAEG-------VRAVSPTGVLGDPAGASAEEGAELLAGMAG---RLAAAVRAWDV 232


>gi|254822792|ref|ZP_05227793.1| membrane sugar transferase [Mycobacterium intracellulare ATCC
           13950]
          Length = 685

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 108/226 (47%), Gaps = 29/226 (12%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           ++PLG+ EQHGPHLP++TDT IA  +A R ++ L     V   P    G S EH    GT
Sbjct: 1   MIPLGSTEQHGPHLPLDTDTRIATAVARRARARLGDGWLVA--PAIAYGASGEHQSFAGT 58

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGI--RKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
            +L   EA+   L +++  R  G   R++V +N HGGN  + ++ +  AR+R      + 
Sbjct: 59  ISLG-TEALT--LLLVEYGRSAGTWARRLVFVNGHGGN--VAALGAAVARLRAEGR--NA 111

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            W     P G           H G  ETS++L ++P  V+ D  +  +   +        
Sbjct: 112 GWCPCVAPGG---------DAHAGHTETSVLLHISPADVRTD--QWRAGNTAPLPELLGS 160

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
           +R  G       +  ++P GV+G+   AT  +GE +++   +  ++
Sbjct: 161 MRRGG-------VAAVSPVGVLGDPTTATAAEGERIVAEMVDECVR 199


>gi|148269645|ref|YP_001244105.1| creatininase [Thermotoga petrophila RKU-1]
 gi|147735189|gb|ABQ46529.1| Creatininase [Thermotoga petrophila RKU-1]
          Length = 311

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 109/250 (43%), Gaps = 29/250 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE---HM 79
           ++++P+G+ E HGP+ P   DT +   +AE++       L   C   EPI Y      H+
Sbjct: 26  LIIIPVGSTENHGPNAPTGEDTFLVTRMAEQVA------LKTGCTVAEPIWYGYHPYHHI 79

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM-RFSML 138
            + GT  +     I++ +++I      G RK ++LN HG    +   +   A++ +   +
Sbjct: 80  GMPGTVPVKDEAFIDYLVSVIAGFWNTGFRKQILLNGHGQEFVIPVAIHKFAKIFQVPAI 139

Query: 139 VVSTSW-----SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           +++ +W      +F   +     P     IH  E+ETS  LAL P L+  + A    +  
Sbjct: 140 IINLNWYHAIQDKFKTKEE--GGPYETPFIHADEVETSWSLALFPELMHQEWA--VDTEP 195

Query: 194 SEFLRNFKYLRAHG---------SHSFGWSMKDLN-PKGVVGNAMDATVKKGEGLLSYFA 243
             FL      +A            H  G  ++ +  P+GVVG A  A+  K +  +    
Sbjct: 196 KGFLPEGHIDKAGNLLHRPIAWYGHVGGGPIEVVAYPEGVVGKATLASADKAKEGVEALL 255

Query: 244 NCFIQLLNDI 253
           +   +L+ DI
Sbjct: 256 DYLEKLVRDI 265


>gi|39996821|ref|NP_952772.1| creatinine amidohydrolase [Geobacter sulfurreducens PCA]
 gi|39983709|gb|AAR35099.1| creatinine amidohydrolase [Geobacter sulfurreducens PCA]
 gi|298505830|gb|ADI84553.1| creatinine amidohydrolase superfamily protein [Geobacter
           sulfurreducens KN400]
          Length = 239

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 108/259 (41%), Gaps = 28/259 (10%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +II T   +      R    V++P G+ E+HG HLP++TDTI A  + ++   +    +P
Sbjct: 1   MIIETMTMVEFEEGLRATRTVLVPFGSVEEHGSHLPLSTDTIQAYEVGKKAARL----IP 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +   P    G         GT ++T          I+ ++ + G+R ++IL  H G S  
Sbjct: 57  LFVAPPVHYGSCRSTSCHPGTISITTGTLKSLMKDIVRSLYQQGLRNVIILTGHAGGSHR 116

Query: 124 VSI-----VSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           +++              ++ VV+     +   + II   ETE   H GEIETS ++   P
Sbjct: 117 MALQDAGEELLPELPELNIAVVTEYELAYHEGKSII---ETEGDSHAGEIETSRIMHSHP 173

Query: 179 HLVKMDLAENFSSRQSEFL-RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
            LVK      F S     L RN +           W      P GV G+   A+V+KG  
Sbjct: 174 DLVKGCAEREFPSFPPGLLVRNKRKY---------W------PGGVWGDPSKASVEKGRL 218

Query: 238 LLSYFANCFIQLLNDINSF 256
           +        +QL   + +F
Sbjct: 219 IEDLVVAKIVQLARTLEAF 237


>gi|281411645|ref|YP_003345724.1| Creatininase [Thermotoga naphthophila RKU-10]
 gi|281372748|gb|ADA66310.1| Creatininase [Thermotoga naphthophila RKU-10]
          Length = 323

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 111/250 (44%), Gaps = 29/250 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE---HM 79
           ++++P+G+ E HGP+ P   DT +   +AE++       L   C   EPI Y      H+
Sbjct: 38  LIIIPVGSTENHGPNAPTGEDTFLVTRMAEQVA------LKTGCTVAEPIWYGYHPYHHI 91

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM-RFSML 138
            + GT  +     I++ +++I      G RK ++LN HG    +   +   A++ +   +
Sbjct: 92  GMPGTVPVKDEAFIDYLVSVIAGFWNTGFRKQILLNGHGQEFVIPVAIHKFAKIFQVPAI 151

Query: 139 VVSTSW-----SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           +++ +W      +F   +    + ET   IH  E+ETS  LAL P L+  + A    +  
Sbjct: 152 IINLNWYHAIQDKFKTKEEGGPY-ETPF-IHADEVETSWSLALFPELMHQEWA--VDTEP 207

Query: 194 SEFLRNFKYLRAHG---------SHSFGWSMKDLN-PKGVVGNAMDATVKKGEGLLSYFA 243
             FL      +A            H  G  ++ +  P+GVVG A  A+  K +  +    
Sbjct: 208 KGFLPEGHIDKAGNLLHRPIAWYGHVGGGPIEVVAYPEGVVGKATLASADKAKEGVEALL 267

Query: 244 NCFIQLLNDI 253
           +   +L+ DI
Sbjct: 268 DYLEKLVRDI 277


>gi|322691625|ref|YP_004221195.1| creatininase [Bifidobacterium longum subsp. longum JCM 1217]
 gi|320456481|dbj|BAJ67103.1| creatininase [Bifidobacterium longum subsp. longum JCM 1217]
          Length = 252

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 88/191 (46%), Gaps = 23/191 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           V++P+G+ EQHG HLP+ TD +    LA R+   L  R+  T +P    GY  + +    
Sbjct: 23  VIVPIGSTEQHGQHLPIGTDAV----LATRVAEDLAERIDGTVLPTLSYGYKSKPLSGGG 78

Query: 80  -YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS-- 136
               GT  +     I     ++  +   G  KIV++NAH  N   + + + +  +R +  
Sbjct: 79  PLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMNAHFENEAFI-VEAIDLVIRETGG 137

Query: 137 -MLVVSTSWSRFTIPQGIIS-------FPETEIGIHGGEIETSMMLALAPHLVKMD-LAE 187
              +V T+W    +PQ +I        FP   +  H    ETS+ML  AP LV MD + E
Sbjct: 138 VATIVETNWWD-PVPQSVIDKVFDGLVFPGWALE-HAAVTETSLMLHYAPELVHMDRMVE 195

Query: 188 NFSSRQSEFLR 198
              +    ++R
Sbjct: 196 EAGATAKSYVR 206


>gi|55376867|ref|YP_134718.1| hypothetical protein pNG7317 [Haloarcula marismortui ATCC 43049]
 gi|55229592|gb|AAV45012.1| unknown [Haloarcula marismortui ATCC 43049]
          Length = 243

 Score = 65.5 bits (158), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 98/235 (41%), Gaps = 22/235 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDT----IIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           + +LP+G+ EQHGPH P+ TDT    ++A   AER    +     V     E      EH
Sbjct: 18  LALLPVGSTEQHGPHAPLGTDTLDAEVVAEHGAERHDDPVVVAPAVPVGVAE------EH 71

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT   + +    +   I+ ++   G   +V++N HGGN   +  V+          
Sbjct: 72  RAFSGTLWTSESTFRSYVRDIVRSLASHGWDHVVLVNGHGGNIDALREVAGTITRHDEAF 131

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
            V  +W         +     ++G HGG +ETS++    P  V  D  +  +   S+   
Sbjct: 132 AVPFTWFN------AVGDHSADMG-HGGPLETSLLQHTNPETVHEDRLDEAADGGSDGWG 184

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
            ++        +  +   +    GVVG+  + + ++GE LL       + LL++I
Sbjct: 185 EWQS-----GVNLAFDSDEFTQNGVVGDPREGSAERGEMLLDLATESLVALLDEI 234


>gi|313616867|gb|EFR89542.1| creatinine amidohydrolase [Listeria innocua FSL S4-378]
          Length = 249

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 86/183 (46%), Gaps = 11/183 (6%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +P
Sbjct: 6   ENSFDIGAKITKTKPVLLPIGAVEAHGPHLPLGTDNILASEYSVKIAA----ETDGFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ TL+     +  + I +++ K G R  V ++ H GN   +   +
Sbjct: 62  VLPYGQVWSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAA 121

Query: 129 TEARMRF-SMLVVSTSWSRFTIPQGIISFPETEIG----IHGGEIETSMMLALAPHLVKM 183
            E   +F  M+++   +    I +  +   E +      IH  EIETS+ML L+P    M
Sbjct: 122 RELYAKFPDMIILHIFYPN--IQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADM 179

Query: 184 DLA 186
             A
Sbjct: 180 SRA 182


>gi|269121094|ref|YP_003309271.1| creatininase [Sebaldella termitidis ATCC 33386]
 gi|268614972|gb|ACZ09340.1| Creatininase [Sebaldella termitidis ATCC 33386]
          Length = 243

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 106/238 (44%), Gaps = 28/238 (11%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           NS  +     K  + +LPLGA E HGPHLP+ TD  ++  +AE+    L   +     P 
Sbjct: 7   NSKEIKEIIEKVKVAILPLGAVEAHGPHLPLGTDNYLSEKIAEK----LSENVECLVFPT 62

Query: 70  EPIG--YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
            P G  +S+E     G+ +L+    I     I  ++ K G +   I+N H GN    + +
Sbjct: 63  LPYGQVWSLEEF--PGSVSLSNETLINMLYEIGKSMYKNGFKIFGIINGHLGNG---TAI 117

Query: 128 STEARMRFSMLVVSTSWSRFT--IPQGIISFPETEI----GIHGGEIETSMMLALAPHLV 181
               R  FS      +++ F     + I    ET+       H  E+ETS ML LA   V
Sbjct: 118 KEAQRKLFSEFSDFKTFNFFYTGTDKVIQEVRETQKLHKNYFHADELETSYMLYLADEYV 177

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           +M  A N +    E++ +   +R        W+  +     V+G+A  AT +KG+ ++
Sbjct: 178 EMSKAINGNPDYPEYI-DITPVR--------WT--EFTDTAVMGDATLATKEKGKKIV 224


>gi|222099230|ref|YP_002533798.1| Creatinine amidohydrolase [Thermotoga neapolitana DSM 4359]
 gi|221571620|gb|ACM22432.1| Creatinine amidohydrolase [Thermotoga neapolitana DSM 4359]
          Length = 323

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 111/250 (44%), Gaps = 29/250 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE---HM 79
           ++++P+G+ E HGP+ P   DT +   +AE++       L   C   EPI Y      H+
Sbjct: 38  LIIIPVGSTENHGPNAPTGEDTFLVTRMAEQVA------LKTGCTVAEPIWYGYHPYHHI 91

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM-RFSML 138
            + GT  +     I++ +++I      G RK ++LN HG    +   +   A++ +   +
Sbjct: 92  GMPGTVPVKDEAFIDYLVSVIAGFWNTGFRKQILLNGHGQEFVIPVAIHKFAKIFQVPAI 151

Query: 139 VVSTSW-----SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           +++ +W      +F   +    + ET   IH  E+ETS  LAL P L+  + A    +  
Sbjct: 152 IINLNWYHAIQDKFKTKEEGGPY-ETPF-IHADEVETSWSLALFPELMHQEWA--VDTEP 207

Query: 194 SEFLRNFKYLRAHG---------SHSFGWSMKDLN-PKGVVGNAMDATVKKGEGLLSYFA 243
             FL      +A            H  G  ++ +  P+GVVG A  A+  K +  +    
Sbjct: 208 KGFLPEGHIDKAGNLLHRPIAWYGHVGGGPIEVVAYPEGVVGKATLASADKAKEGVEALL 267

Query: 244 NCFIQLLNDI 253
           +   +L+ DI
Sbjct: 268 DYLEKLVRDI 277


>gi|118468439|ref|YP_885808.1| creatininase subfamily protein [Mycobacterium smegmatis str. MC2
           155]
 gi|118169726|gb|ABK70622.1| creatininase subfamily protein [Mycobacterium smegmatis str. MC2
           155]
          Length = 222

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 94/224 (41%), Gaps = 25/224 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL--PPRLPVTCMPVEPIGYSIEHMY 80
           +V++P+G+ EQHGPHLP++TDT IAA +A  +      P        P    G S EH  
Sbjct: 4   MVLVPVGSTEQHGPHLPLDTDTRIAAAVAGTVVEQFGAPADRDAVVAPPVAYGASGEHEG 63

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT ++  A A+E  L            +IV +N HGGN   ++      R        
Sbjct: 64  FPGTVSIGTA-ALELLLVEYGRSASKWTSRIVFVNGHGGNVEALAAAVALLRYEGR---- 118

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
              W   ++P         +   H G  ETS++L ++P  V  D  E      +      
Sbjct: 119 DAGWVPCSVP---------DADAHAGHTETSVLLHISPDDVLTD--ELVCGNTAPLAELM 167

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             +R+ G       +  ++  G++G+   AT  +GE + +   N
Sbjct: 168 PRMRSGG-------VAAVSELGILGDPTTATAAEGERIFAEMVN 204


>gi|322689664|ref|YP_004209398.1| creatininase [Bifidobacterium longum subsp. infantis 157F]
 gi|320461000|dbj|BAJ71620.1| creatininase [Bifidobacterium longum subsp. infantis 157F]
          Length = 252

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 86/190 (45%), Gaps = 21/190 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           V++P+G+ EQHG HLP+ TD +    LA R+   L  R+  T +P    GY  + +    
Sbjct: 23  VIVPIGSTEQHGQHLPIGTDAV----LATRVAEDLAERIDGTVLPTLSYGYKSKPLSGGG 78

Query: 80  -YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP-LVSIVSTEARMRFSM 137
               GT  +     I     ++  +   G  KIV++NAH  N   +V  +    R    +
Sbjct: 79  PLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMNAHFENEAFIVEAIDLVTRETGGV 138

Query: 138 -LVVSTSWSRFTIPQGIIS-------FPETEIGIHGGEIETSMMLALAPHLVKMD-LAEN 188
             +V T+W    +PQ +I        FP   +  H    ETS+ML  AP LV MD + E 
Sbjct: 139 ATIVETNWWD-PVPQSVIDKVFDGLVFPGWALE-HAAVTETSLMLHYAPELVHMDRMVEE 196

Query: 189 FSSRQSEFLR 198
             +    ++R
Sbjct: 197 AGATAKSYVR 206


>gi|189438877|ref|YP_001953958.1| amidase-like protein [Bifidobacterium longum DJO10A]
 gi|189427312|gb|ACD97460.1| Amidase-like protein [Bifidobacterium longum DJO10A]
          Length = 252

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 86/190 (45%), Gaps = 21/190 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           V++P+G+ EQHG HLP+ TD +    LA R+   L  R+  T +P    GY  + +    
Sbjct: 23  VIVPIGSTEQHGQHLPIGTDAV----LATRVAEDLAERIDGTVLPTLSYGYKSKPLSGGG 78

Query: 80  -YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP-LVSIVSTEARMRFSM 137
               GT  +     I     ++  +   G  KIV++NAH  N   +V  +    R    +
Sbjct: 79  PLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMNAHFENEAFIVEAIDLVTRETGGV 138

Query: 138 -LVVSTSWSRFTIPQGIIS-------FPETEIGIHGGEIETSMMLALAPHLVKMD-LAEN 188
             +V T+W    +PQ +I        FP   +  H    ETS+ML  AP LV MD + E 
Sbjct: 139 ATIVETNWWD-PVPQSVIDKVFDGLVFPGWALE-HAAVTETSLMLHYAPELVHMDRMVEE 196

Query: 189 FSSRQSEFLR 198
             +    ++R
Sbjct: 197 AGATAKSYVR 206


>gi|41410253|ref|NP_963089.1| hypothetical protein MAP4155 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41399087|gb|AAS06705.1| hypothetical protein MAP_4155 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 243

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 103/233 (44%), Gaps = 41/233 (17%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM--PVEPIGYSIEHMYV 81
           +++PLG+ EQHGPHLP++TDT IA+ +A R      PRL    +  P    G S EH   
Sbjct: 30  LLVPLGSTEQHGPHLPLDTDTRIASAVAGRAV----PRLGDDWLVAPAIAYGASGEHQSF 85

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMG--IRKIVILNAHGGN----SPLVSIVSTEARMRF 135
            GT ++   EA+   L +I+  R      +++V +N HGGN       V  +  E R   
Sbjct: 86  AGTVSIGT-EALT--LLLIEYGRSAAGWAQRVVFVNGHGGNVAALGRAVGTLRAEGR--- 139

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
                   W       G           H G  ETS++L ++P  V+    +  +  ++ 
Sbjct: 140 -----DAGWCPCVAAGGD---------AHAGHTETSVLLHISPAEVRTGAWQ--AGNRAP 183

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
                  +R  G       +  ++P GV+G+   AT  +GE +LS   N  ++
Sbjct: 184 LPELLGSMRRGG-------VAAVSPVGVLGDPTTATAAEGERILSEMVNECVR 229


>gi|239620717|ref|ZP_04663748.1| creatininase [Bifidobacterium longum subsp. infantis CCUG 52486]
 gi|312132330|ref|YP_003999669.1| amidase-like protein [Bifidobacterium longum subsp. longum BBMN68]
 gi|239516293|gb|EEQ56160.1| creatininase [Bifidobacterium longum subsp. infantis CCUG 52486]
 gi|291516223|emb|CBK69839.1| Uncharacterized protein, putative amidase [Bifidobacterium longum
           subsp. longum F8]
 gi|311773757|gb|ADQ03245.1| Amidase-like protein [Bifidobacterium longum subsp. longum BBMN68]
          Length = 252

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 86/190 (45%), Gaps = 21/190 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           V++P+G+ EQHG HLP+ TD +    LA R+   L  R+  T +P    GY  + +    
Sbjct: 23  VIVPIGSTEQHGQHLPIGTDAV----LATRVAEDLAERIDGTVLPTLSYGYKSKPLSGGG 78

Query: 80  -YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP-LVSIVSTEARMRFSM 137
               GT  +     I     ++  +   G  KIV++NAH  N   +V  +    R    +
Sbjct: 79  PLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMNAHFENEAFIVEAIDLVTRETGGV 138

Query: 138 -LVVSTSWSRFTIPQGIIS-------FPETEIGIHGGEIETSMMLALAPHLVKMD-LAEN 188
             +V T+W    +PQ +I        FP   +  H    ETS+ML  AP LV MD + E 
Sbjct: 139 ATIVETNWWD-PVPQSVIDKVFDGLVFPGWALE-HAAVTETSLMLHYAPELVHMDRMVEE 196

Query: 189 FSSRQSEFLR 198
             +    ++R
Sbjct: 197 AGATAKSYVR 206


>gi|291612565|ref|YP_003522722.1| Creatininase [Sideroxydans lithotrophicus ES-1]
 gi|291582677|gb|ADE10335.1| Creatininase [Sideroxydans lithotrophicus ES-1]
          Length = 256

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 78/164 (47%), Gaps = 7/164 (4%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH-MYVDG 83
           +LP+GA EQHGPHL    D +IA  L   +      R+PV  +P  P G S+ H     G
Sbjct: 23  ILPVGATEQHGPHLGCGVDFVIAEELCLAVSEKT--RVPV--LPTLPYGSSLGHSKRWPG 78

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSMLVVST 142
           T +L     IE    I D     G+R++ I+NAH  N +PL   +         M+V S 
Sbjct: 79  TISLQPITLIEVVKQIGDWAYHSGVRRLFIVNAHVTNVAPLRCALEMLRAEHDDMMVASI 138

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
             +  +       F +     H  + ETS+MLA+AP LV+ +L 
Sbjct: 139 GSATLSDRVRKFHFADA-ADWHANDAETSLMLAIAPALVRPELC 181


>gi|317481701|ref|ZP_07940733.1| creatinine amidohydrolase [Bifidobacterium sp. 12_1_47BFAA]
 gi|316916815|gb|EFV38205.1| creatinine amidohydrolase [Bifidobacterium sp. 12_1_47BFAA]
          Length = 252

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 86/190 (45%), Gaps = 21/190 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           V++P+G+ EQHG HLP+ TD +    LA R+   L  R+  T +P    GY  + +    
Sbjct: 23  VIVPIGSTEQHGQHLPIGTDAV----LATRVAEDLAERIDGTVLPTLSYGYKSKPLSGGG 78

Query: 80  -YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP-LVSIVSTEARMRFSM 137
               GT  +     I     ++  +   G  KIV++NAH  N   +V  +    R    +
Sbjct: 79  PLFPGTIDMNGVTVITQMHDVLSELIADGFTKIVVMNAHFENEAFIVEAIDLVTRETGGV 138

Query: 138 -LVVSTSWSRFTIPQGIIS-------FPETEIGIHGGEIETSMMLALAPHLVKMD-LAEN 188
             +V T+W    +PQ +I        FP   +  H    ETS+ML  AP LV MD + E 
Sbjct: 139 ATIVETNWWD-PVPQSVIDKVFDGLVFPGWALE-HAAVTETSLMLHYAPELVHMDRMVEE 196

Query: 189 FSSRQSEFLR 198
             +    ++R
Sbjct: 197 AGATAKSYVR 206


>gi|226225191|ref|YP_002759298.1| creatinine amidohydrolase [Listeria monocytogenes Clip81459]
 gi|254824993|ref|ZP_05229994.1| creatinine amidohydrolase [Listeria monocytogenes FSL J1-194]
 gi|254854148|ref|ZP_05243496.1| creatinine amidohydrolase [Listeria monocytogenes FSL R2-503]
 gi|254994458|ref|ZP_05276648.1| creatinine amidohydrolase [Listeria monocytogenes FSL J2-064]
 gi|255519626|ref|ZP_05386863.1| creatinine amidohydrolase [Listeria monocytogenes FSL J1-175]
 gi|300763603|ref|ZP_07073601.1| creatinine amidohydrolase [Listeria monocytogenes FSL N1-017]
 gi|225877653|emb|CAS06367.1| Putative creatinine amidohydrolase [Listeria monocytogenes serotype
           4b str. CLIP 80459]
 gi|258607540|gb|EEW20148.1| creatinine amidohydrolase [Listeria monocytogenes FSL R2-503]
 gi|293594233|gb|EFG01994.1| creatinine amidohydrolase [Listeria monocytogenes FSL J1-194]
 gi|300515880|gb|EFK42929.1| creatinine amidohydrolase [Listeria monocytogenes FSL N1-017]
          Length = 249

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 108/248 (43%), Gaps = 22/248 (8%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +P
Sbjct: 6   ENSFDIGAKITKTKPVLLPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETDGFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ TL+     +  + I +++ K G R  V ++ H GN   +   +
Sbjct: 62  VLPYGQVWSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAA 121

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG----IHGGEIETSMMLALAPHLVKMD 184
            E   ++  +V+   +    I +  +   E +      IH  EIETS+ML L+P    M 
Sbjct: 122 RELYAKYPDMVILHIFYP-NIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADM- 179

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHS-FGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
                    S  + +   L      +   W  ++     V+G A  AT +KGE L+    
Sbjct: 180 ---------SRAIDDPPILPIDADFTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKTL 228

Query: 244 NCFIQLLN 251
              ++L+ 
Sbjct: 229 KTCVELIK 236


>gi|188587170|ref|YP_001918715.1| Creatininase [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179351857|gb|ACB86127.1| Creatininase [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 286

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 104/247 (42%), Gaps = 46/247 (18%)

Query: 29  GAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT--CMPVEPIGYSIEHMYVDGT-- 84
           G+ EQHGPHLP++ D  IA  LA++I       + ++       P+GYS  HM   GT  
Sbjct: 27  GSIEQHGPHLPIDNDIYIARALAKKIAEEAKQSMNISIGIGASMPVGYSQHHMEFPGTVS 86

Query: 85  -KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE------------- 130
            +  TY   ++    II +    GI  I+++N HGGN  ++    TE             
Sbjct: 87  FRKETYKMVLK---DIIHSYYHHGITDILLINGHGGNGEIIKETLTEIKENSNGPNNSPN 143

Query: 131 ---------------ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
                          +  + ++L +   W+      G     ET+   H  E ETS   A
Sbjct: 144 NVSNKVPNKLPNNVPSNEKTNLLDIFNYWNAIKEQGG--HLLETQFFCHACEGETSFAEA 201

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGW--SMKDLNPKGVVGNAMDATVK 233
           L   +++ +L +  S  Q+  L  +       S   G   S++ ++  GV+GN   A+ +
Sbjct: 202 LDQRVLRDELIDALS--QNPELSKYNLF----SEPCGNLPSIEQVSASGVIGNNKPASRE 255

Query: 234 KGEGLLS 240
            GE LL 
Sbjct: 256 TGEKLLQ 262


>gi|296454591|ref|YP_003661734.1| amidase-like protein [Bifidobacterium longum subsp. longum JDM301]
 gi|296184022|gb|ADH00904.1| Amidase-like protein [Bifidobacterium longum subsp. longum JDM301]
          Length = 252

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 86/190 (45%), Gaps = 21/190 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           V++P+G+ EQHG HLP+ TD +    LA R+   L  R+  T +P    GY  + +    
Sbjct: 23  VIVPIGSTEQHGQHLPIGTDAV----LATRVAEDLAERIDGTVLPTLSYGYKSKPLSGGG 78

Query: 80  -YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP-LVSIVSTEARMRFSM 137
               GT  +     I     ++  +   G  KIV++NAH  N   +V  +    R    +
Sbjct: 79  PLFPGTIDMNGVTVITQMHDVLSELIADGFTKIVVMNAHFENEAFIVEAIDLVTRETGGV 138

Query: 138 -LVVSTSWSRFTIPQGIIS-------FPETEIGIHGGEIETSMMLALAPHLVKMD-LAEN 188
             +V T+W    +PQ +I        FP   +  H    ETS+ML  AP LV MD + E 
Sbjct: 139 ATIVETNWWD-PVPQSVIDKVFDGLVFPGWALE-HAAVTETSLMLHYAPELVHMDRMVEE 196

Query: 189 FSSRQSEFLR 198
             +    ++R
Sbjct: 197 AGATAKSYVR 206


>gi|291457462|ref|ZP_06596852.1| creatininase [Bifidobacterium breve DSM 20213]
 gi|291381297|gb|EFE88815.1| creatininase [Bifidobacterium breve DSM 20213]
          Length = 246

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 87/190 (45%), Gaps = 21/190 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           V++P+G+ EQHG HLP+ TD ++A  +AE     L  R+  T +P    GY  + +    
Sbjct: 17  VIVPIGSTEQHGQHLPIGTDAVLATCVAED----LAERIDGTVLPALSYGYKSKPLSGGG 72

Query: 80  -YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP-LVSIVSTEARMRFSM 137
               GT  +     I     ++  +   G  KIV++NAH  N   +V  +    R    +
Sbjct: 73  PLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMNAHFENEAFIVEAIDLVTRETGGV 132

Query: 138 -LVVSTSWSRFTIPQGIIS-------FPETEIGIHGGEIETSMMLALAPHLVKMD-LAEN 188
             +V T+W    +PQ +I        FP   +  H    ETS+ML  AP +V MD + E 
Sbjct: 133 ATIVETNWWD-PVPQSVIDKVFDGLVFPGWALE-HAAVTETSLMLHYAPEMVHMDRMVEE 190

Query: 189 FSSRQSEFLR 198
             +    ++R
Sbjct: 191 AGASAKSYVR 200


>gi|237711718|ref|ZP_04542199.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237725843|ref|ZP_04556324.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|265753136|ref|ZP_06088705.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|229435651|gb|EEO45728.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229454413|gb|EEO60134.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263236322|gb|EEZ21817.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 251

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 81/189 (42%), Gaps = 28/189 (14%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV------------E 70
           +V+LP GA E H  HLP  TD I++  +A     +      + CM +             
Sbjct: 22  LVLLPWGATEPHNLHLPYLTDCILSHDIALDAAKMAKTHYGIRCMVLPYVTAGSQNPGQR 81

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
            + + I + Y      L+          I+ ++   G RK+VI+N HGGN+   S++   
Sbjct: 82  GLDFCIHYRYETQKAILS---------DIVASLYAQGYRKMVIINGHGGNT-FKSMIRDL 131

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA--EN 188
           +      L+ S+ W  F   +     P    G H  E+ETS+M+   P LV +D A   N
Sbjct: 132 SLDYPDFLIASSEWFAFVPAKEYFDEP----GDHADELETSVMMHYHPELVNLDEAGDGN 187

Query: 189 FSSRQSEFL 197
           +    S+ L
Sbjct: 188 YKKFASQML 196


>gi|89893713|ref|YP_517200.1| hypothetical protein DSY0967 [Desulfitobacterium hafniense Y51]
 gi|89333161|dbj|BAE82756.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 252

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 89/189 (47%), Gaps = 16/189 (8%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R+  + ++P G+ EQHGPHLP  TD      +A ++ S L   L    +P    G +  H
Sbjct: 22  RRSQLAIIPNGSVEQHGPHLPCGTDHYCIMAIARKVASGLDGLL----LPFSHTGVTPFH 77

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT TL     +   L    ++   G++KI+ +N H GN+  ++  +++ +  + + 
Sbjct: 78  ASFAGTLTLRQETYVNLLLDTAVSVINHGVQKILFVNWHEGNTTSINYAASQLQKEYGVT 137

Query: 139 VVSTSWSRFT--IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS----SR 192
            V       T  + QG     E ++  H G +E   ++A  P L+K++ A N S    ++
Sbjct: 138 CVVAQACYITEQLYQG-----EADL-THAGALEVLPVMAYRPDLLKLERATNPSPYEAAK 191

Query: 193 QSEFLRNFK 201
           + + LR  K
Sbjct: 192 EVDALRRSK 200


>gi|227546741|ref|ZP_03976790.1| creatinine amidohydrolase; creatininase [Bifidobacterium longum
           subsp. infantis ATCC 55813]
 gi|227212703|gb|EEI80584.1| creatinine amidohydrolase; creatininase [Bifidobacterium longum
           subsp. infantis ATCC 55813]
          Length = 246

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 86/190 (45%), Gaps = 21/190 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           V++P+G+ EQHG HLP+ TD +    LA R+   L  R+  T +P    GY  + +    
Sbjct: 17  VIVPIGSTEQHGQHLPIGTDAV----LATRVAEDLAERIDGTVLPTLSYGYKSKPLSGGG 72

Query: 80  -YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP-LVSIVSTEARMRFSM 137
               GT  +     I     ++  +   G  KIV++NAH  N   +V  +    R    +
Sbjct: 73  PLFPGTIDMNGVTVITQMHDVLSELIADGFTKIVVMNAHFENEAFIVEAIDLVTRETGGV 132

Query: 138 -LVVSTSWSRFTIPQGIIS-------FPETEIGIHGGEIETSMMLALAPHLVKMD-LAEN 188
             +V T+W    +PQ +I        FP   +  H    ETS+ML  AP LV MD + E 
Sbjct: 133 ATIVETNWWD-PVPQSVIDKVFDGLVFPGWALE-HAAVTETSLMLHYAPELVHMDRMVEE 190

Query: 189 FSSRQSEFLR 198
             +    ++R
Sbjct: 191 AGATAKSYVR 200


>gi|23464642|ref|NP_695245.1| creatinine amidohydrolase; creatininase [Bifidobacterium longum
           NCC2705]
 gi|23325200|gb|AAN23881.1| creatinine amidohydrolase; creatininase [Bifidobacterium longum
           NCC2705]
          Length = 252

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 86/190 (45%), Gaps = 21/190 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           V++P+G+ EQHG HLP+ TD +    LA R+   L  R+  T +P    GY  + +    
Sbjct: 23  VIVPIGSTEQHGQHLPIGTDAV----LATRVAEDLAERIDGTVLPTLSYGYKSKPLSGGG 78

Query: 80  -YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP-LVSIVSTEARMRFSM 137
               GT  +     I     ++  +   G  KIV++NAH  N   +V  +    R    +
Sbjct: 79  PLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMNAHFENEAFIVEAIDLVTRETGGV 138

Query: 138 -LVVSTSWSRFTIPQGIIS-------FPETEIGIHGGEIETSMMLALAPHLVKMD-LAEN 188
             +V T+W    +PQ +I        FP   +  H    ETS+ML  AP LV MD + E 
Sbjct: 139 ATIVETNWWD-PVPQSVIDKVFDGLVFPGWAME-HAAVTETSLMLHYAPELVHMDRMVEE 196

Query: 189 FSSRQSEFLR 198
             +    ++R
Sbjct: 197 AGATAKSYVR 206


>gi|33600518|ref|NP_888078.1| putative creatinine amidohydrolase [Bordetella bronchiseptica RB50]
 gi|33568117|emb|CAE32030.1| putative creatinine amidohydrolase [Bordetella bronchiseptica RB50]
          Length = 264

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 106/235 (45%), Gaps = 30/235 (12%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           K   +++P+GA EQ+G HL   T+  I  G+A  I +    R  +   P+ P+ YS   M
Sbjct: 17  KHDTILIPVGAVEQYGAHLATGTELRICEGIATEIGA----RTGLAVAPIVPVNYSA--M 70

Query: 80  YVDGTKTLTYA-EAIEHWLAII-DAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           ++D   TL+     IE +L  I D++   G R    +N H G+   +  V    R R+  
Sbjct: 71  FLDYPGTLSVEMRTIEDYLKEIGDSLAGQGFRHFFFINIHAGSLGPIESVCRHLRRRYD- 129

Query: 138 LVVSTSWSRFTI----PQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
             V      F+I      G +   ++  G H  E+ TS+ LA  P LV M+ A     R 
Sbjct: 130 -AVGGLIDVFSIMRDMAAGRLKTRQSPSG-HASEMVTSVALAKFPELVFMERA-----RA 182

Query: 194 SEFLRNFKY---LRAHGSHSFGWS-------MKDLNPKGVVGNAMDATVKKGEGL 238
           ++ LR+F       + G  + G S       + D +P G  G+   A+ ++G+ +
Sbjct: 183 AQSLRSFTEGVNTVSSGKVTLGGSSFAVFSDISDYSPIGTQGDPTQASAEQGQAI 237


>gi|46908818|ref|YP_015207.1| creatinine amidohydrolase [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47093815|ref|ZP_00231561.1| creatinine amidohydrolase, putative [Listeria monocytogenes str. 4b
           H7858]
 gi|254931085|ref|ZP_05264444.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|46882091|gb|AAT05384.1| putative creatinine amidohydrolase [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47017812|gb|EAL08599.1| creatinine amidohydrolase, putative [Listeria monocytogenes str. 4b
           H7858]
 gi|293582630|gb|EFF94662.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|328469756|gb|EGF40676.1| creatinine amidohydrolase, putative [Listeria monocytogenes 220]
 gi|332313076|gb|EGJ26171.1| Creatinine amidohydrolase [Listeria monocytogenes str. Scott A]
          Length = 249

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 107/250 (42%), Gaps = 26/250 (10%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +P
Sbjct: 6   ENSFDIGAKITKTKPVLLPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETSGFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ TL+     +  + I +++ K G R  V ++ H GN   +   +
Sbjct: 62  VLPYGQVWSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAA 121

Query: 129 TEARMRFSMLVV------STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            E   ++  +V+      +       + +G  +       IH  EIETS+ML L+P    
Sbjct: 122 RELYAKYPDMVILHIFYPNIQKLAMDVREGNANH---HTYIHACEIETSLMLYLSPENAD 178

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHS-FGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           M          S  + +   L      +   W  ++     V+G A  AT +KGE L+  
Sbjct: 179 M----------SRAIDDPPILPIDADFTPTPW--QNFTKTAVLGEATLATAEKGEYLIEK 226

Query: 242 FANCFIQLLN 251
                ++L+ 
Sbjct: 227 TLKTCVELIK 236


>gi|328468130|gb|EGF39136.1| creatinine amidohydrolase, putative [Listeria monocytogenes 1816]
          Length = 475

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 84/184 (45%), Gaps = 13/184 (7%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +P
Sbjct: 6   ENSFDIGAKITKTKPVLLPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETSGFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ TL+     +  + I +++ K G R  V ++ H GN   +   +
Sbjct: 62  VLPYGQVWSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAA 121

Query: 129 TEARMRFSMLVV------STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            E   ++  +V+      +       + +G  +       IH  EIETS+ML L+P    
Sbjct: 122 RELYAKYPDMVILHIFYPNIQKLAMDVREGNANH---HTYIHACEIETSLMLYLSPENAD 178

Query: 183 MDLA 186
           M  A
Sbjct: 179 MSRA 182


>gi|83596083|gb|ABC25440.1| creatininase [uncultured marine bacterium Ant4D5]
          Length = 251

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 113/276 (40%), Gaps = 51/276 (18%)

Query: 1   MNPLIIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTI----IAAGLAERI 54
           M+  I+  + + P   +A  D    VV+ +GA EQHGPHLP+  D +    +A  +A R+
Sbjct: 1   MSDSILLEEMTWPEVGEAIADGRTTVVIAVGAIEQHGPHLPLLVDAVRGDRLAVEVARRL 60

Query: 55  KSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVIL 114
            S L         P   +G S  HM   GT TL         L    ++ + G  ++  +
Sbjct: 61  GSAL-------VAPTIRVGCSEHHMGFPGTLTLRRETLEAICLDYATSLARHGFTRLCFV 113

Query: 115 NAHGGN-SPLVSI-------VSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGG 166
            +HGGN  PL  +       V  E R+             +T   G + F    +G H  
Sbjct: 114 PSHGGNFGPLAEMLPALQAGVGKECRV-----------DAYTDLVGFMDFWPAAVGEHAP 162

Query: 167 EI-----------ETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSM 215
           ++           ET+ M+ + P LV+ + AE  + R   F     +        F    
Sbjct: 163 DLVPRVGGHADIAETAEMMVIRPDLVREERAE--AGRVQVFDDALMH------RVFSEGF 214

Query: 216 KDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
           + + P G++G++  AT   GE  +++ A+  +  L 
Sbjct: 215 RAVTPNGILGDSRGATSAIGESCIAHAADGIVAALE 250


>gi|266619232|ref|ZP_06112167.1| putative creatinine amidohydrolase [Clostridium hathewayi DSM
           13479]
 gi|288869223|gb|EFD01522.1| putative creatinine amidohydrolase [Clostridium hathewayi DSM
           13479]
          Length = 238

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 101/241 (41%), Gaps = 22/241 (9%)

Query: 12  LPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEP 71
           L +C+ A      ++P+G+ EQHG HLP+ TD      LAE +  ++  R      P   
Sbjct: 17  LEVCSTA------IVPIGSTEQHGYHLPLGTDVF----LAEHLARLISDRTGALVFPTLN 66

Query: 72  IGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
            GYS       GT +L           I+ ++ + G+ K+V LN H  N   +     + 
Sbjct: 67  FGYSWVWRDRIGTVSLPQDHLQLVLKDIVKSVERYGVTKLVFLNGHEANGASMKYAIRDI 126

Query: 132 RMRFSMLVVSTSWSRF-TIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
           +    + V+   +     I    +  P      H  E ETS+ML+    LV MDLA    
Sbjct: 127 QDDTPVKVLGMFYPGLQAIYDKYMESPTWGGMFHACEFETSLMLSAREELVHMDLA---- 182

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
             Q+E+  +   L    + S G    DL+  G  G+   A   KG+ +   FA    +L+
Sbjct: 183 --QAEY-PDRPPLYGMDNTSIG----DLSVSGTYGDPTAAAKDKGDRMFEEFAAKAAELI 235

Query: 251 N 251
           +
Sbjct: 236 S 236


>gi|323486133|ref|ZP_08091464.1| hypothetical protein HMPREF9474_03215 [Clostridium symbiosum
           WAL-14163]
 gi|323400700|gb|EGA93067.1| hypothetical protein HMPREF9474_03215 [Clostridium symbiosum
           WAL-14163]
          Length = 244

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 97/225 (43%), Gaps = 35/225 (15%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAG----LAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++LP GA E +GPH P+  D ++A      LAERI  I+ P L V        G S    
Sbjct: 23  IILPSGACEVYGPHNPLGADILVAKKMSEMLAERIDGIVGPCLEV--------GQSKSLT 74

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR----MRF 135
              GT  ++       +  II    ++G +   I+N H  N+  ++ V  +AR    +++
Sbjct: 75  SFPGTIAISGETLKAVYSEIIAEFVRLGFKNFFIVNNHLHNTQPLNEVLEDARIKNGIKY 134

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN----FSS 191
           + + V       +   G+   P      H  E +TS+++ L P LV M  A N    F  
Sbjct: 135 AQVGVWQYLPAVSDKTGMWETPAPH--AHASEAQTSVLMYLFPELVDMSKAPNTPMMFDD 192

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           R    +++  Y           SM D    G +GNA  AT +KGE
Sbjct: 193 RWPAIMKSVPYS----------SMTD---SGTLGNAQSATAEKGE 224


>gi|189424906|ref|YP_001952083.1| creatinase [Geobacter lovleyi SZ]
 gi|189421165|gb|ACD95563.1| Creatininase [Geobacter lovleyi SZ]
          Length = 241

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 98/233 (42%), Gaps = 26/233 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V +P GA E+HGPHLP++TDTI A  + +R   +    +P+   P  P G         G
Sbjct: 22  VYIPFGALEEHGPHLPLSTDTIQAYQVGKRAAEL----VPLFVAPPIPYGNCRSTSCHPG 77

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI-----VSTEARMRFSML 138
           T +++          ++ +  + G+  +V+L  H G +  +++        +      + 
Sbjct: 78  TVSISTTTLRCLLKDLVRSFYRQGMHNVVVLTGHAGGAHRLALQDAGEELLDELPELRIA 137

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           VV+         +GII   ET    H GEIETS ++   PHLV+    E + +  +  L 
Sbjct: 138 VVTEYELAKDEGRGII---ETPGDAHAGEIETSRIMHSHPHLVQGTAPEEYPTFPTGILV 194

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
             K              +   P GV G+   AT  KG  +    A   ++L+ 
Sbjct: 195 RDK--------------RRYWPGGVWGDPAKATADKGARIEELVARKVVELVR 233


>gi|150003343|ref|YP_001298087.1| putative amidase [Bacteroides vulgatus ATCC 8482]
 gi|319640368|ref|ZP_07995093.1| amidase [Bacteroides sp. 3_1_40A]
 gi|149931767|gb|ABR38465.1| putative amidase [Bacteroides vulgatus ATCC 8482]
 gi|317388143|gb|EFV68997.1| amidase [Bacteroides sp. 3_1_40A]
          Length = 251

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 81/189 (42%), Gaps = 28/189 (14%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV------------E 70
           +V+LP GA E H  HLP  TD I++  +A     +      + CM +             
Sbjct: 22  LVLLPWGATEPHNLHLPYLTDCILSHDIALDAAKLAKTHYGIRCMVMPYVTAGSQNPGQR 81

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
            + + I + Y      L+          ++ ++   G RK+VI+N HGGN+   S++   
Sbjct: 82  ELDFCIHYRYETQKAILS---------DLVASLYAQGYRKMVIINGHGGNT-FKSMIRDL 131

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA--EN 188
           +      L+ S+ W  F   +     P    G H  E+ETS+M+   P LV +D A   N
Sbjct: 132 SLDYPDFLIASSEWFAFIPAKEYFDEP----GDHADELETSVMMHYHPELVNLDEAGDGN 187

Query: 189 FSSRQSEFL 197
           +    S+ L
Sbjct: 188 YKKFASQML 196


>gi|284163500|ref|YP_003401779.1| creatininase [Haloterrigena turkmenica DSM 5511]
 gi|284013155|gb|ADB59106.1| Creatininase [Haloterrigena turkmenica DSM 5511]
          Length = 253

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 101/240 (42%), Gaps = 21/240 (8%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           + R+  IV +  G+ EQHGPHLP+N D +    L+ RI + L   L     P    G S 
Sbjct: 23  NGRRTAIVAV--GSIEQHGPHLPLNMDALDGDELSRRIAAELGDAL---AAPTIRPGCSG 77

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
            HM   GT T+     ++   A   ++   G   +V++  HGGN   VS V+ E      
Sbjct: 78  HHMEFPGTITVPPETLMDLIRAYCRSLDDHGFEHVVLVPTHGGNFAPVSTVAPEIAREID 137

Query: 137 MLVVSTS---WSRFTIPQGI--ISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSS 191
             V++ +        + +G+        E  IH G  ET+M+LA+   LV+ D  E    
Sbjct: 138 ANVIALADLDDHMALLNEGLRDAGIEYQEDVIHAGAAETAMILAIDEGLVRTDRLEAGPE 197

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                 R         S  F    K +   GV+G+  +AT + G+ +       +++ + 
Sbjct: 198 GSISTARLL-------SEGF----KSITENGVLGDPDEATPEAGDAIFDAVTAAYVERIE 246


>gi|323344557|ref|ZP_08084782.1| hypothetical protein HMPREF0663_11318 [Prevotella oralis ATCC
           33269]
 gi|323094684|gb|EFZ37260.1| hypothetical protein HMPREF0663_11318 [Prevotella oralis ATCC
           33269]
          Length = 255

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 81/173 (46%), Gaps = 20/173 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +V+LP GA E H  HLP  TD I++  +A         R  + CM + P+    ++    
Sbjct: 22  VVLLPWGATEPHNLHLPYMTDCILSHDIAVDAAQQTFERYGIRCMVMPPVNMGSQN---P 78

Query: 83  GTKTLTYAEAIEHWLA------IIDAIRKMGIRKIVILNAHGGNS--PLVSIVSTEARMR 134
           G + L++     +         I+ ++   G RK++I+N HGGN+   ++  +S E    
Sbjct: 79  GQRELSFCVHARYETQKAILTDIVASLNYQGFRKLLIVNGHGGNTFKNMIRDLSVE---- 134

Query: 135 FSMLVVSTS-WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
           +   VV+TS W +    +     P    G H  E+ETS+M+     LV +D A
Sbjct: 135 YPHFVVATSEWFKLMPAKEFFDTP----GDHADEVETSVMMHYHQELVNLDEA 183


>gi|154252090|ref|YP_001412914.1| creatininase [Parvibaculum lavamentivorans DS-1]
 gi|154156040|gb|ABS63257.1| Creatininase [Parvibaculum lavamentivorans DS-1]
          Length = 252

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 95/223 (42%), Gaps = 21/223 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV- 81
           + VLP+GA EQHGPHL   TDT+    LA+ I      R  +  +P  P G S  H    
Sbjct: 23  LAVLPIGATEQHGPHLATGTDTL----LADTICREACRRRGLPMLPALPYGCSYGHTNAW 78

Query: 82  DGTKTLTYAEAIEHWLAIID--AIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
            GT +L+  E +   +  +   AI   GI +++ ++ H  N P +     + R  +    
Sbjct: 79  PGTLSLS-PETLTRVICELARWAIDNSGIDRLLFISGHATNGPSIESAILQLRYEYPHAR 137

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
            +         + +  +      IH    ETSM++A+ P  V+M+ AE+     +  +  
Sbjct: 138 FAARGLWEISDEALRLYTSDAADIHANVAETSMVMAIDPQSVQMERAEDVEDVTAGLI-- 195

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           ++Y           +M  + P GVVG    ++   G  +L   
Sbjct: 196 WRY-----------AMPAVTPNGVVGRPSGSSAAAGREMLDRL 227


>gi|118575249|ref|YP_874992.1| conserved hypothetical protein, putative amidase [Cenarchaeum
           symbiosum A]
 gi|118193770|gb|ABK76688.1| conserved hypothetical protein, putative amidase [Cenarchaeum
           symbiosum A]
          Length = 236

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 101/219 (46%), Gaps = 28/219 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM-YVD 82
            VLP+G+ EQHG HLP++TD+ I + +A R+      +    CMP    G S EH  Y++
Sbjct: 21  AVLPVGSTEQHGAHLPVSTDSDIVSEVAYRVSK----KCGYLCMPTIQYGVSFEHSPYLN 76

Query: 83  -GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
              +  T    +     II ++   G   + ++N H GN+  +  + ++   R     V 
Sbjct: 77  LSLRGATLRHVVRD---IISSMASAGAPAVFVINGHHGNARHLEGLESK---RAPRTRVI 130

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           + W    + +G+          H G+IETS+MLA++   V+M  A+             +
Sbjct: 131 SYW--HYLEEGL---------DHAGDIETSIMLAISDK-VRMSRAKKGFVPPELDDTGRE 178

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
            L    S SF     ++   G+ G+   AT KKGE +LS
Sbjct: 179 RLSKRASRSF----IEVTGNGIWGDPRKATAKKGEEMLS 213


>gi|308396513|ref|ZP_07492314.2| hypothetical protein TMLG_03187 [Mycobacterium tuberculosis
           SUMu012]
 gi|308367072|gb|EFP55923.1| hypothetical protein TMLG_03187 [Mycobacterium tuberculosis
           SUMu012]
          Length = 221

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 76/170 (44%), Gaps = 28/170 (16%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVT-----CMPVEPIGYSIEH 78
           ++PLG+ EQHGPHLP++TDT IA  +A  + + L    LP+        P    G S EH
Sbjct: 1   MIPLGSTEQHGPHLPLDTDTRIATAVARTVTARLHAEDLPIAQEEWLMAPAIAYGASGEH 60

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN----SPLVSIVSTEARMR 134
               GT ++   EA+   L           R++V +N HGGN    +  V ++  E R  
Sbjct: 61  QRFAGTISIG-TEALTMLLVEYGRSAACWARRLVFVNGHGGNVGALTRAVGLLRAEGR-- 117

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
                    W   T P G           H G  ETS++L L+P  V+ +
Sbjct: 118 ------DAGWCPCTCPGG---------DPHAGHTETSVLLHLSPADVRTE 152


>gi|15643179|ref|NP_228223.1| creatinine amidohydrolase, putative [Thermotoga maritima MSB8]
 gi|4980918|gb|AAD35498.1|AE001720_12 creatinine amidohydrolase, putative [Thermotoga maritima MSB8]
          Length = 311

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 109/250 (43%), Gaps = 29/250 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE---HM 79
           ++++P+G+ E HGP+ P   DT +   +AE++       L   C   EPI Y      H+
Sbjct: 26  LIIIPVGSTENHGPNAPTGEDTFLVTRMAEQVA------LKTGCTVAEPIWYGYHPYHHI 79

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM-RFSML 138
            + GT  +     I++ +++I      G RK ++LN HG    +   +   A++ +   +
Sbjct: 80  GMPGTVPVKDEAFIDYLVSVIAGFWNTGFRKQILLNGHGQEFVIPIAIHKFAKIFQVPAI 139

Query: 139 VVSTSW-----SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           +++ +W      +F   +     P     IH  E+ETS  LAL P  +  + A    +  
Sbjct: 140 IINLNWYHAIQDKFKTKEE--GGPYETPFIHADEVETSWSLALFPEFMHQEWA--VDTEP 195

Query: 194 SEFLRNFKYLRAHG---------SHSFGWSMKDLN-PKGVVGNAMDATVKKGEGLLSYFA 243
             FL      +A            H  G  ++ +  P+GVVG A  A+ +K +  +    
Sbjct: 196 KGFLPEGHIDKAGNLLHRPIAWYGHVGGGPIEVVAYPEGVVGKATLASAEKAKEGVEALL 255

Query: 244 NCFIQLLNDI 253
           +   +L+ DI
Sbjct: 256 DYLEKLVRDI 265


>gi|315647315|ref|ZP_07900428.1| Creatininase [Paenibacillus vortex V453]
 gi|315277517|gb|EFU40846.1| Creatininase [Paenibacillus vortex V453]
          Length = 242

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 104/238 (43%), Gaps = 24/238 (10%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  +    R+    +LP+GA E HGPHLP+ TD ++AA LA++    L  R     +P
Sbjct: 6   ENSAEVKDKIRRLGAAILPIGAVEAHGPHLPLGTDNLLAARLADK----LAERTDSFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
             P G         G+  ++    I     I +++ + G R  +++N H GN+   + + 
Sbjct: 62  TLPYGQVWSLRNFPGSINVSNEALIRLLADIGESLYQQGFRIFIMVNGHLGNA---AALK 118

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG------IHGGEIETSMMLALAPHLVK 182
             AR+ +  +     +  F      I+    E        +H  EIETS ML LA   V 
Sbjct: 119 EAARILYERVPALKVFYFFYPGTKEITAEVREASAAHGTYMHADEIETSYMLYLAGEYVD 178

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           M  A +  +    F  +F            W  +++    V+G+A  AT +KGE ++ 
Sbjct: 179 MSKAID-GAPHIPFDADFT--------PTPW--EEMTASAVLGDATLATREKGERIIQ 225


>gi|110632440|ref|YP_672648.1| creatininase [Mesorhizobium sp. BNC1]
 gi|110283424|gb|ABG61483.1| Creatininase [Chelativorans sp. BNC1]
          Length = 267

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 94/197 (47%), Gaps = 12/197 (6%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI-KSILPPRLPVTCMPVEPIGYSIEHM 79
           D ++++P+G+ E  G H PM  D + A  +A+RI ++      P    PV P G      
Sbjct: 20  DAVILIPMGSLEDQGVHAPMG-DYLAAKLIADRIAQAATAAGTPTFTAPVIPFGAEDYFG 78

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              G   L  +        ++ ++ + G+++IV++N HGGN P+++ ++ + R    M +
Sbjct: 79  LTHGGIALRSSTLRALLDDMVGSLYRRGLKRIVLINGHGGNVPVITELALKWRRDKGMFI 138

Query: 140 VSTSWSRFTIPQGII-----SFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR-- 192
             TS   + +  GI+           +  HG +  TS+ L L P +++MDLA+   +   
Sbjct: 139 --TSLYLWQMAYGILRKELGDAEAARVSGHGADPLTSVGLHLYPEILRMDLAKGPPTNPM 196

Query: 193 -QSEFLRNFKYLRAHGS 208
            +   ++ + YL   GS
Sbjct: 197 LKGLKIQQYGYLEYEGS 213


>gi|195970706|gb|ACG60744.1| putative hydrolase [Streptomyces flavoviridis]
          Length = 276

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 82/187 (43%), Gaps = 17/187 (9%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP-RLPVT 65
            TD +    ADA +   VV P+GA EQHGPHLP++ D I+A   A  I   L    LP  
Sbjct: 11  LTDLTSEQVADAVRGRTVVWPIGAIEQHGPHLPLSVDLILAEAFATEIARELDAFTLPAQ 70

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
            +    +  S   ++  GT  +     +      + A+  + + ++V++N H  N P + 
Sbjct: 71  AIGARSLPQSGGGLFFPGTVYVGGDTLVRFLRDTLSALTVLPMARLVVVNGHYENEPFLF 130

Query: 126 IVSTEARMR----------FSML-VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMML 174
               + R R          FS   +V  +W+    P+    FP      H G  ETS+ML
Sbjct: 131 EALDQVRERGLLDGMEVFAFSWWSLVRDTWTDAETPR----FPGWH-AEHAGITETSLML 185

Query: 175 ALAPHLV 181
            L P LV
Sbjct: 186 HLRPDLV 192


>gi|225420011|ref|ZP_03762314.1| hypothetical protein CLOSTASPAR_06354 [Clostridium asparagiforme
           DSM 15981]
 gi|225041362|gb|EEG51608.1| hypothetical protein CLOSTASPAR_06354 [Clostridium asparagiforme
           DSM 15981]
          Length = 371

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 103/250 (41%), Gaps = 23/250 (9%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR---L 62
           I T N   +    RK+ IV +P+G  E HG H     DT +   + E ++     +    
Sbjct: 59  IQTTNRSRVIERRRKNDIVFVPIGCTENHGKHANTGLDTFMVTQILEGLRRYTAKQGREC 118

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            +   P+   G+   H+ + GT  + +    E  + ++  +   G RKI+++N HG    
Sbjct: 119 SIAFTPLNYGGHPYHHIAMPGTVNMPHEVVQETIIYMMLGLWNDGFRKIILVNNHGHLWM 178

Query: 123 L-VSIVSTEARMRFSMLVVSTSWSR----FTIPQGIISFPETEIGIHGGEIETSMMLALA 177
           L  +I     R +   +     W R    F IP       ET   IH  EIETSM + L 
Sbjct: 179 LEAAIQEFCKRFQLPGIFRVIDWHRAIREFFIPVDRGDSFETTF-IHADEIETSMGMLLF 237

Query: 178 PHLVKMDLAE-----------NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGN 226
           P ++ M+ AE           +F      + R  ++    G  +   +     P+GVVGN
Sbjct: 238 PEMMDMEQAEEAWPKGYLPDGHFDVSVDAYRRPCRWSEGQGHQAIEIAG---TPEGVVGN 294

Query: 227 AMDATVKKGE 236
              AT +K +
Sbjct: 295 PKLATARKAK 304


>gi|319951175|ref|ZP_08025019.1| creatinine amidohydrolase [Dietzia cinnamea P4]
 gi|319435163|gb|EFV90439.1| creatinine amidohydrolase [Dietzia cinnamea P4]
          Length = 229

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 99/218 (45%), Gaps = 30/218 (13%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLPLGA EQHGPHLP  TDT++A   A  +         V  +P    G S EH   D
Sbjct: 16  LAVLPLGATEQHGPHLPPETDTLLATATARALAPG-----DVRVLPGLAYGASGEHQAFD 70

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMG--IRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           GT ++   EA+     II+  R +     ++V++N HGGN   + +     R+R+     
Sbjct: 71  GTVSIGT-EALAG--TIIELGRSVSAWADRLVVVNGHGGNVDALRLAVP--RLRYEGR-- 123

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
             +W    +P       E     H G  ETS++L L P LV++DLA           R  
Sbjct: 124 DAAW----LP---CRTSEDPTDTHAGHAETSLLLHLHPDLVRVDLAAPGCV--EPLPRIL 174

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
             LR  G       +  ++P GV+G+   A+  +G  L
Sbjct: 175 PALREGG-------VAAVSPNGVLGDPTTASADEGRRL 205


>gi|186471044|ref|YP_001862362.1| creatininase [Burkholderia phymatum STM815]
 gi|184197353|gb|ACC75316.1| Creatininase [Burkholderia phymatum STM815]
          Length = 277

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 82/177 (46%), Gaps = 19/177 (10%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTD----TIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           W V++PLGA EQHGPH+ MN D    T I   +A  I++++ P +       +  G    
Sbjct: 36  WPVLIPLGALEQHGPHMSMNPDVLLPTAIGIAVARNIEALVAPAIAYGYKSQQKSGGG-- 93

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR--- 134
             ++ GT +L           I+    + G R I ++N H  NS + ++   +  +R   
Sbjct: 94  -NHLCGTTSLDGHTLTSTIKDILKEFARHGARSICLINGHFENS-MFAVEGIDLALRELK 151

Query: 135 ----FSMLVVSTSWSRFTIPQGIIS-FPETEIGI---HGGEIETSMMLALAPHLVKM 183
                 + VV  S+  F     I   +P+   G    HGG +ETS+ML L PHLV M
Sbjct: 152 WEGTCDLQVVMLSYWDFVTETTIARIYPDGFPGWAVEHGGVLETSLMLHLHPHLVDM 208


>gi|110634210|ref|YP_674418.1| hypothetical protein Meso_1860 [Mesorhizobium sp. BNC1]
 gi|110285194|gb|ABG63253.1| Uncharacterized protein putative amidase-like protein
           [Chelativorans sp. BNC1]
          Length = 273

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 112/256 (43%), Gaps = 29/256 (11%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +D ++++PLG+ E+ GPH PM         L+ER+ + +  R      P  P GY+    
Sbjct: 20  EDPVILVPLGSQEEQGPHAPMGDFM-----LSERLAAAVAERSGAIAAPTIPFGYADVFR 74

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
            + G   L  A         I A    G+R+IV+ N H GN+ L+     E ++R  +++
Sbjct: 75  GMAGGIQLRPATFCALLEDTIAAFLDHGLRRIVLFNGHTGNAGLIDQTVRELKIRTGLII 134

Query: 140 VSTS-WSRFTIPQGIISFPETEI----GIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
            S + W    IP  + +    ++    G HG +  TS+     P L++ DL      + S
Sbjct: 135 PSINIWK--AIPHELWTRLHGDLAERAGGHGADPITSVYWHYFPELMRPDL-----QKTS 187

Query: 195 EFLRNFKY-------LRAHGSH-SFGWSMKDLNPKGVV-GNAMDATVKKGEGLLSY---F 242
           E  + F +       +   G   +      D+NP G++ GN+  ++ + G     +   F
Sbjct: 188 EAAKAFGHEPVGLSAISFQGCEVAVPLDALDVNPHGLIGGNSRLSSAEIGAAFAEHIISF 247

Query: 243 ANCFIQLLNDINSFDV 258
           A  F++   + +  D+
Sbjct: 248 AAEFVKHFRNCDPADL 263


>gi|298293563|ref|YP_003695502.1| creatininase [Starkeya novella DSM 506]
 gi|296930074|gb|ADH90883.1| Creatininase [Starkeya novella DSM 506]
          Length = 259

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 89/192 (46%), Gaps = 39/192 (20%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           ++D IV LP+G+ EQHGPHLP+ TDT+    +A  +A+R+  ++ P          P+ Y
Sbjct: 19  KEDPIVFLPIGSVEQHGPHLPLATDTLLPLAVAQQVADRVGGLVAP----------PVAY 68

Query: 75  SIEHM-------YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
             +         +  GT +L     I     I++ + + G+R+IV+ + H  N   +   
Sbjct: 69  GYKSQPKSGGGNHFPGTLSLDAGVLIGLVRNIVNELVRHGVRRIVLFDGHMENQWFLVEA 128

Query: 128 STEARMRFSML--------------VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMM 173
           +  A    +ML               ++ +  +   P G   FP  E+  H   +ETS+M
Sbjct: 129 ADLALRDQAMLGRTDVRIVKLGYWEFITKATEKVLFPDG---FPSWELE-HAAVMETSVM 184

Query: 174 LALAPHLVKMDL 185
           L + P LV+ +L
Sbjct: 185 LHIRPDLVREEL 196


>gi|108805822|ref|YP_645759.1| creatininase [Rubrobacter xylanophilus DSM 9941]
 gi|108767065|gb|ABG05947.1| Creatininase [Rubrobacter xylanophilus DSM 9941]
          Length = 264

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 87/185 (47%), Gaps = 35/185 (18%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV-EPIGYSIEHMYVD- 82
           ++P GA EQHGPH+P+  D  ++  +A+ + +        T +PV  P+ Y +   + D 
Sbjct: 43  IVPFGAVEQHGPHMPLCVDWNMSYHVAQGVSA-------ATGVPVLHPVIYGVSASHGDF 95

Query: 83  -GTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
            GT +L   T+   +E    I++ +   G+R+ ++LN H  N   + + + + R R+  +
Sbjct: 96  PGTISLRPETFLAVVED---IVNWLYHSGVRQFILLNGHAWNGAPLQVCAEKIRTRYDDV 152

Query: 139 VVSTSWSRFTIPQGIISFPETEIG---------IHGGEIETSMMLALAPHLVKMDLA--- 186
                  R      +  +P +EI           H    ETS ML + P LVKMD A   
Sbjct: 153 -------RVRALDYVDMYPPSEIDGRYTYGRLLAHANYFETSCMLYVNPDLVKMDRATSK 205

Query: 187 ENFSS 191
           ++F S
Sbjct: 206 QDFDS 210


>gi|323692989|ref|ZP_08107210.1| hypothetical protein HMPREF9475_02073 [Clostridium symbiosum
           WAL-14673]
 gi|323502990|gb|EGB18831.1| hypothetical protein HMPREF9475_02073 [Clostridium symbiosum
           WAL-14673]
          Length = 244

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 99/241 (41%), Gaps = 35/241 (14%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAG----LAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++LP GA E +GPH P+  D ++A      LAERI  I+ P L V        G S    
Sbjct: 23  IILPSGACEVYGPHNPLGADILVAKKMSEMLAERIDGIVGPCLEV--------GQSKSLT 74

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              GT  ++       +  II    ++G +   I+N H  N+  ++ V  +AR++  +  
Sbjct: 75  SFPGTIAISGETLKAVYSEIIAEFVRLGFKNFFIVNNHLHNTQPLNEVLEDARIKNGIKY 134

Query: 140 VSTS-WSRFTIPQGIISFPETEI-GIHGGEIETSMMLALAPHLVKMDLAEN----FSSRQ 193
                W             ET     H  E +TS+++ L P LV M  A N    F  R 
Sbjct: 135 AQVGVWQYLPAVSDNTGMWETPAPHAHASEAQTSVLMYLFPELVDMSKAPNTPMMFDDRW 194

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG----EGLLSYFANCFIQL 249
              +++  Y           SM D    G +GNA  AT +KG    E +L+   +C    
Sbjct: 195 PAIMKSVPYS----------SMTD---SGTLGNAQSATAEKGKRAVELMLAEMEDCVRNY 241

Query: 250 L 250
           L
Sbjct: 242 L 242


>gi|219668090|ref|YP_002458525.1| creatininase [Desulfitobacterium hafniense DCB-2]
 gi|219538350|gb|ACL20089.1| Creatininase [Desulfitobacterium hafniense DCB-2]
          Length = 252

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 89/189 (47%), Gaps = 16/189 (8%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R+  + ++P G+ EQHGPHLP  TD      +A ++ S L   L    +P    G +  H
Sbjct: 22  RRSQLAIIPNGSVEQHGPHLPCGTDHYCIMAIARKVASGLDGLL----LPFSHTGVTPFH 77

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT TL     +   L    ++   G++KI+ +N H GN+  ++  +++ +  + + 
Sbjct: 78  ASFAGTLTLRQETYVNLLLDTAVSVINHGVQKILFVNWHEGNTTSINYAASQLQKEYGVT 137

Query: 139 VVSTSWSRFT--IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS----SR 192
            V       T  + +G     E ++  H G +E   ++A  P L+K++ A N S    ++
Sbjct: 138 CVVAQACYITEQLYKG-----EADL-THAGALEVLPVMAYRPDLLKLERATNPSPYEAAK 191

Query: 193 QSEFLRNFK 201
           + + LR  K
Sbjct: 192 EVDALRRSK 200


>gi|119383770|ref|YP_914826.1| creatininase [Paracoccus denitrificans PD1222]
 gi|119373537|gb|ABL69130.1| Creatininase [Paracoccus denitrificans PD1222]
          Length = 263

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 106/250 (42%), Gaps = 44/250 (17%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           +++P+G+ EQHG H+P++ D ++    A R+       L    +   P  Y  +      
Sbjct: 27  ILIPVGSMEQHGHHMPLHVDVLLPTEFARRVA------LETGGLVAPPFTYGYKSHQKSG 80

Query: 80  ---YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTEARMR 134
              ++ GT +L  A  +     +I    + G+R+I ++N H  NS  +   I      +R
Sbjct: 81  GGNHLPGTTSLDGATLVSALRDVIKEFARHGVRRICMVNGHYENSWFIIEGIDLALRELR 140

Query: 135 F----SMLVVSTSWSRFT--------IPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           +     M +V  S+  F          P G   FP  E+  HGGE+ETS+MLAL P LV 
Sbjct: 141 WDGITGMKIVVLSYWDFVGEADISRLYPDG---FPGWELE-HGGELETSLMLALYPTLV- 195

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNP-KGVVGNAMDATVKKGEGLLSY 241
            DL+       ++F     Y           +  +  P  G + +  DA+ +KGE LL  
Sbjct: 196 -DLSRAVDVEPAQFPPYDVYP----------AKPEWTPASGTLSSPKDASAEKGELLLEV 244

Query: 242 FANCFIQLLN 251
                +  L 
Sbjct: 245 CTKGIVAALR 254


>gi|114778549|ref|ZP_01453376.1| Creatininase [Mariprofundus ferrooxydans PV-1]
 gi|114551138|gb|EAU53698.1| Creatininase [Mariprofundus ferrooxydans PV-1]
          Length = 259

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 99/236 (41%), Gaps = 30/236 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH-MYVD 82
            +LP+GA EQHGPHL    D  IA  L +++ +       +  +P+ P G SI H     
Sbjct: 17  AMLPVGATEQHGPHLGCGMDAEIAGKLCDQVAAA----TDIALLPLLPYGCSIGHSKRWP 72

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  L     I+    I D +   G +++ I+N+H  N   +       R  +  L+V+ 
Sbjct: 73  GTLALQPKTLIDVVKQIGDWVHAAGFKRLFIVNSHVTNLAPLRCALEMLRADYDDLMVA- 131

Query: 143 SWSRFTIPQGIIS-------FPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
                 I  G +S       F + E   H  E ETS+MLA++P +V+            E
Sbjct: 132 -----LINTGTLSARVRERHFQDAE-DWHANEAETSLMLAVSPQMVR-----------PE 174

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
            L +       G   F   +   +  GV G    A+ ++GE L ++      +L+ 
Sbjct: 175 RLADSDDEDRTGDCVFSHPVNRTSLNGVTGTPSLASRERGEELFAWMVEDLSELIR 230


>gi|126433638|ref|YP_001069329.1| creatininase [Mycobacterium sp. JLS]
 gi|126233438|gb|ABN96838.1| Creatininase [Mycobacterium sp. JLS]
          Length = 235

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 74/161 (45%), Gaps = 16/161 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++P+G+ EQHGPHLP++TDT IA  +A  +   L P    +  P    G S EH    G
Sbjct: 22  LIVPVGSTEQHGPHLPLDTDTRIATAVAREVAGTLTPSW--SLAPAVGYGASGEHESFPG 79

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T ++  A A+   L            ++V LN HGGN+   ++    A +R+    V  +
Sbjct: 80  TISIGTA-ALRLLLVEFGRSATNWASRVVFLNGHGGNTE--ALAGATALLRYEDRDV--A 134

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           W               +   H G  ETS++L ++P  V  D
Sbjct: 135 WCPCIA---------KDSDAHAGHTETSVLLHISPDDVHTD 166


>gi|302336578|ref|YP_003801784.1| creatininase [Spirochaeta smaragdinae DSM 11293]
 gi|301633763|gb|ADK79190.1| Creatininase [Spirochaeta smaragdinae DSM 11293]
          Length = 253

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 111/253 (43%), Gaps = 36/253 (14%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY-V 81
           +V++P+G+ E HG H+P+ TDT+I   + E ++      L     P  P G + E +Y  
Sbjct: 20  LVIIPIGSIECHGKHMPLGTDTLIPDKIIELLRRQEDRFL---IAPTIPYG-ACESLYPF 75

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT  L      E    I++ +++ G +K V+LN HGGN   +  +  E      ++ + 
Sbjct: 76  PGTVNLGTDLLYELMKTIVENLKRHGAKKFVVLNGHGGNIKALERIGYELDADGCLMAIL 135

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK----------MDLAEN--- 188
             W            PE + G HGG  ET+ ++A+ P LV            DL++    
Sbjct: 136 NWWLNVWEMN-----PEWK-GGHGGGEETAAVMAIDPDLVDRSYIDLPLEITDLSDTIKG 189

Query: 189 --FSSRQSEFLR-NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
             F++ Q + +      L  H + S GW   D +PK        ATV+ G  +L  F N 
Sbjct: 190 SGFNTVQYDNITVTIPRLTNHVT-SNGWIGPD-HPKY-------ATVEWGSEMLQTFTNF 240

Query: 246 FIQLLNDINSFDV 258
            +  L +    ++
Sbjct: 241 MVSFLKEFEKVEL 253


>gi|299139968|ref|ZP_07033139.1| Creatininase [Acidobacterium sp. MP5ACTX8]
 gi|298598115|gb|EFI54282.1| Creatininase [Acidobacterium sp. MP5ACTX8]
          Length = 290

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 79/170 (46%), Gaps = 11/170 (6%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM-PVEPIGYSIEHMYVD 82
            +LP+G  E+HGP LP+ TD      L  R  S+   +L    + P    G   E  +  
Sbjct: 47  CILPIGIIEKHGPQLPLGTDL-----LNVRFASLNAAKLEYAVVSPEYYFGQIFEARHEP 101

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT   + +  +      ++ + + G  KI+I+N HGGN+ L+ + +          VV  
Sbjct: 102 GTIAYSLSTQLVLLQETVNELGRNGCHKILIVNGHGGNNSLLPLFAQSQLASPHDYVVYV 161

Query: 143 SWSRFTIPQGIISFP--ETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
             S   IP+     P  ++   +H GE ETS MLA  P LV M+ A++ S
Sbjct: 162 MGS---IPRDGAGRPSQKSAADLHAGEAETSAMLANRPDLVHMERAKSES 208


>gi|298250478|ref|ZP_06974282.1| Creatininase [Ktedonobacter racemifer DSM 44963]
 gi|297548482|gb|EFH82349.1| Creatininase [Ktedonobacter racemifer DSM 44963]
          Length = 252

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 114/255 (44%), Gaps = 52/255 (20%)

Query: 14  LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIK-------SILPPRLPVTC 66
           L +D R+  + +LP+G+ EQHGP+LP++TD  IA  LA+++        ++L P LP +C
Sbjct: 11  LKSDRRR--VAILPIGSIEQHGPYLPVDTDARIAELLAQKLSVGLGEEMALLLPALPFSC 68

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIR-----KIVILNAHGGNS 121
                   S EH  + GT  LT    +    A I  I K  +R      ++++N HGGN 
Sbjct: 69  --------SWEHAGL-GTVALT----VTTLAATIHDIAKSLMRWETPFLLLLVNWHGGND 115

Query: 122 PLVSIVSTE--ARMRFSMLV------VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMM 173
            L+  ++TE  A  +    V      V  +W R        S   T   +HGG IET +M
Sbjct: 116 -LLGALATEITAVEQIPCAVIPGSAQVGAAWER--------SRMTTAKDVHGGAIETGIM 166

Query: 174 LALAPHLVKMDLAENFS-SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATV 232
            A  P LV   ++ +     Q    +    L+A GS+        +  +G+ G   DA  
Sbjct: 167 RAYWPELVPEAISGDAHFEPQIAPAKTQPVLQAIGSYG-------ITRQGIWGAPEDADP 219

Query: 233 KKGEGLLSYFANCFI 247
           +K   L+       +
Sbjct: 220 EKARILIEQLVQSMV 234


>gi|329765898|ref|ZP_08257463.1| creatininase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329137604|gb|EGG41875.1| creatininase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 244

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 105/225 (46%), Gaps = 26/225 (11%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +K+ + V+P+G+ EQHGPHLP++TD+ I   +A+R    L  +     +P    G S EH
Sbjct: 18  KKNQVAVIPIGSIEQHGPHLPISTDSDIVTEVAKR----LSKKKDFLLLPTITYGVSYEH 73

Query: 79  --MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRF 135
              +    K  T    +   + +  ++    I+ I I+N H GN  PL +I     ++  
Sbjct: 74  APFFNLSIKESTLRSIV---IDLCTSLFVNDIKTIFIINGHHGNLKPLKNIDRKLQQISG 130

Query: 136 SML-VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
           + L V S S+  F          + E   H G +ETS+MLA++ + VKM LA+       
Sbjct: 131 NRLRVFSLSYWHFM---------KREFD-HAGFVETSLMLAVSNN-VKMKLAKKGLVTDG 179

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
              +  K L      SF    K+    G+ G+   A+ K G+ +L
Sbjct: 180 MKQQQIKKLGQLAEISFPKVTKN----GIWGDPRKASKKDGQIIL 220


>gi|94968660|ref|YP_590708.1| creatininase [Candidatus Koribacter versatilis Ellin345]
 gi|94550710|gb|ABF40634.1| Creatininase [Candidatus Koribacter versatilis Ellin345]
          Length = 293

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 77/178 (43%), Gaps = 13/178 (7%)

Query: 25  VLPLGAYEQHGPHLPMNTD--TIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
            LP+G  E+HGPH+P+ TD   +  A L    K        V   P    G   E     
Sbjct: 49  ALPIGILEKHGPHMPIGTDLLNVRYAALHAAEKEY------VIVFPEYYFGQIFEARQEP 102

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF--SMLVV 140
           GT   +    ++     ++ + + G +KIVI+N HGGN  L+ + + +A++      +V 
Sbjct: 103 GTIAYSLDLQLKLLQETVNEMARNGCKKIVIINGHGGNESLLPLFA-QAQLATPKDFVVF 161

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
                R  +P          + +H G  ETS M+   P L+KMD     S R  + L+
Sbjct: 162 VYGLPRLEVPGRPAK--NDSVDMHAGSSETSHMMVTHPELLKMDKVNTESGRDQDRLK 217


>gi|108797976|ref|YP_638173.1| creatininase [Mycobacterium sp. MCS]
 gi|119867072|ref|YP_937024.1| creatininase [Mycobacterium sp. KMS]
 gi|108768395|gb|ABG07117.1| Creatininase [Mycobacterium sp. MCS]
 gi|119693161|gb|ABL90234.1| Creatininase [Mycobacterium sp. KMS]
          Length = 218

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 95/217 (43%), Gaps = 27/217 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++P+G+ EQHGPHLP++TDT IA  +A  +   L P    +  P    G S EH    G
Sbjct: 5   LIVPVGSTEQHGPHLPLDTDTRIATAVAREVAGTLTPSW--SLAPAVGYGASGEHESFPG 62

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T ++  A A+   L            ++V LN HGGN+   ++    A +R+    V  +
Sbjct: 63  TISIGTA-ALRLLLVEFGRSATNWASRVVFLNGHGGNTE--ALAGATALLRYEDRDV--A 117

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF-KY 202
           W               +   H G  ETS++L ++P  V  D   ++    +  LR+    
Sbjct: 118 WCPCIA---------KDSDAHAGHTETSVLLHISPDDVHTD---HWERGNTAPLRDLMPA 165

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LR  G       +  ++  GV+G+   AT   G  L 
Sbjct: 166 LRQGG-------VAAVSEVGVLGDPTTATGADGARLF 195


>gi|258620075|ref|ZP_05715114.1| creatinine amidohydrolase [Vibrio mimicus VM573]
 gi|258587433|gb|EEW12143.1| creatinine amidohydrolase [Vibrio mimicus VM573]
          Length = 243

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 107/236 (45%), Gaps = 26/236 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG--YSIEHM- 79
           I  LPLGA E HG HLP+ TD+ +A      I  + P   P   +P  P    +S++   
Sbjct: 20  IAFLPLGATEPHGDHLPLGTDSYLAEHFTALIAELFP--YPSVILPTLPYSQVWSLKGFA 77

Query: 80  -YVD-GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             +D G + LT+       + +   ++  GI  +V++NAH GN   +   +   +   + 
Sbjct: 78  GAIDIGNELLTHL-----VVKLAKNMQSYGISTLVVINAHYGNFDALKSAARLLKENGAE 132

Query: 138 LVVSTSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLA-ENFSSRQSE 195
           L V +     ++ + I    E   G +H  EIETS+ LAL    V M LA EN+      
Sbjct: 133 LFVFSWPGTDSVIKQIRESKEARKGYMHACEIETSIALALIKDEVDMSLAKENYPI---- 188

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
           F  +F YL         W+  + +   ++G+   AT  KG+ ++   +   +++L 
Sbjct: 189 FPTHFSYL------PIQWT--EFSQTAILGDPTKATQNKGQIIVEASSKTIVEILT 236


>gi|329927337|ref|ZP_08281596.1| creatininase [Paenibacillus sp. HGF5]
 gi|328938476|gb|EGG34861.1| creatininase [Paenibacillus sp. HGF5]
          Length = 242

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 105/241 (43%), Gaps = 30/241 (12%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS+ +    RK    +LP+GA E HGPHLP+ TD ++A+ LA++    L  R     +P
Sbjct: 6   ENSVEVEEKIRKLGAAILPIGAVEAHGPHLPLGTDNLLASRLADK----LAERTDSFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
             P G         G+  ++    I     I ++I   G R  +++N H GN+     + 
Sbjct: 62  TLPYGQVWSLRNFPGSINVSNEALIRLLADIGESIYHQGFRLFIMVNGHLGNA---VAMK 118

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG------IHGGEIETSMMLALAPHLVK 182
             AR+ +  +     +  F      I+    E        +H  EIETS ML LA   V 
Sbjct: 119 EAARILYERVPELKVFYFFYPGTKEITAEVREASAAHGSYMHADEIETSYMLYLAGEYVD 178

Query: 183 MDLAENFSSR---QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           M  A + + +   +++F                W  +++    V+G+A  AT +KGE ++
Sbjct: 179 MSKAIDGAPQIPIEADFTPT------------PW--EEMTASAVLGDATLATREKGERII 224

Query: 240 S 240
            
Sbjct: 225 E 225


>gi|302876628|ref|YP_003845261.1| Creatininase [Clostridium cellulovorans 743B]
 gi|307687302|ref|ZP_07629748.1| Creatininase [Clostridium cellulovorans 743B]
 gi|302579485|gb|ADL53497.1| Creatininase [Clostridium cellulovorans 743B]
          Length = 277

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 111/264 (42%), Gaps = 43/264 (16%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI--GYSI 76
           +++ +V+LP+   E+HGPHLP+ TDT +   + + I+  L  ++ V  +   P   G ++
Sbjct: 23  KQEAVVLLPVAVIEEHGPHLPLGTDTYLTYAMFKHIQDEL-DKVNVKSVIAPPFYWGINV 81

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
                 G+ T+            I+ +   G + + ILN HG +    +IV T       
Sbjct: 82  ATSGFPGSFTVKVDTMKAVLKDTIECLYNWGFKNVYILNMHGDSLHSKTIVETVKE---- 137

Query: 137 MLVVSTSWSRF--TIP---QGIISFPETE---------------------IGIHGGEIET 170
           +  VS    +    IP   Q I+   ++E                     + IH G  ET
Sbjct: 138 IYEVSQKDKKVYNIIPEFFQKIMGLDDSEPYLLIQKEDHDEPPVNDENPYMDIHAGGFET 197

Query: 171 SMMLALAPHLVKMDLAENFSSRQS--EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM 228
           S+ML     LV  ++A+ F S ++  E LR ++     G        +++ P G  GN  
Sbjct: 198 SLMLLEFKELVNEEMAKGFESSKTTFELLRKWQQGGVEG--------REITPLGYCGNPS 249

Query: 229 DATVKKGEGLLSYFANCFIQLLND 252
           +  +K+ +     F    ++L+ D
Sbjct: 250 NINLKEAKEFTDAFVKLTVELIVD 273


>gi|302344594|ref|YP_003809123.1| creatininase [Desulfarculus baarsii DSM 2075]
 gi|301641207|gb|ADK86529.1| Creatininase [Desulfarculus baarsii DSM 2075]
          Length = 240

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 101/225 (44%), Gaps = 32/225 (14%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R+    +LP+G  EQHGPHLP+  D + A  LA+   +I P      C  + P+ Y I  
Sbjct: 16  RQVEAAILPIGVMEQHGPHLPLGLDAMHALALAQAAAAIEP------CFVLPPLFYGICR 69

Query: 79  MYVDGTKTLTYA----EAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
              +   T+  +     A+ H   I   +   GIR + +L  H G +   +++    R+ 
Sbjct: 70  STANHPGTIGISGDALRAVLH--DIGQGVWSQGIRCLCLLTGHAGGTHQSALIEAGERLL 127

Query: 135 FSM-LVVSTSWSRFTIPQG--IISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSS 191
            S  L V+T      + +   I+  P      H GE+ETS+ + L P LV+   AE + S
Sbjct: 128 TSTGLQVATVCVLDLLAEARPILQCPGDS---HAGEVETSLAMHLWPGLVQGSAAEEYPS 184

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
               F R F+ +R   +H   W      P GV G+   A+ +KG 
Sbjct: 185 ----FPR-FRLVRDKRAH---W------PGGVWGDPTKASAEKGR 215


>gi|322370059|ref|ZP_08044621.1| Creatininase [Haladaptatus paucihalophilus DX253]
 gi|320550395|gb|EFW92047.1| Creatininase [Haladaptatus paucihalophilus DX253]
          Length = 245

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 104/242 (42%), Gaps = 14/242 (5%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP+G+ EQHGPH P+ TD + A  +A+   +       V   P   +G S EH    
Sbjct: 18  LALLPVGSTEQHGPHAPLGTDWLNAEAVADAGAAAYDGE--VVVAPPISVGVSEEHRQFT 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  ++      +    + ++   G  ++VI+N HGGN   +  V+           V  
Sbjct: 76  GTLWVSEDTFRRYVRETVASLAHHGWNRVVIVNGHGGNVAALREVAGTITRHDEAYAVPF 135

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           +W         +    +++G H G +ET+ +    P LV+ D  E      S+    +  
Sbjct: 136 TWFE------AVGDHRSDMG-HAGPLETAFLRHTRPDLVREDEIEAAREGASDGWGEWVS 188

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFD 262
                  +  +   +    GVVG+  D   ++GE LL       ++LL+ + S DVS  D
Sbjct: 189 YT-----NLAYDSAEFTENGVVGDPTDGDEERGEELLELATQSLVKLLSAVESRDVSRPD 243

Query: 263 KD 264
           ++
Sbjct: 244 RE 245


>gi|300712290|ref|YP_003738104.1| hypothetical protein HacjB3_14665 [Halalkalicoccus jeotgali B3]
 gi|299125973|gb|ADJ16312.1| hypothetical protein HacjB3_14665 [Halalkalicoccus jeotgali B3]
          Length = 245

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 93/217 (42%), Gaps = 22/217 (10%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP+G+ EQHGPH P+ TD   A  +AE           V   P  P+G + EH +  
Sbjct: 18  LALLPVGSTEQHGPHAPLGTDVETATAVAEAASEAYDGE--VVVAPAIPVGIAEEHRHFS 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  ++      +    + ++   G  ++V++N HGGN P +  V        +   V  
Sbjct: 76  GTLWVSPDTFRSYVRETVASLAYHGWDRVVVVNGHGGNVPALGEVCATICRHDAANAVPY 135

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD----LAENFSSRQSEFLR 198
           +W      Q        ++G HGG +ET+++  + P L++ D      E  + R  E++ 
Sbjct: 136 TWFEGVGDQ------RHDMG-HGGPLETALLRWVEPDLIREDRIDEAREGAAERWGEWVS 188

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
                      +      +    GVVG+  + + ++G
Sbjct: 189 RV---------NLAVDSAEFTENGVVGDPEEGSKERG 216


>gi|218506268|ref|ZP_03504146.1| probable creatininase protein [Rhizobium etli Brasil 5]
          Length = 145

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I +LP+ + EQHGPHLP+ TD  IA G+   ++   P  L    +P + IG + EH+Y  
Sbjct: 24  IAILPIASTEQHGPHLPIATDVAIANGMLAELRKQKPADLDFLVLPTQEIGKANEHVYGP 83

Query: 83  GTKTLTYAEAIEHWLAI 99
           GT +L+    I  W AI
Sbjct: 84  GTLSLSAELLIPVWTAI 100


>gi|261408617|ref|YP_003244858.1| Creatininase [Paenibacillus sp. Y412MC10]
 gi|261285080|gb|ACX67051.1| Creatininase [Paenibacillus sp. Y412MC10]
          Length = 242

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 104/241 (43%), Gaps = 30/241 (12%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS+ +    RK    +LP+GA E HGPHLP+ TD ++A+ LA++    L  R     +P
Sbjct: 6   ENSVEVEEKIRKLGAAILPIGAVEAHGPHLPLGTDNLLASRLADK----LAERTDSFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
             P G         G+  ++    I     I ++I   G R  +++N H GN+     + 
Sbjct: 62  TLPYGQVWSLRNFPGSINVSNEALIRLLADIGESIYHQGFRIFIMVNGHLGNA---VALK 118

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG------IHGGEIETSMMLALAPHLVK 182
             AR+ +  +     +  F      I+    E        +H  EIETS ML LA   V 
Sbjct: 119 EAARILYERVPELKVFYFFYPGTKEITAEVREASAAHGSYMHADEIETSYMLYLAGEYVD 178

Query: 183 MDLAENFSSR---QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           M  A + +     +++F                W  +++    V+G+A  AT +KGE ++
Sbjct: 179 MSKAIDGAPHIPIEADFTPT------------PW--EEMTASAVLGDATLATREKGERII 224

Query: 240 S 240
            
Sbjct: 225 E 225


>gi|320102211|ref|YP_004177802.1| Creatininase [Isosphaera pallida ATCC 43644]
 gi|319749493|gb|ADV61253.1| Creatininase [Isosphaera pallida ATCC 43644]
          Length = 255

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 77/175 (44%), Gaps = 5/175 (2%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAE-RIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           + VLPLGA E H  HLP  TDT     LAE   +        V  +P  P G     M  
Sbjct: 22  VAVLPLGATEPHNLHLPYGTDTFQVRVLAELACRKARREGAAVIELPAIPYGTESNLMRF 81

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
                L  +        ++D++   G+   ++LN HGGN   +  +  E   R  + +  
Sbjct: 82  PLAMNLQPSTLGRVVADLVDSLAAHGVPHCLLLNGHGGND--LKWLLRELTGRTPVNLFL 139

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
             W +  + +    F +   G H G +ETSM LA  P LV +D A++ ++ Q+ F
Sbjct: 140 CHWWKVGLDEAKRHFEDP--GDHAGALETSMGLAHFPELVFLDQADDGATAQTRF 192


>gi|258624876|ref|ZP_05719804.1| creatinine amidohydrolase [Vibrio mimicus VM603]
 gi|258582874|gb|EEW07695.1| creatinine amidohydrolase [Vibrio mimicus VM603]
          Length = 243

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 107/236 (45%), Gaps = 26/236 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG--YSIEHM- 79
           I  LPLGA E HG HLP+ TD+ +A      I  + P   P   +P  P    +S++   
Sbjct: 20  IAFLPLGATEPHGDHLPLGTDSYLAEHFTALISELFP--YPSVILPTLPYSQVWSLKGFA 77

Query: 80  -YVD-GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             +D G + LT+       + +   ++  GI  +V++NAH GN   +   +   +   + 
Sbjct: 78  GAIDIGNELLTHL-----VVKLAKNMQSYGISTLVVINAHYGNFDALKSAARLLKENGAE 132

Query: 138 LVVSTSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLA-ENFSSRQSE 195
           L V +     ++ + I    E   G +H  EIETS+ LAL    V M LA EN+      
Sbjct: 133 LFVFSWPGTDSVIKQIRESKEAYKGYMHACEIETSIALALIKDEVDMSLAKENYPI---- 188

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
           F  +F YL         W+  + +   ++G+   AT  KG+ ++   +   +++L 
Sbjct: 189 FPTHFSYL------PIQWT--EFSQTAILGDPTKATQNKGQIIVEASSKTIVEILT 236


>gi|282856530|ref|ZP_06265805.1| creatininase [Pyramidobacter piscolens W5455]
 gi|282585651|gb|EFB90944.1| creatininase [Pyramidobacter piscolens W5455]
          Length = 261

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 57/125 (45%), Gaps = 2/125 (1%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           D + ++PLG+ EQHG   P+ TD  I   +A R+++  P RL V  +P  P G    H  
Sbjct: 18  DLLALVPLGSTEQHGSIGPLGTDFAIPEEMARRLEAQYPDRLVV--LPTMPYGVCPYHTE 75

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT  +  A       ++ + +   G+R+   LN HGGN P +         R  +  +
Sbjct: 76  FSGTIDIGTAALQSVMTSVAEHLMNAGVRRFAFLNGHGGNDPALEAACLGIYERGGLGAI 135

Query: 141 STSWS 145
              W+
Sbjct: 136 LDWWT 140


>gi|262172974|ref|ZP_06040651.1| creatinine amidohydrolase [Vibrio mimicus MB-451]
 gi|261890332|gb|EEY36319.1| creatinine amidohydrolase [Vibrio mimicus MB-451]
          Length = 243

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 107/236 (45%), Gaps = 26/236 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG--YSIEHM- 79
           I  LPLGA E HG HLP+ TD+ +A      I  + P   P   +P  P    +S++   
Sbjct: 20  IAFLPLGATEPHGDHLPLGTDSYLAEHFTALIAELFP--YPSVILPTLPYSQVWSLKGFA 77

Query: 80  -YVD-GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             +D G + LT+       + +   ++  GI  +V++NAH GN   +   +   +   + 
Sbjct: 78  GAIDIGNELLTHL-----VVKLAKNMQSYGISTLVVINAHYGNFDALKSAARLLKENGAE 132

Query: 138 LVVSTSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLA-ENFSSRQSE 195
           L V +     ++ + I    E   G +H  EIETS+ LAL    V M LA EN+      
Sbjct: 133 LFVFSWPGTDSVIKQIRESKEAYKGYMHACEIETSIALALIKDEVDMSLAKENYPI---- 188

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
           F  +F YL         W+  + +   ++G+   AT  KG+ ++   +   +++L 
Sbjct: 189 FPTHFSYL------PIQWT--EFSKTAILGDPTKATQNKGQIIVEASSKTIVEILT 236


>gi|332830108|gb|EGK02736.1| hypothetical protein HMPREF9455_00986 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 251

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 103/231 (44%), Gaps = 41/231 (17%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGL----------AERIKSILPPRLPVTCM--PVE 70
             VLP GA E H  HLP  TD  +A G+          +++IK ++ P +P+        
Sbjct: 22  FAVLPWGATEPHNYHLPYITDCYLAHGISVDAVIKAYDSQKIKGMVLPPIPLGSQNPGQR 81

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
            + + +   Y      LT          I+ ++   GI  +VI+N HGGNS   +++   
Sbjct: 82  ELPFCLHGRYETQKGILT---------DIVASLDCQGIYTLVIVNGHGGNS-FKNMIRDL 131

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN-- 188
           A      L+V + W  F +      F E +   H GE+ETS+M+   P LV + LA +  
Sbjct: 132 AVDYPHFLIVVSDW--FAVLPQAGYFEERD--DHAGEMETSVMMHYYPELVNLSLAGDGA 187

Query: 189 FSSRQSEFLRNFKYLRAHGSHSFGWSMKD---LNPKGVVGNAMDATVKKGE 236
           ++  + E LR+            GW+ ++   ++    +GN   +T +KG+
Sbjct: 188 YTPFKPETLRD----------GTGWTPRNWAQVSYDTGIGNPKKSTAEKGK 228


>gi|322419613|ref|YP_004198836.1| Creatininase [Geobacter sp. M18]
 gi|320126000|gb|ADW13560.1| Creatininase [Geobacter sp. M18]
          Length = 239

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 100/237 (42%), Gaps = 26/237 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V LP G+ E+HG HLP++TDTI A  + +R       R+P+   P    G         G
Sbjct: 21  VYLPFGSVEEHGSHLPLSTDTIEAYEVGKRAAE----RIPLFVAPPVHYGCCRSTSRHPG 76

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM-----RFSML 138
           T +++          I+ ++   G+   + L  H G S  +++      +       +M 
Sbjct: 77  TISISTGTLKALLKDIVRSLHAQGVMNFIALTGHAGGSHRMALQDAGEELIQELPEINMA 136

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           VV+         +      ET    H GEIETS ++   PHLVK   A  + +  +  L 
Sbjct: 137 VVT---EYDLAKESGAHLIETRGDAHAGEIETSRIMHSHPHLVKGMGAVEYPNFPTGILV 193

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
             K        SF W      P GV G+   A+ +KG+ L S  A+  ++L+  + S
Sbjct: 194 RDK-------RSF-W------PGGVWGDPTKASAEKGKLLESLVADKVVELVKALES 236


>gi|158424535|ref|YP_001525827.1| hypothetical protein AZC_2911 [Azorhizobium caulinodans ORS 571]
 gi|158331424|dbj|BAF88909.1| uncharacterized protein [Azorhizobium caulinodans ORS 571]
          Length = 233

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 67/132 (50%), Gaps = 11/132 (8%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           N + + A  R D   VLP+G+ EQH  +L + TD      LAER+       L V   PV
Sbjct: 7   NWMQMEARVRADDRCVLPIGSVEQHA-YLSLATDMT----LAERVALEAAGPLDVPVFPV 61

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS- 128
            P G +       GT +L  +  +     I+D++ + G R+I+I+N HGGN+P+ + +S 
Sbjct: 62  LPYGLASGFTAFPGTVSLRLSTYLSVVSDILDSLYRTGFRRILIVNGHGGNTPVTAQISE 121

Query: 129 -----TEARMRF 135
                  AR+RF
Sbjct: 122 WLNGHEGARVRF 133


>gi|254489140|ref|ZP_05102344.1| creatininase subfamily protein [Roseobacter sp. GAI101]
 gi|214042148|gb|EEB82787.1| creatininase subfamily protein [Roseobacter sp. GAI101]
          Length = 233

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
            VLPLG+ EQH  HL ++ DTI++  +A    +  P  +PV   P  P G +   M   G
Sbjct: 21  CVLPLGSTEQHA-HLSLSVDTILSGKIA--ADAAAPLGIPV--FPAVPYGLTPYFMGFPG 75

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           T +L   TYA  +     I+D++   G R+I+I+N HGGNSP+  + +   + R      
Sbjct: 76  TVSLRLRTYAALVRD---ILDSLYDTGFRRILIVNGHGGNSPVQPVCAEWMQDRDGARCR 132

Query: 141 STSWSR 146
              W R
Sbjct: 133 FHDWWR 138


>gi|331696779|ref|YP_004333018.1| Creatininase [Pseudonocardia dioxanivorans CB1190]
 gi|326951468|gb|AEA25165.1| Creatininase [Pseudonocardia dioxanivorans CB1190]
          Length = 263

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 83/181 (45%), Gaps = 17/181 (9%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++ +V+LP GA E HG H+P + DT      AE + +++  RL     P  P G S    
Sbjct: 17  REALVILPTGATEAHGAHMPNDADT----HQAEHVATLVAERLGAVVAPPLPYGISKTFE 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR------- 132
              GT +L+     E    +  A+ K G R+++ILN   GN P  +     AR       
Sbjct: 73  SFTGTISLSVPLYQELVYEVGTALIKQGFRRLLILN---GNRPNGTANDAVARRLIDDLD 129

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIG--IHGGEIETSMMLALAPHLVKMDLAENFS 190
             ++  V + S+      + I +   +E+G   HG E ETS  LA+ P LV M   E  +
Sbjct: 130 TTYAPTVTAVSYWEPAAAR-IHALRRSEVGGMGHGCEFETSFQLAVRPELVDMAAIEGVA 188

Query: 191 S 191
           +
Sbjct: 189 T 189


>gi|282856327|ref|ZP_06265607.1| creatininase [Pyramidobacter piscolens W5455]
 gi|282585830|gb|EFB91118.1| creatininase [Pyramidobacter piscolens W5455]
          Length = 252

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 75/163 (46%), Gaps = 10/163 (6%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           ++D  V++ +G+ E HG H+P+ TDT+I     +++ +++  +  V   P  P G +   
Sbjct: 16  KEDGTVIIGIGSIESHGRHMPLGTDTLIP----DKLLAMIEEKTDVLIAPTIPYGATQSL 71

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT  +       + L +++++R+ G  K +ILN HGGN   +   + +   +  + 
Sbjct: 72  NEYPGTVDIDNDVLYRYLLCVMESLRRHGAGKFLILNGHGGNMKPIERAALDMDKKGCLT 131

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            V   W                 G HGG  ET+ +L + P LV
Sbjct: 132 AVLNWWLM------AWDMDPAWKGGHGGGEETAAILGIDPALV 168


>gi|308178499|ref|YP_003917905.1| creatininase [Arthrobacter arilaitensis Re117]
 gi|307745962|emb|CBT76934.1| possible creatininase [Arthrobacter arilaitensis Re117]
          Length = 264

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 77/177 (43%), Gaps = 10/177 (5%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL-PVTCMPVEPIGYSI 76
           AR    +++P GA EQHGPH+P+  D +++  +AE +  +    + P  C   +    S 
Sbjct: 19  ARTGSTIIIPAGATEQHGPHMPLGVDAMLSRSIAEAVAQLTGALVAPALCYGYKSQPRSG 78

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV------SIVSTE 130
              +  GT +L           ++ +    G   +V+LN H  N   +      ++  T 
Sbjct: 79  GGNHRVGTTSLGGTSLSLMVEDVVASFISQGFDNVVLLNGHFENYQFLYEGVDNAVAKTR 138

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIG---IHGGEIETSMMLALAPHLVKMD 184
                +  ++ + W           FP+  +G    HGG +ETS+ML L P LV MD
Sbjct: 139 TAGSTARAILLSYWDFVDENTLAKVFPDGFLGWDIEHGGILETSLMLLLHPQLVDMD 195


>gi|332883797|gb|EGK04077.1| hypothetical protein HMPREF9456_01105 [Dysgonomonas mossii DSM
           22836]
          Length = 251

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 109/243 (44%), Gaps = 33/243 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLA--ERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
            V P GA E H  HLP  TD  +A  L+    IK+    ++    +PV  +G        
Sbjct: 23  AVQPWGATEPHNYHLPYMTDCYLAHDLSVDAVIKAYEKQKVKGMVLPVIHLGSQNP---- 78

Query: 82  DGTKTLTYA-----EAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            G + L +      E  +  L+ I+ ++   G+ K+VI+N HGGNS    I     +   
Sbjct: 79  -GQRELPFCLHAGYETQKAILSDIVSSLNYQGVHKLVIVNGHGGNSFKNMIRDLAVQYPD 137

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR--Q 193
            ++V+S  ++   +PQ    F E +   H GE+ETSMM+   P LV + +A + +S+   
Sbjct: 138 FLIVISNLFA--IVPQ-TGYFEEKD--DHAGEMETSMMMHYHPELVNLSVAGDGASKPFS 192

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKD---LNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           +E LR             GW+ ++   ++    +GN   +T +KG       +    +L 
Sbjct: 193 AESLRE----------GIGWTPRNWAKVSHDTGIGNPRKSTAEKGRKYADAVSRKLSELF 242

Query: 251 NDI 253
            D+
Sbjct: 243 IDV 245


>gi|119952666|ref|YP_950330.1| creatinine amidohydrolase [Arthrobacter aurescens TC1]
 gi|119951796|gb|ABM10705.1| creatinine amidohydrolase [Arthrobacter aurescens TC1]
          Length = 281

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 101/245 (41%), Gaps = 24/245 (9%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
            D +++LP G+ EQHGP   +  DT +A G+ E   +    R+   C P    G S  H+
Sbjct: 25  SDQLILLPFGSTEQHGPAGTLGIDTFVATGIVEDAAT----RMGALCAPPMWFGDSPHHL 80

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML- 138
              GT +L     +     +  ++   G R+I+++N H G S L ++ S    +  + L 
Sbjct: 81  AFPGTVSLKTETLMAVVRDVCTSLASHGFRQIILVNGHKG-SNLAALGSAARDLHENHLP 139

Query: 139 -VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
            V+        + +      +     HGGE+E S +    P  V+MD     +   ++F 
Sbjct: 140 DVMFAVADPLHLARNAAPHIKETNEHHGGELELSQVHFRYPGQVRMD---RLTDEGADFA 196

Query: 198 RNFKYLRAHGSHSFG---------WS---MKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
           R F      G+  FG         WS    +D  P G + +++     KG     +  + 
Sbjct: 197 RVFGGFV--GADLFGPAPDGVDVIWSSREQRDFAPTGSLSSSLGVESDKGRRFHEHIVDR 254

Query: 246 FIQLL 250
             +++
Sbjct: 255 LCEVI 259


>gi|297539395|ref|YP_003675164.1| Creatininase [Methylotenera sp. 301]
 gi|297258742|gb|ADI30587.1| Creatininase [Methylotenera sp. 301]
          Length = 254

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 77/170 (45%), Gaps = 7/170 (4%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A  +   +LP+GA EQHGPH+    D ++A  L   + ++      V  +P  P G SI 
Sbjct: 16  AEANQAAILPIGATEQHGPHMGCGMDYVLADILCSAVSTL----TNVPMLPTMPYGCSIG 71

Query: 78  H-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           H     GT  +     I     I D     GIR++ I+N H  N+  +       R    
Sbjct: 72  HSQRWPGTLAIQPITLINMMKDIGDWAYHSGIRRLFIVNTHVTNAAPLRCALEMLRAEHD 131

Query: 137 MLVVSTSWSRFTIPQGIISFPETE-IGIHGGEIETSMMLALAPHLVKMDL 185
            ++V+   S   I + +  F   +    H  + ETS+MLA APH+V+ +L
Sbjct: 132 DMMVTVINSAH-ISERVRQFHHADGDDWHANDAETSLMLATAPHMVRTEL 180


>gi|116748108|ref|YP_844795.1| creatininase [Syntrophobacter fumaroxidans MPOB]
 gi|116697172|gb|ABK16360.1| Creatininase [Syntrophobacter fumaroxidans MPOB]
          Length = 247

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 101/249 (40%), Gaps = 31/249 (12%)

Query: 16  ADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           A+ RK    V+LP GA E+HG HLP+ TD + A  LA  +  +      V   P  PI Y
Sbjct: 13  AEGRKTCRTVILPCGAVEEHGTHLPLGTDALHAVALAGEVARV----AGVWVAP--PIYY 66

Query: 75  SI-----EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
            +      H    G +  T    +E    I+    + G+  +++L+ H G + + ++   
Sbjct: 67  GLCRSGSRHPGTIGIRGSTLQCLVED---ILRGFHQQGLLNVLVLSGHAGWTHMAALADA 123

Query: 130 EARMRFSMLVVSTS-WSRFTIPQGIIS-FPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
             R+ F    +  +  S   I   + +   ET    H GE+ETS+ML L P  V     E
Sbjct: 124 CERVLFEFDDLRIAVLSVLDIGAAVWTDLIETPGDSHAGEVETSLMLHLHPECVTGRAPE 183

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
            + +     L   K              +   P GV GN      +KG+  +       +
Sbjct: 184 EYPTFPRHILVRNK--------------QAFWPGGVWGNPAAGNAEKGKLFMERSVKALV 229

Query: 248 QLLNDINSF 256
           +++  + ++
Sbjct: 230 EIIEKLENW 238


>gi|149914495|ref|ZP_01903025.1| Creatininase [Roseobacter sp. AzwK-3b]
 gi|149811288|gb|EDM71123.1| Creatininase [Roseobacter sp. AzwK-3b]
          Length = 266

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 81/180 (45%), Gaps = 23/180 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           +++P G+ EQHG H+PM+ D ++    A R+       L V  +   P  Y  +      
Sbjct: 27  ILIPFGSMEQHGHHMPMHVDVLLPTEFARRVA------LEVGGLVAPPFTYGYKSQQKCG 80

Query: 80  ---YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS----IVSTE-- 130
              +  GT +L     +     +I    + G R+I I+N H  NS  ++    +   E  
Sbjct: 81  GGNFFPGTTSLDGMSLVHALRDVIREFARHGNRQICIVNGHFENSWFIAEGIDLALRELG 140

Query: 131 -ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLA 186
            + +  + +VV + W     P     +PE  +G    HGG +ETS+ML L P LV ++ A
Sbjct: 141 WSGIHDTKVVVLSYWDFVDQPAIDRLYPEGFLGWDIEHGGVLETSLMLRLYPDLVSLERA 200


>gi|119719731|ref|YP_920226.1| creatininase [Thermofilum pendens Hrk 5]
 gi|119524851|gb|ABL78223.1| Creatininase [Thermofilum pendens Hrk 5]
          Length = 303

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 119/260 (45%), Gaps = 31/260 (11%)

Query: 14  LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG 73
           L    +K+ IV++P G+ E HG       DTII A +AER+         +T  P  PI 
Sbjct: 30  LLERVKKNDIVLVPCGSVESHGLGQATGEDTIIGAYIAERVAF----ETGITVAP--PIF 83

Query: 74  YS---IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
           Y      H  + GT  +     I++  +++  +   G +KI++ N+HG    ++ IV  +
Sbjct: 84  YGSHPSHHYGMPGTIPIKKEAYIDYVTSVVKWLSHAGFKKIILFNSHGQEY-VLPIVKDK 142

Query: 131 ARMR--FSMLVVSTS---WSRFTIPQGIISFP----ETEIGIHGGEIETSMMLALAPHLV 181
           A +      L++ TS   W R  + QG    P    ET   IH  E+E S++  +AP LV
Sbjct: 143 AIIEEGVKALILVTSWWAWVRDILRQGTELKPGLVLETPF-IHADELEASVLWYVAPKLV 201

Query: 182 K-MDLAENFSSRQSEFLRNFKYLRAHGS---HSFGW----SMKDLN--PKGVVGNAMDAT 231
               L E+ + +    + + K+    G+     FGW    +  +++  PKG VG    A+
Sbjct: 202 DPSKLKESDAEKMVGVIPD-KWADKAGNVYGRPFGWYDISAFMEIHHYPKGSVGYPSKAS 260

Query: 232 VKKGEGLLSYFANCFIQLLN 251
            +KGE ++       I+ + 
Sbjct: 261 REKGEVVVETAIQRIIEFIE 280


>gi|329903955|ref|ZP_08273640.1| Creatininase [Oxalobacteraceae bacterium IMCC9480]
 gi|327548185|gb|EGF32895.1| Creatininase [Oxalobacteraceae bacterium IMCC9480]
          Length = 261

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 98/226 (43%), Gaps = 26/226 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAG----LAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +V LP+GA EQHGPHLP+ TD ++AA     +AE++  I+ P +          G     
Sbjct: 24  VVFLPVGALEQHGPHLPLGTDALLAAAVAHSVAEQVGGIVAPTINYGYKSQPKCGGG--- 80

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS-- 136
            +  GT +L           ++  + + G+R +V+++ H  N   +      AR R    
Sbjct: 81  QHFPGTTSLDGGTLSAITCDVLAELGRHGVRNVVVMSGHYENQWFLIEGIDLARRRLGPG 140

Query: 137 ---MLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFS 190
               ++    W   T       FP+   G    H   +ETSMML   P LV++D   +  
Sbjct: 141 STLNIMRLEYWDFLTEATLAGVFPDGFPGFALEHAAVMETSMMLHYFPQLVQLDKLPD-- 198

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
               E   +F     + +H+  W    +   GV+ +A  AT +KG+
Sbjct: 199 ----EPPADFPPYDMYPTHTH-W----VPSSGVLSSARGATAEKGK 235


>gi|323702382|ref|ZP_08114047.1| Creatininase [Desulfotomaculum nigrificans DSM 574]
 gi|323532688|gb|EGB22562.1| Creatininase [Desulfotomaculum nigrificans DSM 574]
          Length = 324

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 106/248 (42%), Gaps = 25/248 (10%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS---IEHM 79
           ++++P+GA E HGPH  +  DT +   +AE +           C   +P+ +      HM
Sbjct: 39  LIIIPIGATEAHGPHACLGEDTFLVTRMAELVAK------KTGCTVSQPLWWGSHPYHHM 92

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM-RFSML 138
            + GT  L     I    +++      G RK+++LN HG    + + +   A+  +  M+
Sbjct: 93  GMPGTVILPEEIFIGVLKSVMAGYWNAGFRKMILLNGHGQEYVIPTAIHQFAKTYQVPMV 152

Query: 139 VVSTSWSRFTIPQGIISF---PETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
           V + +W      Q  +     P     IH  E+ETS  LAL   ++  D+++   ++   
Sbjct: 153 VCNLNWYHAIQDQFKLKSEGGPYETSFIHADEVETSWSLALFQEMI--DMSKAVDTKVQG 210

Query: 196 FLRNFKYLRA----------HGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
           ++ +    +A          +G    G       P+GVVG A  A+ +K    +    + 
Sbjct: 211 YMPDGHVDKAGNLLHRPIAWYGQVGMGPIEVSAYPEGVVGKATLASAEKAIPGIEKLLDY 270

Query: 246 FIQLLNDI 253
            ++L+ DI
Sbjct: 271 MVKLVEDI 278


>gi|284044429|ref|YP_003394769.1| creatininase [Conexibacter woesei DSM 14684]
 gi|283948650|gb|ADB51394.1| Creatininase [Conexibacter woesei DSM 14684]
          Length = 243

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 82/167 (49%), Gaps = 5/167 (2%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LP+GA E HG HLP++TD ++A G+A ++ + +P  +    +P+   G         
Sbjct: 20  VALLPIGAVENHGDHLPLSTDNLLADGVAHQVAARVPDSV---VLPLVSYGQVWSTSAYA 76

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L+        + I  ++ + G+  +  +N H GN   + + + +      M V++ 
Sbjct: 77  GTISLSLETMTSTLVEIGASLFEQGVPILAFVNGHMGNLDAMKLAARDLHDELGMKVLAL 136

Query: 143 SWSRF-TIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLAE 187
           ++     I + ++          H  E+ETS ML +AP  VKM+ A+
Sbjct: 137 TYPGIGEISREVLEEERLHPSYFHACELETSYMLRIAPGAVKMEHAK 183


>gi|223986108|ref|ZP_03636131.1| hypothetical protein HOLDEFILI_03439 [Holdemania filiformis DSM
           12042]
 gi|223961913|gb|EEF66402.1| hypothetical protein HOLDEFILI_03439 [Holdemania filiformis DSM
           12042]
          Length = 258

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 105/245 (42%), Gaps = 32/245 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++  G+ E HG H P+  DT++   LA+RI+     +  +  +P  P G         G
Sbjct: 21  VMIITGSLECHGVHNPLGVDTLVPEALAQRIEK----QTEILVLPALPFGSCDYLRGFPG 76

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +L+          I+D++R  G R+ + LN HGGN P +  V+ +   +  + +++  
Sbjct: 77  TVSLSTETLRRVLQEIVDSMRAHGARRFLFLNGHGGNLPALEQVALKLNSQGDLGIIANW 136

Query: 144 W--SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD---------LAENFSSR 192
           W  ++   P         E        ET+ MLA+ P  V  +         L+EN ++ 
Sbjct: 137 WQMAKEIDPAWGGGHGGGE--------ETAAMLAICPQAVHRERCRESTLKPLSENITT- 187

Query: 193 QSEFLRNFKYLRAHG-SHSFGWSMKDLNPKGVVG--NAMDATVKKGEGLLSYFANCFIQL 249
                  FK ++  G + +    +  +   G  G  +   A+   GE +L   +   +QL
Sbjct: 188 -----TGFKTVQFKGVTLTMPQPIAAICDNGWTGPDHPAAASASWGETMLEAISQLLVQL 242

Query: 250 LNDIN 254
           ++++ 
Sbjct: 243 IDELK 247


>gi|169235158|ref|YP_001688358.1| creatininase [Halobacterium salinarum R1]
 gi|167726224|emb|CAP13004.1| creatininase [Halobacterium salinarum R1]
          Length = 247

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 96/244 (39%), Gaps = 27/244 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+G+ EQHGPH P+ TD I A  +A            +   P+  +G S EH    
Sbjct: 18  LAVLPVGSTEQHGPHAPLGTDHITAHAVAAAGADAYSDGEVIVAPPIT-VGVSAEHRQFT 76

Query: 83  GTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
           GT  +   T+   +     ++ ++   G  ++V++N HGGN+  +  V      +     
Sbjct: 77  GTLWVAPDTFRATVRD---VVGSLASHGWDRVVVVNGHGGNTAALGEVCATITRQDDAYA 133

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD----LAENFSSRQSE 195
           V  +W         +    +++G H G +ET+ +    P L++ D     AE+ +    +
Sbjct: 134 VPFTWFD------AVGDHSSDMG-HAGPLETAFLRHTDPELIREDRVQAAAEDGADAWGK 186

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           ++ +                      GVVG+       +G  LL         LL  +  
Sbjct: 187 WVSHANLAA---------DAAAFTDNGVVGDPRAGDADRGAALLDAATESLCALLAAVAD 237

Query: 256 FDVS 259
            D +
Sbjct: 238 RDTT 241


>gi|85704740|ref|ZP_01035841.1| creatinine amidohydrolase; creatininase [Roseovarius sp. 217]
 gi|85670558|gb|EAQ25418.1| creatinine amidohydrolase; creatininase [Roseovarius sp. 217]
          Length = 287

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 87/188 (46%), Gaps = 27/188 (14%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           AR    +++PLG+ EQHG H+PM+ D ++    A R        + V  +   P  Y  +
Sbjct: 42  ARGAVPILIPLGSMEQHGHHMPMHVDVLLPTEFARRAA------VEVGGLVAPPFTYGYK 95

Query: 78  HM-------YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS----I 126
                    +  GT +L  A  +     +I    + G R+I I+N H  NS  ++    +
Sbjct: 96  SQQKSGGGNFFPGTTSLDGASLVNALKDVIREFARHGNRQICIVNGHFENSWFIAEGIDL 155

Query: 127 VSTE---ARMRFSMLVVSTSWSRFTIPQGIIS--FPETEIGI---HGGEIETSMMLALAP 178
              E   + +  + +VV + W    + Q  I+  +PE  +G    HGG +ETS+ML L P
Sbjct: 156 ALRELGWSGIHDTKVVVLSYWD--FVDQAAIAKLYPEGFLGWDIEHGGVLETSLMLRLYP 213

Query: 179 HLVKMDLA 186
            LV ++ A
Sbjct: 214 DLVSLERA 221


>gi|317121550|ref|YP_004101553.1| creatininase [Thermaerobacter marianensis DSM 12885]
 gi|315591530|gb|ADU50826.1| creatininase [Thermaerobacter marianensis DSM 12885]
          Length = 306

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 78/181 (43%), Gaps = 23/181 (12%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS-----ILPPRLPVTCMPVEPIG 73
           R+    +LPL + E HGPH+P+ TD I+A GLAER++      + PP +   C       
Sbjct: 62  RRADFALLPLASLEWHGPHMPLGTDLILARGLAERLRGEFTALLYPPFVYTAC------- 114

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH--GGNSPLVSIVSTEA 131
              +  +  GT  L    A+     ++  I   G  ++++LNAH         +  +   
Sbjct: 115 -PGKTRHYPGTVALRAEVALAVLCDVLRGILDAGFVRVLLLNAHDANMAIARAAAEAVTG 173

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEIGI------HGGEIETSMMLALAPHLVKMDL 185
             R S+L+V  +W +   P+        E G       HGG  E S   ALAP  V   L
Sbjct: 174 ERRASILLV--NWWQMVSPEETAGLFRGEPGDARPGRGHGGPFEASATAALAPESVDPAL 231

Query: 186 A 186
           A
Sbjct: 232 A 232


>gi|222081117|ref|YP_002540480.1| creatininase (creatinine amidohydrolase) protein [Agrobacterium
           radiobacter K84]
 gi|221725796|gb|ACM28885.1| creatininase (creatinine amidohydrolase) protein [Agrobacterium
           radiobacter K84]
          Length = 270

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 84/172 (48%), Gaps = 7/172 (4%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI-KSILPPRLPVTCMPVEPIGYSIEHM 79
           D +++LP+G+ E  G H PM  D + A  +A  I ++     +P    PV P G +    
Sbjct: 23  DAVILLPMGSLEDQGTHAPMG-DYLAAEAVALDIARAARAEGVPTFIAPVIPFGGADYFG 81

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              G   L+ +  +     +   + + G+ K++++N HGGN   ++ VS + R    M V
Sbjct: 82  SSHGGVALSQSTLVAVLDDMFACLARHGLTKVLVINGHGGNVGAINDVSLKWRQTNGMFV 141

Query: 140 VSTS-WS-RFTIPQGIISFPE--TEIGIHGGEIETSMMLALAPHLVKMDLAE 187
            S   W   + + + I+  PE   +   HGG+  TS+ L   P L++MDLA+
Sbjct: 142 ASMYLWQISYELLKEILG-PEAAAKSSGHGGDPLTSVGLHYYPELLRMDLAK 192


>gi|149201021|ref|ZP_01877996.1| Creatininase [Roseovarius sp. TM1035]
 gi|149145354|gb|EDM33380.1| Creatininase [Roseovarius sp. TM1035]
          Length = 266

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 87/188 (46%), Gaps = 27/188 (14%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           AR    +++PLG+ EQHG H+PM+ D ++    A R        + V  +   P  Y  +
Sbjct: 21  ARGGVPILIPLGSMEQHGHHMPMHVDVLLPTEFARRAA------VEVGGLVAPPFTYGYK 74

Query: 78  HM-------YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS----I 126
                    +  GT +L  A  +     +I    + G R+I I+N H  NS  ++    +
Sbjct: 75  SQQKSGGGNFFPGTTSLDGASLVNALKDVIREFARHGNRQICIVNGHFENSWFIAEGIDL 134

Query: 127 VSTE---ARMRFSMLVVSTSWSRFTIPQGIIS--FPETEIGI---HGGEIETSMMLALAP 178
              E   + +  + +VV + W    + Q  I+  +PE  +G    HGG +ETS+ML L P
Sbjct: 135 ALRELGWSGIHDTKVVVLSYWD--FVDQAAIAKLYPEGFLGWDIEHGGVLETSLMLRLYP 192

Query: 179 HLVKMDLA 186
            LV ++ A
Sbjct: 193 DLVSLERA 200


>gi|126731759|ref|ZP_01747564.1| Predicted amidase [Sagittula stellata E-37]
 gi|126707925|gb|EBA06986.1| Predicted amidase [Sagittula stellata E-37]
          Length = 233

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 64/121 (52%), Gaps = 17/121 (14%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
            VLPLG+ EQH  +L ++ D+I    L+E++ +     L V   P  P G +   M   G
Sbjct: 21  CVLPLGSTEQHA-YLSLSVDSI----LSEKVGADAAEPLGVPVFPAVPYGLTPYFMGFPG 75

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV------STEARMR 134
           + +L   TYA  I     I+D++ K G R+++I+N HGGNSP+  +       +  AR R
Sbjct: 76  SVSLRLTTYAALIRD---ILDSLYKTGFRRVLIVNGHGGNSPVQPVTMEWMEANEGARCR 132

Query: 135 F 135
           F
Sbjct: 133 F 133


>gi|170722441|ref|YP_001750129.1| creatininase [Pseudomonas putida W619]
 gi|169760444|gb|ACA73760.1| Creatininase [Pseudomonas putida W619]
          Length = 260

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 83/189 (43%), Gaps = 22/189 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           + LP+GA EQHG H+ M  D ++   L + +       +    +P    GY  +      
Sbjct: 25  IFLPVGALEQHGHHMCMEVDVLLPTALCKAVAR----EVDGLVLPALAYGYKSQQKSGGG 80

Query: 80  -YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--SIVSTEARMRFS 136
            +  GT +L  A        II  + + G RK+V++N H  NS  +   I      +R+ 
Sbjct: 81  NHFPGTTSLDGATLTHTIQDIIRELARHGARKLVLMNGHYENSMFIVEGIDLALRELRYG 140

Query: 137 -----MLVVSTSWSRFTIPQGIIS-FPETEIGI---HGGEIETSMMLALAPHLVKMDLAE 187
                 +VV + W     P  I   +PE  +G    HGG  ETS+MLAL P   K+DL+ 
Sbjct: 141 GITDFKVVVLSYWDFVNAPAVIEELYPEGFLGWDIEHGGVFETSLMLALHPE--KVDLSR 198

Query: 188 NFSSRQSEF 196
                 ++F
Sbjct: 199 AVDHPPAKF 207


>gi|15789443|ref|NP_279267.1| hypothetical protein VNG0124C [Halobacterium sp. NRC-1]
 gi|10579771|gb|AAG18747.1| conserved hypothetical protein [Halobacterium sp. NRC-1]
          Length = 260

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 96/244 (39%), Gaps = 27/244 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + VLP+G+ EQHGPH P+ TD I A  +A            +   P+  +G S EH    
Sbjct: 31  LAVLPVGSTEQHGPHAPLGTDHITAHAVAAAGADAYSDGEVIVAPPIT-VGVSAEHRQFT 89

Query: 83  GTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
           GT  +   T+   +     ++ ++   G  ++V++N HGGN+  +  V      +     
Sbjct: 90  GTLWVAPDTFRATVRD---VVGSLASHGWDRVVVVNGHGGNTAALGEVCATITRQDDAYA 146

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD----LAENFSSRQSE 195
           V  +W         +    +++G H G +ET+ +    P L++ D     AE+ +    +
Sbjct: 147 VPFTWFD------AVGDHSSDMG-HAGPLETAFLRHTDPELIREDRVQAAAEDGADAWGK 199

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           ++ +                      GVVG+       +G  LL         LL  +  
Sbjct: 200 WVSHANLAA---------DAAAFTDNGVVGDPRAGDADRGAALLDAATESLCALLAAVAD 250

Query: 256 FDVS 259
            D +
Sbjct: 251 RDTT 254


>gi|302337270|ref|YP_003802476.1| creatininase [Spirochaeta smaragdinae DSM 11293]
 gi|301634455|gb|ADK79882.1| Creatininase [Spirochaeta smaragdinae DSM 11293]
          Length = 325

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 58/260 (22%), Positives = 110/260 (42%), Gaps = 35/260 (13%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS--- 75
            K+ ++++P+G+ E HG + P   DT +   L E++       L   C   +PI Y    
Sbjct: 34  EKNDVILIPVGSTENHGANAPYGEDTYLDTRLCEQVA------LATGCTVAQPIWYGSHP 87

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL-VSIVSTEARMR 134
             H+ + GT  +      ++   +       G RK++++N HG +  + ++I     + +
Sbjct: 88  YHHLGMPGTIMIPEETLADYLCYVFAGFWNTGFRKMIVVNGHGQDYVIPLAIHKFGKKFQ 147

Query: 135 FSMLVVSTS-WSRFTIPQ-GIISFPETEIG-------IHGGEIETSMMLALAPHLVKMDL 185
              +V+    W+    P+ G+      + G       +H  E+E S  LAL P L K + 
Sbjct: 148 VPGIVLYVHFWNAARNPETGLTDLATKDQGGVYNTPFVHADEVEQSFALALFPELCKQEN 207

Query: 186 A-----------ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDL-NPKGVVGNAMDATVK 233
           A            + ++     +   K+  A GS      M+ +  P+GV+G+   A  +
Sbjct: 208 AVVTKPSPMLPPGHINNSAENGVGPIKWYNAFGS----VGMECICTPEGVIGDPTMADAE 263

Query: 234 KGEGLLSYFANCFIQLLNDI 253
           K    + +  N   +L+NDI
Sbjct: 264 KARAGVEHTLNYLEKLVNDI 283


>gi|218283101|ref|ZP_03489191.1| hypothetical protein EUBIFOR_01777 [Eubacterium biforme DSM 3989]
 gi|218216122|gb|EEC89660.1| hypothetical protein EUBIFOR_01777 [Eubacterium biforme DSM 3989]
          Length = 249

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 83/181 (45%), Gaps = 13/181 (7%)

Query: 15  CADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG 73
           C +  KD  +V+L  G+ E HG H P+ TDT+I      +I  ++  +  V   P  P G
Sbjct: 11  CEEYFKDHDMVILTTGSTENHGIHNPLGTDTMI----PNKILELVEKQSDVLIAPTLPYG 66

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
            +  H    GT ++  ++ +E  +  I D +   G R  V LN HGGN+  +S V    R
Sbjct: 67  DADFHTEYTGTISIG-SDLLEMVMERISDRLYDCGARHFVFLNGHGGNTHALSKV---CR 122

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
             +    V T +  +TI   I        G HG   ET+ ML +   LV+ D  E+ +  
Sbjct: 123 HLYKKGAVGTIFDWWTIAGKI---NPKWAGGHGAGQETAAMLYVDESLVQKDKIEDSNLN 179

Query: 193 Q 193
           Q
Sbjct: 180 Q 180


>gi|331000317|ref|ZP_08323999.1| creatininase [Parasutterella excrementihominis YIT 11859]
 gi|329572196|gb|EGG53857.1| creatininase [Parasutterella excrementihominis YIT 11859]
          Length = 256

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 83/173 (47%), Gaps = 23/173 (13%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGL----AERIKSILPPRLPVTCMPVEPIGYSIEH 78
           + ++P+G+ EQH  HLP+ TDT +A  +    AE+  ++L P  PV        G+S  H
Sbjct: 23  VAIVPIGSVEQHSYHLPLGTDTYVAMTIAEEAAEKTGAVLTP--PVW------FGWSPHH 74

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG-GNSPLVSIVSTEARMRFSM 137
           M + GT T+      E    II+++   G+ KI+++N H   N   + I +  A+ +   
Sbjct: 75  MVLPGTVTIRPEVLSELTYDIIESLNAHGLNKIILINGHRIVNVVWMQICAQRAQSKLGC 134

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGI----HGGEIETSMMLALAPHLVKMDLA 186
            V      +   P  +      E+G     H  E+ETS M+A  P +V ++ A
Sbjct: 135 TV------KIFDPAYMSKDIVKELGFGPVGHAEEVETSHMMARYPDMVHLEKA 181


>gi|325168378|ref|YP_004280168.1| creatininase [Agrobacterium sp. H13-3]
 gi|325064101|gb|ADY67790.1| creatininase [Agrobacterium sp. H13-3]
          Length = 285

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/255 (23%), Positives = 110/255 (43%), Gaps = 19/255 (7%)

Query: 14  LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAE---RIKSILPPRLPVTCMPVE 70
             A  ++  ++++PL + E+ GPH PM  D ++   LAE   R    L         PV 
Sbjct: 17  FAARMKRPAVILIPLASQEEQGPHAPMG-DFMLTERLAEMSARAGDGL-------TAPVL 68

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
           P G++     + G   L  A        I+ +    G  +++I N H  N+PL+  V  +
Sbjct: 69  PFGHAEFFRAISGGIQLRAATFTAVLEDILTSFLDHGHEQLLIFNGHTTNAPLIDQVCRK 128

Query: 131 ARMRFSMLVVSTS-WSRF--TIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
            R    +L+ + + W     ++ + +     T +  HGGE  TS+ + L P LV+ +   
Sbjct: 129 LRREKGVLIPALNIWQSLPDSLWKTLYGDDATRVRGHGGEPMTSVYMHLFPELVRTEAMR 188

Query: 188 NFSSRQSEF---LRNFKYLRAHG-SHSFGWSMKDLNPKGVVGN-AMDATVKKGEGLLSYF 242
           + + R S F   +      R  G          +++P G++G  A  A+ +KG+ +  + 
Sbjct: 189 DPAPRGSVFGLPVGGVSATRFEGIPVQIPLDCTEVDPAGMLGGRASLASAEKGQVICDHI 248

Query: 243 ANCFIQLLNDINSFD 257
                +L+  +  FD
Sbjct: 249 VGHTARLMRHLAGFD 263


>gi|315229781|ref|YP_004070217.1| creatinine amidohydrolase [Thermococcus barophilus MP]
 gi|315182809|gb|ADT82994.1| creatinine amidohydrolase [Thermococcus barophilus MP]
          Length = 364

 Score = 59.3 bits (142), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 118/257 (45%), Gaps = 28/257 (10%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVT-CMPVEPIGY 74
           + R+  +V++P+G+ E HG HLP  TDT+    ++E ++  +  +  PV    P+    +
Sbjct: 64  EVRQCDVVLIPIGSTEFHGNHLPSGTDTLYVTQISEAVRRYMKKKGKPVAITWPINYGSH 123

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST-EARM 133
              H  + GT  +      ++ + ++  +  +G RK +++N HG    L S +     + 
Sbjct: 124 PWHHYGMPGTVIIEEDHLKDYIIDVMLGLWNLGYRKQILINNHGHFWVLESAIQEFMKKY 183

Query: 134 RFSMLVVSTSWSR-----FTIPQGIISFPETEIGIHGGEIETSMMLALAP-HLVKMDLAE 187
           +   + ++  W R     F   +    F ET+  +H  E ETS+ L L P  +V MD A 
Sbjct: 184 QLPGIYIALDWHRAAGKFFRTKERGGEF-ETDF-VHADEAETSIALLLFPREMVDMDKAV 241

Query: 188 NFSSRQ-----------SEFLRNFKYLRAHGSHSFGWSMKDLN-PKGVVGNAMDATVKKG 235
           + + R               LR  ++  A G       ++ +N P+GVVG A  A  KK 
Sbjct: 242 DTTPRAYLPDGHFDKAVDGLLRPMRWSSAEGH----IPIEIVNTPEGVVGKATLADAKKA 297

Query: 236 EGLLSYFANCFIQLLND 252
           +  +++    +++LL D
Sbjct: 298 KRAIAFILK-YLELLID 313


>gi|162450266|ref|YP_001612633.1| hypothetical protein sce1994 [Sorangium cellulosum 'So ce 56']
 gi|161160848|emb|CAN92153.1| hypothetical protein sce1994 [Sorangium cellulosum 'So ce 56']
          Length = 264

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 99/236 (41%), Gaps = 20/236 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + ++P+G+ E HGPHLP+ TDT+I    AE+    L  R  V  +   PIGY +      
Sbjct: 26  VALVPVGSVEPHGPHLPLGTDTLIGEAAAEQAGRRLWAR-GVAALLAPPIGYGVTDFAAG 84

Query: 83  GTKTLTY-AEAIEHWL-AIIDAIRKMGIRKIVILNAH---GGNSPLVSIVSTEARMRFSM 137
               ++  A A+  +L A+ +A    G+  +  +N H     +  + +  S     R S+
Sbjct: 85  FAGAISIPAPALTAFLRAVAEAYLSAGLSHVCFINNHLEPEHDRAVRAATSDLPLGRASV 144

Query: 138 LV-VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
              ++  W+R       +S        H G  ETS++LA A  LV+ D+AE         
Sbjct: 145 ACPLARRWAR------TLSAEFRSGACHAGRYETSLVLAAASALVRKDIAEALPDLGLSL 198

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
               K     G+ SF     D       G+  +A+  +G  LL   A   +  + +
Sbjct: 199 SEGIKA----GAKSFRALGMD---AAYTGSPREASEDEGRALLDLLATMIVTEVEE 247


>gi|320108812|ref|YP_004184402.1| Creatininase [Terriglobus saanensis SP1PR4]
 gi|319927333|gb|ADV84408.1| Creatininase [Terriglobus saanensis SP1PR4]
          Length = 305

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 102/238 (42%), Gaps = 14/238 (5%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM-PVEPIGYSIEHMYVD 82
            +LP+G  E+HGPHLP+ +D I A     R  +I   +     + P    G   E  +  
Sbjct: 63  CILPIGIMEKHGPHLPIGSDLINA-----RYAAIHAAQQSYAVVFPEYYFGQISEARHEP 117

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT + +    +    A  D + + G +KI+I+N HGGN+ L+   + ++++      V  
Sbjct: 118 GTVSYSRDLQLALLQATTDEMSRNGCKKILIVNGHGGNTSLLPYFA-QSQLDKPHDYVVY 176

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            +S+ T   G      T    H GE ETS ++   P LV  + A   S      L     
Sbjct: 177 LFSQRTPTSGGPKKKSTN-DQHAGESETSKLMITRPDLVHPERATQESGADQHHLN---- 231

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
               G ++  W      P    G+   AT + GE  + ++ +   + L  I + DVS+
Sbjct: 232 -LPEGVYTGIWWYASF-PDHYAGDGSVATHELGEYQMKWWVDSVTKSLIAIKADDVSL 287


>gi|226228198|ref|YP_002762304.1| creatinine amidohydrolase [Gemmatimonas aurantiaca T-27]
 gi|226091389|dbj|BAH39834.1| creatinine amidohydrolase [Gemmatimonas aurantiaca T-27]
          Length = 263

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 88/184 (47%), Gaps = 11/184 (5%)

Query: 6   IFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LP 63
           +  + + P   D    W + +LP GA E H  HLP  TDT++ A +A R+ +        
Sbjct: 14  VLAEQTWPALRDGH--WPVALLPFGATEPHNTHLPYGTDTLLGAEVAARVAAHAIAHGTG 71

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V  +P  P G +   + +  T  +     +     I+ ++   G+R +V+LNAHGGN   
Sbjct: 72  VLALPPIPFGVNTTQLDLRFTINVMPTTQLILLRDIVKSLEPHGVRALVLLNAHGGNE-- 129

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V  E +   SM++   +W + T    +   P    G H GE+ET+ ++ +AP LV  
Sbjct: 130 LRAVVRELQPETSMMLAIVNWWQ-TADVSVFREP----GDHAGELETAAVMHVAPGLVVE 184

Query: 184 DLAE 187
           D ++
Sbjct: 185 DRSQ 188


>gi|55376664|ref|YP_134515.1| creatinine amidohydrolase [Haloarcula marismortui ATCC 43049]
 gi|55229389|gb|AAV44809.1| creatinine amidohydrolase [Haloarcula marismortui ATCC 43049]
          Length = 252

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 83/171 (48%), Gaps = 12/171 (7%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV+ +G+ EQHGPHLP+N DT+    LA RI + +   L     P    G S  HM   G
Sbjct: 28  VVVAVGSIEQHGPHLPLNMDTLDGDELARRIAAEMGDAL---AAPTIRPGCSGHHMEFPG 84

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSMLVVST 142
           T T+     ++   +   ++   G   IV++  HGGN  P+ ++    AR   +  +   
Sbjct: 85  TITVPPETLMDVIRSYCRSLDTHGFEHIVLVPTHGGNFGPVKTVAPDIARELEAAAIPLA 144

Query: 143 SWSRFT--IPQGI----ISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
                   + QG+    I + E ++ IH G  ET+++LA+   LV+M+  E
Sbjct: 145 DLDEHMQLLNQGLSKAGIEY-EQDV-IHAGAAETAIVLAIDEGLVRMEDVE 193


>gi|148264178|ref|YP_001230884.1| creatininase [Geobacter uraniireducens Rf4]
 gi|146397678|gb|ABQ26311.1| Creatininase [Geobacter uraniireducens Rf4]
          Length = 239

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 97/243 (39%), Gaps = 24/243 (9%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           ++   V +P G+ E+HG HLP++TDTI A  + +R   I+P           PI Y    
Sbjct: 16  KRTRTVYIPFGSVEEHGYHLPLSTDTIQAYEVGKRAAEIIP------LFVAPPIHYGCCR 69

Query: 79  MYV--DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
                 GT ++T A        I+ +    G+R  ++L  H G +  +++      +   
Sbjct: 70  STACHPGTISITTATLKALLKDIVRSFHSHGMRNFIVLTGHAGGAHKMALQDAGEELIAE 129

Query: 137 MLVVSTS-WSRFTIPQGI-ISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
           +L +  +  + + + +       ET    H GEIETS ++   P LV       F S   
Sbjct: 130 LLDIRMAVVTEYDLAKDAGRELVETAGDAHAGEIETSRIMHSHPQLVNGTGEREFPSFPV 189

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
             L   K              +   P GV G+   A+ +KG+ L        + L   + 
Sbjct: 190 GILVRDK--------------RRFWPNGVWGDPTKASAEKGKRLEQLVTAKVVDLARALE 235

Query: 255 SFD 257
           +F+
Sbjct: 236 AFE 238


>gi|240167696|ref|ZP_04746355.1| hypothetical protein MkanA1_00170 [Mycobacterium kansasii ATCC
           12478]
          Length = 236

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 103/232 (44%), Gaps = 32/232 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +V+PLG+ EQHGPHLP++TDT IA  +A  + + + PR      P    G S EH    G
Sbjct: 22  IVVPLGSTEQHGPHLPLDTDTRIATAVARAVAAGM-PRPDWLVAPAIAYGASGEHQSFAG 80

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T ++   +A+   L            ++V +N HGGN  + ++     ++RF       +
Sbjct: 81  TISIGI-DALAMLLVEYGRSATCWAGRLVFVNGHGGN--IAALRRAVGQLRFEGR--DAA 135

Query: 144 WSRFTIPQGIISFPETEIG--IHGGEIETSMMLALAPHLVKMD--LAENFSSRQSEFLRN 199
           W            P + +G   H G  ETS++L ++P  V  D  LA N  +   E L +
Sbjct: 136 WC-----------PCSAVGGDAHAGHTETSVLLHISPDDVLTDRWLAGN-GAPLPELLPS 183

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
            +             +  ++P GV+G+   AT   G  + +   +   Q ++
Sbjct: 184 MRR----------GGIAAVSPTGVLGDPTTATAAAGRRIFAEMVDECRQRID 225


>gi|226326081|ref|ZP_03801599.1| hypothetical protein COPCOM_03899 [Coprococcus comes ATCC 27758]
 gi|225205623|gb|EEG87977.1| hypothetical protein COPCOM_03899 [Coprococcus comes ATCC 27758]
          Length = 253

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 77/168 (45%), Gaps = 20/168 (11%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS----ILPPRLPV-TCMPVEPIG 73
            K+ +V++ +G+ E HG H+P+ TDT+I   L E+I+     ++ P +P  +C  + P  
Sbjct: 16  EKNDMVLISIGSIECHGRHMPLGTDTLIPEHLLEKIEKKSDVLIAPTIPYGSCQCLAPYP 75

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
            +I+   +D      +         I  ++ + G RK V LN HGGN  ++  +  E   
Sbjct: 76  GTID---IDNEVLYQFCR------QIFLSLYRHGARKFVFLNGHGGNIKMIERLGMEFED 126

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           +  ++ +   W                 G HGG  ET+ +L + P LV
Sbjct: 127 KGCLVAMLNWWLM------AWDMNPAWKGGHGGGEETAAILGIDPSLV 168


>gi|116754791|ref|YP_843909.1| creatininase [Methanosaeta thermophila PT]
 gi|116666242|gb|ABK15269.1| Creatininase [Methanosaeta thermophila PT]
          Length = 232

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 102/248 (41%), Gaps = 39/248 (15%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI-- 76
           +K   V+LP+GA E+HGPHLP+ TDT  A  +A  +      R  V   P  P+ Y I  
Sbjct: 16  KKTRTVILPVGAVEEHGPHLPVTTDTHQALEVAYEVAR----RREVFVAP--PVHYGICR 69

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI------VSTE 130
                 GT ++ +    ++   I+    +   R +++L+ H G   + S+          
Sbjct: 70  STRGFPGTVSVGFNALRDYVYDILLGFHESNFRYVMVLSGHAGGQHMSSLKEACQSAVNN 129

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
             +R S+L   T +             +T    H G+IETS ML   P LV+     N  
Sbjct: 130 TDLRISLL---TDFDLIRC--------DTPGDGHAGDIETSRMLLHRPDLVRGLPPANHP 178

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
            R       +  LR         S+++    G++G+   A+ +KG           ++ L
Sbjct: 179 KRP-----RYLILR---------SVREFMGNGIMGDPSSASAEKGVRYFEMAVRGVLEAL 224

Query: 251 NDINSFDV 258
           +++  F V
Sbjct: 225 DELEGFSV 232


>gi|294341807|emb|CAZ90236.1| Creatinine amidohydrolase [Thiomonas sp. 3As]
          Length = 263

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 85/180 (47%), Gaps = 15/180 (8%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTD----TIIAAGLAERIKSILPPRLPVTCMPVEPIG 73
           A  D ++ LP GA EQHGPHLP+ TD    T +AAG A R++ ++ P L          G
Sbjct: 19  AEDDPVMFLPCGALEQHGPHLPLGTDALLATAVAAGAAARLEGLVAPALSYGYKSQPKCG 78

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS----IVST 129
                 +  GT +L     I+    +I  + + GI+++V++  H  N   V+    +   
Sbjct: 79  GG---QHFPGTTSLDATSLIQMTRDVIRELARHGIKRLVVVVGHYENQWFVTEGIDLALR 135

Query: 130 EARMRFSMLVVSTSWSRFTIPQGIIS-FPETEIGI---HGGEIETSMMLALAPHLVKMDL 185
           E     ++ V+   +  F   Q +   FPE   G    H   IETS+ML   P LV+MDL
Sbjct: 136 ELGPACALRVMRLEYWDFLTEQTLARVFPEGFPGFALEHAAVIETSLMLHHHPELVRMDL 195


>gi|239625805|ref|ZP_04668836.1| creatininase [Clostridiales bacterium 1_7_47_FAA]
 gi|239520035|gb|EEQ59901.1| creatininase [Clostridiales bacterium 1_7_47FAA]
          Length = 254

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 87/190 (45%), Gaps = 17/190 (8%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAA----GLAERIKSILPPRLP--VTCMPVEPI 72
           ++ + ++LP+G+ EQHGP LP++TD I A     G AE  K ++ P +       P+   
Sbjct: 21  KEGYGIILPIGSTEQHGPALPISTDAICAREVSLGAAENTKMLVAPTIQYGYRSRPLSGG 80

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           G +       GT  L+    I     I++   +MG +K+V+L+ H  N   +   S    
Sbjct: 81  GATF-----PGTTNLSGHTLICVIEDILEEFARMGFKKVVVLSMHMENQNFIYEGSYLVS 135

Query: 133 MRFSMLVVSTSWSRF-TIPQGIIS--FPETEIGI---HGGEIETSMMLALAPHLVKMDLA 186
            R   + +    S F  I + I+   FP+   G    H   +E S+ML   P LV  D A
Sbjct: 136 RRHPDMKIMVMESAFGDIQENIMDVLFPDGFPGWAREHAACMEVSIMLYRHPELVHFDRA 195

Query: 187 ENFSSRQSEF 196
            N +S +  F
Sbjct: 196 VNDNSEEYPF 205


>gi|159044667|ref|YP_001533461.1| hypothetical protein Dshi_2124 [Dinoroseobacter shibae DFL 12]
 gi|157912427|gb|ABV93860.1| hypothetical protein Dshi_2124 [Dinoroseobacter shibae DFL 12]
          Length = 267

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 23/180 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           V++PLG+ EQHG H+PM+ D ++    A R+      ++     P    GY         
Sbjct: 27  VLIPLGSMEQHGHHMPMHVDVLLPTEFARRVAE----KVGALVAPPFTYGYKSHQKSGGG 82

Query: 80  -YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM- 137
            +  GT +L  A  +     ++    + G+R + I+N H  NS  ++     A       
Sbjct: 83  NFFPGTTSLDGASLVNALKDVVKEFVRHGVRNLCIVNGHFENSWFITEAIDLALRELGWG 142

Query: 138 ------LVVSTSWSRFTIPQGIIS--FPETEIGI---HGGEIETSMMLALAPHLVKMDLA 186
                 +VV + W    + Q  I   +P   +G    HGG +ETS+ML L P LV +  A
Sbjct: 143 GVHDVKIVVLSYWD--FVDQASIEKLYPNGFLGWDIEHGGVLETSLMLRLHPDLVSLQDA 200


>gi|222055914|ref|YP_002538276.1| Creatininase [Geobacter sp. FRC-32]
 gi|221565203|gb|ACM21175.1| Creatininase [Geobacter sp. FRC-32]
          Length = 239

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 100/245 (40%), Gaps = 28/245 (11%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           ++   V +P G+ E+HG HLP++TDTI A  + +R   +    +P+   P    G     
Sbjct: 16  KRTQTVYIPFGSVEEHGYHLPLSTDTIQAYEVGKRAAEL----IPLFVAPPVHYGCCRST 71

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM----- 133
               GT +++ A        I+ ++   G++  ++L  H G S  +++      +     
Sbjct: 72  ARHPGTISISTATLKSFLKDIVRSLHSHGLKNFIVLTGHAGGSHKMALQDAGEELIAEIY 131

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
              M VV+         +G+I   ET    H GEIETS ++   P LV       F +  
Sbjct: 132 DIKMAVVTEYDLAKEEGRGLI---ETAGDAHAGEIETSRIMHSHPQLVTGTGEREFPTFP 188

Query: 194 SEFL-RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
              L RN +           W        GV G+   AT +KG  L +  A   ++L   
Sbjct: 189 PGILVRNKRQY---------WQ------NGVWGDPTKATAEKGAKLEALVATKVVELARA 233

Query: 253 INSFD 257
           + + +
Sbjct: 234 LEALE 238


>gi|297526083|ref|YP_003668107.1| Uncharacterized protein putative amidase-like protein
           [Staphylothermus hellenicus DSM 12710]
 gi|297254999|gb|ADI31208.1| Uncharacterized protein putative amidase-like protein
           [Staphylothermus hellenicus DSM 12710]
          Length = 231

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 70/135 (51%), Gaps = 15/135 (11%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP--PRLPVTCM 67
           NS P    ++  +I ++P G+YE HG +LP +TD+++A  +  R  + L     + +   
Sbjct: 7   NSFP---PSKNLYISIIPTGSYEYHGENLPYDTDSVLAEKIVSRCITSLKSMKNVNIQVY 63

Query: 68  PVEPIGYSIEHMYVDGTKTL---TYAEAIEHWLAIIDAIRK-MGIRKIVILNAHGGNSPL 123
           P    GYSIE +   GT ++   TY + +E   +I+D + K +     + +N HGGN  L
Sbjct: 64  PALKYGYSIEWIKYPGTISIDPKTYLDMLE---SIVDFMEKNISPAGYIFVNGHGGNYSL 120

Query: 124 VSIVSTEARMRFSML 138
           + + S   R +F  L
Sbjct: 121 LEVFS---RKKFYEL 132


>gi|226939775|ref|YP_002794848.1| amidase [Laribacter hongkongensis HLHK9]
 gi|226714701|gb|ACO73839.1| Predicted amidase [Laribacter hongkongensis HLHK9]
          Length = 233

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 56/108 (51%), Gaps = 13/108 (12%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           VLPLG+ EQH  +L + TD +    LAER+       L V   P  P G +       GT
Sbjct: 22  VLPLGSTEQHA-YLSLATDVL----LAERVAVDAAEPLGVPVFPAVPYGITPYFTAFPGT 76

Query: 85  KTLTYAEAIEHWLAII----DAIRKMGIRKIVILNAHGGNSPLVSIVS 128
            TL     +E +LA+I    D + + G R+I+I+N HGGNSP + +  
Sbjct: 77  VTLR----VETYLAVIRDLLDGLARQGFRRILIVNGHGGNSPAMGLTG 120


>gi|10581225|gb|AAG19993.1| conserved hypothetical protein [Halobacterium sp. NRC-1]
          Length = 181

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 68/143 (47%), Gaps = 4/143 (2%)

Query: 107 GIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGG 166
           GI ++V +NAHGGN   +  V    R   ++  V   W   +IP+ ++     + G HGG
Sbjct: 23  GIDRVVFVNAHGGNVSHLREVGRRLRDEGTLYAVEWMWDE-SIPE-LVDEVFDQNGPHGG 80

Query: 167 EIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGN 226
             ET++M  L    V  D  E+        + +   ++ HGS +F +   D    GV+G+
Sbjct: 81  PKETALMQYLDGEHVHDDRLEDARDGGVASVADADTIK-HGSRTF-YDAIDNTDNGVLGD 138

Query: 227 AMDATVKKGEGLLSYFANCFIQL 249
             DAT + GE L    ++  +QL
Sbjct: 139 QTDATAETGERLFEAASDQLVQL 161


>gi|111026498|ref|YP_708781.1| hypothetical protein RHA1_ro10434 [Rhodococcus jostii RHA1]
 gi|110825341|gb|ABH00623.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 280

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 99/251 (39%), Gaps = 22/251 (8%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
            +D +V++P G+ EQHGP   +  DT +A G+ E        R    C P    G S  H
Sbjct: 24  EQDRVVLVPFGSTEQHGPAGVLGVDTYVATGIVEDTAK----RTGALCAPPMWFGDSPHH 79

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH-GGNSPLVSIVSTEARMRFSM 137
           M  +GT +L     I     +  ++   G  +IV++N H G N P +             
Sbjct: 80  MAFEGTISLRTETLISVVKDVCTSLAHHGFNRIVLVNGHKGSNLPALGTAVRALHEESLP 139

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
            V+        + + +    +     HGGE+E S +L   P  ++ D      +  +E  
Sbjct: 140 HVIFAVADPLHLARNVAPSIKETNEHHGGELELSQVLYRYPGRIRTDRLTGEGAPFAEVF 199

Query: 198 RNFKYLRAHGSHSFG---------WSMKD---LNPKGVVGNAMDATVKKGEGLLSYFANC 245
             F      G+  FG         WS ++     P G + +++  T  KG+    +  + 
Sbjct: 200 GGFV-----GNDLFGPAPDGVDVVWSSREQRKFAPTGSMSSSLGVTEDKGKQFHGHLVDR 254

Query: 246 FIQLLNDINSF 256
             +++  + ++
Sbjct: 255 LSEVVEWLRTY 265


>gi|295111056|emb|CBL27806.1| Uncharacterized protein, putative amidase [Synergistetes bacterium
           SGP1]
          Length = 257

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 84/190 (44%), Gaps = 21/190 (11%)

Query: 11  SLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVE 70
           + P  A A KD ++++P+G+ EQH  HLP++ D II+   A     IL   +     P  
Sbjct: 13  TWPEYAKAAKDGVLIIPVGSTEQHSQHLPLSVDVIISENFAR----ILTEEIDAYVAPSI 68

Query: 71  PIGYSIEHM-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
             GY             GT  L     +     I+      G +KI+++N+H  N   ++
Sbjct: 69  AYGYKSNPTSGGGPLFPGTIDLKGNTLVTLTKDILLEFIADGWKKIILMNSHYENQAFLA 128

Query: 126 ----IVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEI------ETSMMLA 175
               +   + +  F  +++++ W    + Q II     E    G ++      ETS+ML 
Sbjct: 129 EAADLTIGKQQEEFPKVILTSWWDN--VSQDIIPAVFDERPFRGWDLEHAAVTETSLMLY 186

Query: 176 LAPHLVKMDL 185
            AP LVK++L
Sbjct: 187 FAPELVKVEL 196


>gi|327480612|gb|AEA83922.1| chain F, crystal structure of creatinine amidohydrolase
           (creatininase) [Pseudomonas stutzeri DSM 4166]
          Length = 253

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 83/181 (45%), Gaps = 21/181 (11%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIA----AGLAERIKSILPPRLPVTCMPVEPIGY 74
           R+  +V LP GA EQHGPHLP+ TD ++A    A +A R+  ++ P L       +P   
Sbjct: 18  REGAVVFLPCGATEQHGPHLPLGTDALLASAISADVAARVGGLVAPALSYG-YKSQPKCG 76

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKM---GIRKIVILNAHGGNSPLVS----IV 127
             +H    GT +L  A        + DA+R+    G+R++V++  H  N   V+    + 
Sbjct: 77  GGQHFC--GTTSLDGATLSA---LVRDAVREFHRHGVRRLVLVLGHYENQWFVAEGIQLA 131

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIIS-FPETEIGI---HGGEIETSMMLALAPHLVKM 183
             +      + V+      F   Q +   FPE   G    H   IETS+ML   P LV M
Sbjct: 132 LRDLGPDAGLEVMRLEHWDFCHEQTLTDIFPEGFPGFALEHAAVIETSLMLHFHPQLVAM 191

Query: 184 D 184
           +
Sbjct: 192 E 192


>gi|302349291|ref|YP_003816929.1| creatinine amidohydrolase [Acidilobus saccharovorans 345-15]
 gi|302329703|gb|ADL19898.1| creatinine amidohydrolase [Acidilobus saccharovorans 345-15]
          Length = 231

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 59/109 (54%), Gaps = 7/109 (6%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI--GYS 75
           +R+D IV++P+G+ EQH    P+ TD +IA G+AE        R+   C+   PI  G+S
Sbjct: 17  SREDAIVIIPVGSVEQHC-EGPLGTDLMIAQGVAEAACE----RVSGPCVLAPPIAYGFS 71

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
            E     GT +L+          +I ++ + G R +VI+N H GNSP V
Sbjct: 72  AEWSLAPGTVSLSLQALQLLLRDVITSLVRSGARNVVIVNGHYGNSPAV 120


>gi|225850043|ref|YP_002730277.1| creatininase [Persephonella marina EX-H1]
 gi|225646136|gb|ACO04322.1| creatininase [Persephonella marina EX-H1]
          Length = 245

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 50/98 (51%), Gaps = 4/98 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I+++P+G+ EQH P+  + TD I A  +A  +      R+ +   P    G S  H    
Sbjct: 20  IILIPIGSVEQHSPYGLIGTDFITAEAIAREVGR----RMDILVAPTITYGMSQHHSAFK 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           GT TL+    I     II+++   G R+I+ +N HGGN
Sbjct: 76  GTVTLSPVTLINLVKDIINSLLNQGFRRIIFINGHGGN 113


>gi|84514740|ref|ZP_01002104.1| creatinine amidohydrolase; creatininase [Loktanella vestfoldensis
           SKA53]
 gi|84511791|gb|EAQ08244.1| creatinine amidohydrolase; creatininase [Loktanella vestfoldensis
           SKA53]
          Length = 257

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 79/179 (44%), Gaps = 21/179 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM---- 79
           +++PLG+ EQHG H+PM+ D ++    A R+      ++     P    GY         
Sbjct: 17  ILIPLGSMEQHGHHMPMHVDVLLPTEFARRVAE----QVGALVAPPFTYGYKSHQKSGGG 72

Query: 80  -YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS-- 136
            +  GT +L  A  +     ++    + G+R + I+N H  NS  ++     A       
Sbjct: 73  NFFPGTTSLDGATLVNALKDVVKEFVRHGVRNLCIVNGHFENSWFITEAIDLALRELGWG 132

Query: 137 ----MLVVSTSWSRFTIPQGIIS--FPETEIGI---HGGEIETSMMLALAPHLVKMDLA 186
               + VV  S+  F + Q  I   +P   +G    HGG +ETS+ML L P LV +  A
Sbjct: 133 DIHDVKVVVLSYWDF-VDQASIEKLYPNGFLGWDIEHGGVLETSLMLRLHPDLVSLQSA 190


>gi|237737784|ref|ZP_04568265.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
 gi|229419664|gb|EEO34711.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
          Length = 239

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 108/245 (44%), Gaps = 26/245 (10%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +K+ I ++ +G+ E HG   P+ TD II     + I + L  R  +  +P  P G     
Sbjct: 5   KKEPIAMIAIGSVEYHGAQAPLGTDYIIP----DYIVNELSMREDILALPPIPYGNCQSI 60

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT  +     I    +I+D++ K GI+K + +N HGGN   +  V  +   +  ++
Sbjct: 61  KDFPGTINIGTENLIRVMNSIVDSLLKHGIKKFIFVNGHGGNIAALDQVGLDTYEKGGLI 120

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM---------DLAENF 189
                W+   +       P+ + G HG   ETS+ +A+    V +         DL++  
Sbjct: 121 ATIDWWNLAKLLN-----PDYD-GGHGDIQETSVAMAVDEKSVNLAYCEPLQINDLSDKI 174

Query: 190 SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG--NAMDATVKKGEGLLSYFANCFI 247
           +++    L N+K    +G+     S KD+   G +G  +  ++T + GE +L        
Sbjct: 175 TNKYISLL-NYK----NGNVKIVRSFKDVVSNGWIGPYDPKNSTKELGERILKDVIQYIN 229

Query: 248 QLLND 252
           + ++D
Sbjct: 230 EFIDD 234


>gi|114767632|ref|ZP_01446352.1| hypothetical protein 1100011001190_R2601_23138 [Pelagibaca
           bermudensis HTCC2601]
 gi|114540352|gb|EAU43443.1| hypothetical protein R2601_23138 [Roseovarius sp. HTCC2601]
          Length = 269

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 80/169 (47%), Gaps = 5/169 (2%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI-KSILPPRLPVTCMPVEPIGYSIEHM 79
           + +V+LP+G+ E  G H PM  D + A  +A  I K+     +P    PV P G      
Sbjct: 22  EAVVLLPMGSLEDQGIHAPMG-DYMAADLMAMEIAKAAREDGVPTFVAPVIPFGGKDYFE 80

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              G  ++++A        +   + + GIRK++I+N HGGN P ++ V+   R +  + +
Sbjct: 81  SSHGGISISHATLCGILDDMFGCLERHGIRKLMIVNGHGGNVPAITEVALRWRQKAGLFI 140

Query: 140 VSTS-W--SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
            S   W  +   +P  I +        HGG+  TS+ L   P L++ D+
Sbjct: 141 PSMYLWQVAYGELPALIGADKAKASSGHGGDPLTSVGLHFYPDLIRADM 189


>gi|282856329|ref|ZP_06265609.1| creatininase [Pyramidobacter piscolens W5455]
 gi|282585832|gb|EFB91120.1| creatininase [Pyramidobacter piscolens W5455]
          Length = 256

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 68/158 (43%), Gaps = 10/158 (6%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++ +G+ E HG HLP+ TDTII      RI  ++  +  V   P  P G +       G
Sbjct: 21  VLIAVGSCECHGRHLPLGTDTII----PNRILELIEEKSGVLIAPTIPYGSTKSLACYPG 76

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T  +          A++D   + G R+ VILN HGGN   +  V  +   R  ++ +   
Sbjct: 77  TIDIGDELLCGLLAAVMDNFYRHGARRFVILNGHGGNIKPIENVGFDFEKRGCLVALLNW 136

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           W                 G HGG  ET+ ++ + P LV
Sbjct: 137 WLM------AWDMNPAWKGGHGGGEETAGVMGVNPDLV 168


>gi|220936241|ref|YP_002515140.1| Creatininase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997551|gb|ACL74153.1| Creatininase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 261

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 92/223 (41%), Gaps = 22/223 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGL----AERIKSILPPRLPVTCMPVEPIGYSIEHM 79
            +LP+GA EQHGPHL    D  IAA L    AE   ++L P LP  C     IG+S    
Sbjct: 24  AILPVGATEQHGPHLGCGMDAEIAARLCRDVAESTGAMLLPALPYGC----SIGHS---R 76

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              GT  L     I+    I D +   G R++ ++N H  N   +       R     L+
Sbjct: 77  RWPGTIALQPKTLIDVIKDIGDWVYASGFRRLFLVNGHVTNEAPLRCALEMLRAEHDDLM 136

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           V+   +     +   +     +  H    ET++M+AL+PH+++           +E +R+
Sbjct: 137 VALVNTPAISERVRTAHCADGMDWHANAAETALMMALSPHMLR-----------AERIRD 185

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
                      F   +   +  GV G+   A  ++G  L ++ 
Sbjct: 186 ADDPDRTEDCVFAHPVNRTSTNGVTGHPSRANREQGATLYAWM 228


>gi|330465800|ref|YP_004403543.1| creatininase [Verrucosispora maris AB-18-032]
 gi|328808771|gb|AEB42943.1| creatininase [Verrucosispora maris AB-18-032]
          Length = 291

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 77/177 (43%), Gaps = 15/177 (8%)

Query: 14  LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI-----KSILPPRLPVTCMP 68
           L A A    + VLP+GA E HGPHLP+ TD ++A G A  +     +++L P  P    P
Sbjct: 25  LAAVAESADLAVLPVGAVEWHGPHLPLGTDLLLAEGFAGELATGTARAVLFPAAPYAACP 84

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
            +   +        GT  L    A+ +   ++  I + G  +++++N H  N   V    
Sbjct: 85  GQTRPWP-------GTVALRPEIAVGYLSDVLTGIVEAGFPRLLVVNGHDANLSTVRAAM 137

Query: 129 TEARMRFSMLVVSTSWSRFTIPQ--GIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
                R    ++  +W +   P   G I F       HGG  E+S +LA  P  V +
Sbjct: 138 EWVSGRHLASLLLVNWFQLVGPDETGEI-FGALPARGHGGAYESSAVLAFDPEAVHL 193


>gi|145225634|ref|YP_001136312.1| creatininase [Mycobacterium gilvum PYR-GCK]
 gi|145218120|gb|ABP47524.1| Creatininase [Mycobacterium gilvum PYR-GCK]
          Length = 251

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 72/163 (44%), Gaps = 16/163 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV--TCMPVEPIGYSIEHMYV 81
           +V+P+G+ EQHGPHLP++TDT IA  +A+ + + L  R        P    G S EH   
Sbjct: 34  LVVPVGSTEQHGPHLPLDTDTRIATAVADAVVTRLRARDETHWVMAPAIAYGASGEHEGF 93

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT ++      E  +  + +  +   R +  +N HGGN   +    T+ R         
Sbjct: 94  PGTISIGTPALAELLVEFVRSACRWTPR-VAFVNGHGGNVDALRRAVTQLRHEGR----D 148

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
            +WS                  H G  ETS++L L+P  V+ +
Sbjct: 149 AAWSPCVA---------GNADAHAGHTETSVLLHLSPDAVRQE 182


>gi|313200733|ref|YP_004039391.1| creatininase [Methylovorus sp. MP688]
 gi|312440049|gb|ADQ84155.1| Creatininase [Methylovorus sp. MP688]
          Length = 256

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 73/163 (44%), Gaps = 7/163 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH-MYVD 82
            +LP+GA EQHGPH+    D I+A  L   +         V  +P  P G S+ H     
Sbjct: 24  AMLPIGATEQHGPHMGCGMDYILADILCREVAET----TGVPMLPTMPYGCSVGHSRRWP 79

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  LT    I     I D     G+R++ I+N+H  N+  +       R     ++V+ 
Sbjct: 80  GTIALTPITLINLVKEIGDWAYHSGVRRLFIINSHVTNAAPLRCALEMLRSEHDDMMVAV 139

Query: 143 SWSRFTIPQGIISFPETE-IGIHGGEIETSMMLALAPHLVKMD 184
             +  T+   +  F   +    H  + ETS+ML  APH+V+ D
Sbjct: 140 I-NTATMSPRVKQFHHADGDDWHANDAETSLMLEKAPHIVRTD 181


>gi|315445986|ref|YP_004078865.1| protein, amidase [Mycobacterium sp. Spyr1]
 gi|315264289|gb|ADU01031.1| uncharacterized protein, putative amidase [Mycobacterium sp. Spyr1]
          Length = 243

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 72/163 (44%), Gaps = 16/163 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV--TCMPVEPIGYSIEHMYV 81
           +V+P+G+ EQHGPHLP++TDT IA  +A+ + + L  R        P    G S EH   
Sbjct: 26  LVVPVGSTEQHGPHLPLDTDTRIATAVADAVVTRLRARDETHWVMAPAIAYGASGEHEGF 85

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT ++      E  +  + +  +   R +  +N HGGN   +    T+ R         
Sbjct: 86  PGTISIGTPALAELLVEFVRSACRWTPR-VAFVNGHGGNVDALRRAVTQLRHEGR----D 140

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
            +WS                  H G  ETS++L L+P  V+ +
Sbjct: 141 AAWSPCVA---------GNADAHAGHTETSVLLHLSPDAVRQE 174


>gi|332798648|ref|YP_004460147.1| creatinine amidohydrolase [Tepidanaerobacter sp. Re1]
 gi|332696383|gb|AEE90840.1| creatinine amidohydrolase, putative [Tepidanaerobacter sp. Re1]
          Length = 373

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 103/256 (40%), Gaps = 29/256 (11%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI---GYSI 76
           K+ IV +P+G  E HG H     DT +   + E ++     +     +   P+   G+  
Sbjct: 75  KNDIVFVPIGCTENHGMHANSGLDTFMVTQILEGVRRYTAKQGREVSLAFPPLNYGGHPY 134

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
            H+ + GT  +      E  + ++  +   G RKI+++N HG    L S +  E   RF 
Sbjct: 135 HHLGMPGTVIMPKEVVEETIIYMMLGLWNDGFRKIILVNNHGHLWMLESAIQ-EFMKRFQ 193

Query: 137 M--LVVSTSWSR----FTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN-- 188
           +  +     W R    F  P       ET   +H  E ETS+ L L P ++ M + E+  
Sbjct: 194 LPGIFQVLDWHRAVREFFYPTDREDSLETHF-VHADEAETSVGLLLFPDMIDMSVVEDAE 252

Query: 189 ---------FSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE--- 236
                    F      F R  ++    G  +     +   P+GVVG    A+VKK +   
Sbjct: 253 GESFLPDGHFDKSVDPFGRPHRWSEGEGHAAI---ERAATPQGVVGKPSIASVKKAKRPI 309

Query: 237 -GLLSYFANCFIQLLN 251
             +L Y      Q+L+
Sbjct: 310 AAILKYLTLVHDQILD 325


>gi|260063609|ref|YP_003196689.1| hypothetical protein RB2501_02345 [Robiginitalea biformata
           HTCC2501]
 gi|88783054|gb|EAR14227.1| hypothetical protein RB2501_02345 [Robiginitalea biformata
           HTCC2501]
          Length = 253

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 82/189 (43%), Gaps = 22/189 (11%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTI-IAAGLAERIKSILP 59
           M P I+   N   L  + R D + +LP GA E H  HLP  TD     A  A        
Sbjct: 1   MRPYILAETNWKAL-KETRFD-LAILPWGATEAHNYHLPYGTDNYEADALAAAAAAHAWE 58

Query: 60  PRLPVTCMPVEPIGYSIEH--MYVDGTKTLTYAEAIEHWLAIID----AIRKMGIRKIVI 113
               V  +P  P G +     +Y+D     +        LAI+D     + + GI+K+V+
Sbjct: 59  AGGRVVVLPTIPFGVNTGQADIYLDMNLNPSTQ------LAILDDVAATLHRHGIQKLVV 112

Query: 114 LNAHGGNSPLVSIVSTEARMRF-SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSM 172
            N+HGGN+     +  E  +R+  + V  T+W R    +     P    G H  E ETS+
Sbjct: 113 FNSHGGNN--FKALLRELGLRYPDLFVCMTNWFRAMDRETYWEAP----GDHADEAETSL 166

Query: 173 MLALAPHLV 181
           ML L P LV
Sbjct: 167 MLHLRPDLV 175


>gi|225352755|ref|ZP_03743778.1| hypothetical protein BIFPSEUDO_04385 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225156362|gb|EEG69931.1| hypothetical protein BIFPSEUDO_04385 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 246

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 81/186 (43%), Gaps = 28/186 (15%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAA----GLAERIKSILPPRLPVTCMPVEPI 72
           +A K   V++P+G+ EQH  HLP+  D +IA+     LAERI  I+ P +          
Sbjct: 10  EASKSKPVIVPIGSTEQHSQHLPLGVDAMIASHVSEDLAERIDGIVAPTM--------NY 61

Query: 73  GYSIEHM-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV--S 125
           GY  + +        GT  +     I     ++  +   G  KIV++NAH  N   +  +
Sbjct: 62  GYKSKPLSGGGPLFPGTIDMNGVTVINQMHDVLGELIADGFTKIVVMNAHFENEAFIIEA 121

Query: 126 IVSTEARMRFSMLVVSTSWSRFTIPQGIIS-------FPETEIGIHGGEIETSMMLALAP 178
           I       R    +V T+W    +P+ ++        FP   +  H    ETS+M+   P
Sbjct: 122 IDLITRETRGVATIVETNWWD-PLPENVVEQVFDGLVFPGWALE-HAAVTETSLMMHYEP 179

Query: 179 HLVKMD 184
            LV MD
Sbjct: 180 ELVHMD 185


>gi|146282360|ref|YP_001172513.1| chain F, crystal structure of creatinine amidohydrolase
           (creatininase) [Pseudomonas stutzeri A1501]
 gi|145570565|gb|ABP79671.1| chain F, crystal structure of creatinine amidohydrolase
           (Creatininase) [Pseudomonas stutzeri A1501]
          Length = 253

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 83/181 (45%), Gaps = 21/181 (11%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIA----AGLAERIKSILPPRLPVTCMPVEPIGY 74
           R+  +V LP GA EQHGPHLP+ TD ++A    A +A R+  ++ P L       +P   
Sbjct: 18  REGAVVFLPCGATEQHGPHLPLGTDALLASAISADVAARVGGLVAPALSYG-YKSQPKCG 76

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKM---GIRKIVILNAHGGNSPLVS----IV 127
             +H    GT +L  A        + DA+R+    G+R++V++  H  N   V+    + 
Sbjct: 77  GGQHFC--GTTSLDGATLSA---LVRDAVREFYRHGVRRLVLVLGHYENQWFVAEGIQLA 131

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIIS-FPETEIGI---HGGEIETSMMLALAPHLVKM 183
             +      + V+      F   Q +   FPE   G    H   IETS+ML   P LV +
Sbjct: 132 LRDLGPDAGLEVMRLEHWDFCHEQTLTDIFPEGFPGFALEHAAVIETSLMLHFHPQLVAL 191

Query: 184 D 184
           +
Sbjct: 192 E 192


>gi|107027248|ref|YP_624759.1| creatininase [Burkholderia cenocepacia AU 1054]
 gi|116691358|ref|YP_836891.1| creatininase [Burkholderia cenocepacia HI2424]
 gi|105896622|gb|ABF79786.1| Creatininase [Burkholderia cenocepacia AU 1054]
 gi|116649358|gb|ABK09998.1| Creatininase [Burkholderia cenocepacia HI2424]
          Length = 259

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 101/235 (42%), Gaps = 32/235 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++P GA EQHGPHLP++ D   A  LA  I ++L   L     P   +G S  HM   G
Sbjct: 31  VIIPCGAIEQHGPHLPLSMDADHADALAVEIATLLGRTL---IAPTIRVGCSKHHMAFPG 87

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           T +L   TYA     +   + A    G + I + +AH GN   +  +  E R      V 
Sbjct: 88  TISLQEHTYAALCHDYCVSLAA---HGFKCIYLFSAHVGNFNALHAMLPELRQAVGPDVQ 144

Query: 141 STSWS---------RFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD--LAENF 189
             +++         R  + +     PE+ +G H    ETS+M+ L P  V++    A + 
Sbjct: 145 VLAYTDHQAWLREWRLAVEEA-GGDPES-VGGHADIAETSLMIHLDPDSVRLARLTAGHV 202

Query: 190 SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
            +  +E L             +   +  ++  GV+G+A  ++ + GE  L   A 
Sbjct: 203 GAMTTEQLNRM----------WKEGVASISRNGVLGDARGSSREIGEACLRATAR 247


>gi|156937701|ref|YP_001435497.1| creatininase [Ignicoccus hospitalis KIN4/I]
 gi|156566685|gb|ABU82090.1| Creatininase [Ignicoccus hospitalis KIN4/I]
          Length = 185

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 61/110 (55%), Gaps = 13/110 (11%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +  LPLG+YEQHGP LP + D  IA+ +A R+  +L   +      + P+ YS    + D
Sbjct: 3   VAFLPLGSYEQHGP-LPKDLDARIASAVARRLAELLGGEV------LPPLYYSCSWEWED 55

Query: 83  GT--KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
               +  T A  +     I  +++++G +++V++NAHGGNS LV  V  +
Sbjct: 56  SVSLRVETLASVLRD---INFSLKRLG-KELVVVNAHGGNSGLVQAVGRQ 101


>gi|254446852|ref|ZP_05060327.1| creatininase subfamily [Verrucomicrobiae bacterium DG1235]
 gi|198256277|gb|EDY80586.1| creatininase subfamily [Verrucomicrobiae bacterium DG1235]
          Length = 259

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 70/156 (44%), Gaps = 5/156 (3%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-D 82
            +LP+GA EQHGP L +  D+++   L   + +       V  +P+ P G S+ H +   
Sbjct: 28  AILPVGATEQHGPQLTLGMDSLLGRQLCSDVSATTG----VPTLPILPYGCSLGHSHRWP 83

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  L+    I     I D +   GIRK+ I+N+H  N   +       R ++  L ++ 
Sbjct: 84  GTLALSPQTLISTITDIADWLHPAGIRKLFIVNSHVTNEAPLRCALELLRSKYDDLCIAI 143

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
             +    P+   +F       H    ETS++L L P
Sbjct: 144 FNTGKLTPEIASAFSADAADWHANAAETSLVLHLEP 179


>gi|255022743|ref|ZP_05294729.1| creatinine amidohydrolase [Listeria monocytogenes FSL J1-208]
          Length = 128

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 60/127 (47%), Gaps = 4/127 (3%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  + A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +P
Sbjct: 6   ENSFDIGAKITKTKPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETDGFVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V P G         G+ TL+        + I +++ K G R  V ++ H GN   +   +
Sbjct: 62  VLPYGQVWSLQDFPGSLTLSNETVTRVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAA 121

Query: 129 TEARMRF 135
            E   ++
Sbjct: 122 RELYAKY 128


>gi|260427252|ref|ZP_05781231.1| creatininase [Citreicella sp. SE45]
 gi|260421744|gb|EEX14995.1| creatininase [Citreicella sp. SE45]
          Length = 269

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 79/169 (46%), Gaps = 5/169 (2%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI-KSILPPRLPVTCMPVEPIGYSIEHM 79
           + +V+LP+G+ E  G H PM  D + A  +A  I K+     +     PV P G      
Sbjct: 22  EAVVLLPMGSLEDQGIHAPMG-DYLAADLMAMEIAKAAREGGVSTFVAPVIPFGGKDYFE 80

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              G  ++++A        +   + + GIRKI+I+N HGGN P ++ V+   R +  + +
Sbjct: 81  SSHGGISISHATLCGILDDMFGCLNRHGIRKIMIVNGHGGNVPAITEVALRWRQKAGLFI 140

Query: 140 VSTS-W--SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
            S   W  +   +P  I +        HGG+  TS+ L   P L++ DL
Sbjct: 141 PSMYLWQVAYGELPALIGAEKAKASSGHGGDPLTSVGLHFYPDLIRKDL 189


>gi|283779450|ref|YP_003370205.1| Creatininase [Pirellula staleyi DSM 6068]
 gi|283437903|gb|ADB16345.1| Creatininase [Pirellula staleyi DSM 6068]
          Length = 263

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 79/184 (42%), Gaps = 18/184 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVTCMPVEPIGYSIEHMYV 81
           + VLPLGA E H  HLP  TD      + E I +    R   V  +P  P G        
Sbjct: 21  VAVLPLGATEPHNLHLPYGTDLFEGTIVGEHIVAEAHRRGGRVVLLPTIPFGTETNMQEF 80

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
                +  +        +I +  K GI KIV+LN+HGGN     +     ++  S+ +  
Sbjct: 81  PLAINVNPSTLFAFITDVIHSCIKSGIHKIVLLNSHGGNEMKPLLRELADKVDASLFLC- 139

Query: 142 TSWSRFTIPQGIISFPETEI----GIHGGEIETSMMLALAPHLVKMD-----LAENFSSR 192
            +W R      +I+  E++I      H GE+ETS  LA  P  V  +      A+N S+ 
Sbjct: 140 -NWYR------VIADVESQIFEHREDHAGEMETSFGLAYFPQFVARNANGTLAADNGSTA 192

Query: 193 QSEF 196
            S+F
Sbjct: 193 PSQF 196


>gi|170760294|ref|YP_001788743.1| putative creatinine amidohydrolase [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169407283|gb|ACA55694.1| putative creatinine amidohydrolase [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 279

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 104/226 (46%), Gaps = 21/226 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR---LPVTCMPVEPIGYSIEHM 79
           ++ + L   E+HGPHLP+ TD I A  L + +   L  +         P  PIGY+   M
Sbjct: 23  VIFVALSPIEEHGPHLPLGTDYISAKDLLKAVIDNLEKQNNAYNYIIHPSFPIGYNECVM 82

Query: 80  YVDGTKTLTYAEAIEHWLAII-DAIRKMGIRKIVILNAH------GGNSPLVSIVSTEAR 132
              GT +   +E +E+ +  + ++I + G +K+VI+N H              I++ E  
Sbjct: 83  NYPGTISFK-SETVENIIVDLGESISRSGFKKMVIVNHHLDLGHIKAIENAKDILNKECS 141

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIG--IHGGEIETSMMLALAPHLVKMDLAENFS 190
           ++   +  S  +SR       I   + ++   IH    ETS ML   P LVK    + +S
Sbjct: 142 LKVLEVASSIIYSRSEKENAKIVKNDLDMKREIHADVRETSFMLFKHPELVK----DCYS 197

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           +    +L   +++++ GS    + M++    G +G+    + +KG+
Sbjct: 198 TLDPIYLDMKEFIKSGGSCWKKYGMEE----GYIGSPAKGSKEKGK 239


>gi|291563441|emb|CBL42257.1| Uncharacterized protein, putative amidase [butyrate-producing
           bacterium SS3/4]
          Length = 253

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 76/168 (45%), Gaps = 20/168 (11%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS----ILPPRLPVTCMP-VEPIG 73
            K+ +V++ +G+ E HG H+P+ TDT+I   L E+I+     ++ P +P    P + P  
Sbjct: 16  EKNDMVLVSIGSIECHGRHMPLGTDTLIPNHLLEKIEKKSDVLIAPTIPYGSTPGLAPYP 75

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
            SI+   +D      +         +  ++ + G RK V LN HGGN  ++  +  E   
Sbjct: 76  GSID---IDSEVLYQFCR------QVFLSLYRHGARKFVFLNGHGGNIKMIQRLGMEFED 126

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           +  ++ +   W                 G HGG  ET+ +L + P LV
Sbjct: 127 KDCLVAMLNWWMM------AWDMNPAWKGGHGGGEETAAILGIDPSLV 168


>gi|134294090|ref|YP_001117826.1| creatininase [Burkholderia vietnamiensis G4]
 gi|134137247|gb|ABO58361.1| Creatininase [Burkholderia vietnamiensis G4]
          Length = 259

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 78/172 (45%), Gaps = 20/172 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV+P GA EQHGPHLP++ D   A  LA  I ++L   L     P   +G S  HM   G
Sbjct: 31  VVIPCGAIEQHGPHLPLSMDADHADALAVEIATLLGRTL---IAPTIRVGCSKHHMAFPG 87

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           T +L   TYA     +   + A    G + I + +AH GN   +  +  E R      V 
Sbjct: 88  TISLQEHTYAALCHDYCVSLAA---HGFKCIYLFSAHVGNFNALHAMLPELRQAVGPDVQ 144

Query: 141 STSWS---------RFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
             +++         R  + +     PE+ +G H    ETS+M+ L P  V++
Sbjct: 145 VLAYTDHQAWLREWRLAVEEA-GGDPES-VGGHADIAETSLMIHLDPDSVRL 194


>gi|312137429|ref|YP_004004766.1| creatininase [Methanothermus fervidus DSM 2088]
 gi|327507631|sp|E3GWT5|ARFB_METFV RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|311225148|gb|ADP78004.1| Creatininase [Methanothermus fervidus DSM 2088]
          Length = 247

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 70/140 (50%), Gaps = 17/140 (12%)

Query: 9   DNSLPLCADA------RKDWIVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           D  L L  DA      +   + VL LG+Y E HGP LP++TD  IA+ LA         +
Sbjct: 11  DTKLKLNYDAGNIISPKVHSVGVLALGSYLENHGPVLPIDTDIKIASYLALNASIKTGAK 70

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRK-MGIRKIVILNAHGGN 120
              T  P      + E+ YV     ++  + IE+ ++I+    K +GI K VI+NAHGGN
Sbjct: 71  FIGTVYP------ATEYPYVKHGIHVSVKDLIENIVSIMKLANKYIGIDKSVIVNAHGGN 124

Query: 121 SPL---VSIVSTEARMRFSM 137
            PL   ++++  E  M+  M
Sbjct: 125 LPLKKHINVIERETGMKIVM 144


>gi|262197160|ref|YP_003268369.1| creatininase [Haliangium ochraceum DSM 14365]
 gi|262080507|gb|ACY16476.1| Creatininase [Haliangium ochraceum DSM 14365]
          Length = 246

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 74/166 (44%), Gaps = 8/166 (4%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++  V++P+G+ EQHGP   + TD + A  +A R+ +       +   P  P+G +  HM
Sbjct: 19  RERAVLVPIGSTEQHGPIGIIGTDFVCAEVIARRVGA----ESKLLVAPTIPVGMARHHM 74

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              G+ TL     +      + +  + G R +V +N HGGN P      +  R  F+   
Sbjct: 75  AFPGSLTLRPETLMAVLRDYVWSFYQHGFRCVVFVNGHGGNIPTAQAALSNIREEFADAQ 134

Query: 140 VS-TSWSRFTIPQGIIS--FPETEIGIHGGEIETSMMLALAPHLVK 182
           V    W R    Q +    + + E G H    E S+ +A  P +VK
Sbjct: 135 VQWFDWFRCQPVQELARQLYGDRE-GAHATPSEVSVTMAAYPEVVK 179


>gi|172057656|ref|YP_001814116.1| creatininase [Exiguobacterium sibiricum 255-15]
 gi|171990177|gb|ACB61099.1| Creatininase [Exiguobacterium sibiricum 255-15]
          Length = 260

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 67/142 (47%), Gaps = 6/142 (4%)

Query: 2   NPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           N L++   NS  +  D++     +L +GA EQ GP+LPM+ DT+I    AE   ++   R
Sbjct: 4   NELMLSYKNSTKVIKDSQTV-TAILSVGATEQFGPYLPMHLDTLI----AEHQATVFGER 58

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           L    +P  P   S EH    GT T++          II  + + G  + ++ N HGG  
Sbjct: 59  LNAYVLPTLPFNTSEEHANQIGTVTVSPTVLSMMLEEIIVNLHRQGFTQFILCNGHGGAY 118

Query: 122 PLVSIVSTEARMRFSMLVVSTS 143
              + V  +   ++  LVV T+
Sbjct: 119 WESAFVK-QINFKYPELVVITT 139


>gi|120402309|ref|YP_952138.1| creatininase [Mycobacterium vanbaalenii PYR-1]
 gi|119955127|gb|ABM12132.1| Creatininase [Mycobacterium vanbaalenii PYR-1]
          Length = 247

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 75/166 (45%), Gaps = 22/166 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY--SIEHMYV 81
           +V+P+G+ EQHGPHLP++TDT IA+ +A+ + + L        +    IGY  S EH   
Sbjct: 30  LVVPVGSTEQHGPHLPLDTDTRIASAVADALVTRLRAGGGPDWLIAPAIGYGASGEHEGF 89

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIR---KIVILNAHGGNSPLVSIVSTEARMRFSML 138
            GT ++      E    ++    +   R   ++V +N HGGN         EA  R   L
Sbjct: 90  AGTVSIGTPVLAE----LLTEFARSACRWAPRVVFVNGHGGN--------VEALRRAVTL 137

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           +          P        +    H G  ETS++L ++P  V+ D
Sbjct: 138 LRHEGRDAVWCP-----CTSSNADAHAGHTETSVLLHISPAAVRQD 178


>gi|253998660|ref|YP_003050723.1| Creatininase [Methylovorus sp. SIP3-4]
 gi|253985339|gb|ACT50196.1| Creatininase [Methylovorus sp. SIP3-4]
          Length = 256

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 73/163 (44%), Gaps = 7/163 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH-MYVD 82
            +LP+GA EQHGPH+    D I+A  L   +         V  +P  P G S+ H     
Sbjct: 24  AMLPIGATEQHGPHMGCGMDYILADILCREVAE----STGVPMLPTMPYGCSVGHSRRWP 79

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  L+    I     I D     G+R++ I+N+H  N+  +       R     ++V+ 
Sbjct: 80  GTIALSPITLINLVKEIGDWAYHSGVRRLFIINSHVTNAAPLRCALEMLRSEHDDMMVAV 139

Query: 143 SWSRFTIPQGIISFPETE-IGIHGGEIETSMMLALAPHLVKMD 184
             +  T+   +  F   +    H  + ETS+ML  APH+V+ D
Sbjct: 140 I-NTATMSPRVKQFHHADGDDWHANDAETSLMLEKAPHIVRTD 181


>gi|148259565|ref|YP_001233692.1| hypothetical protein Acry_0549 [Acidiphilium cryptum JF-5]
 gi|326402771|ref|YP_004282852.1| hypothetical protein ACMV_06230 [Acidiphilium multivorum AIU301]
 gi|146401246|gb|ABQ29773.1| Uncharacterized protein putative amidase-like protein [Acidiphilium
           cryptum JF-5]
 gi|325049632|dbj|BAJ79970.1| hypothetical protein ACMV_06230 [Acidiphilium multivorum AIU301]
          Length = 262

 Score = 55.8 bits (133), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 71/165 (43%), Gaps = 13/165 (7%)

Query: 29  GAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT-CMPVEPIGYSIEHMYVDGTKTL 87
           G+ E  G H PM  D  +AA LA RI         +T   P  P G +     V G   L
Sbjct: 29  GSQEDQGAHAPMG-DFRLAAALAGRIARAATEAGTLTLAAPALPFGAADHFGAVPGGLAL 87

Query: 88  TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRF 147
             A        +I  +R+ G+ +IVILN HGGN+PLV  V+   R     ++ S     F
Sbjct: 88  APATFRAVLADLIADLRRTGLDRIVILNGHGGNAPLVHEVTLSIRRAGGPIIPS-----F 142

Query: 148 TIPQGIISFPETEIGI------HGGEIETSMMLALAPHLVKMDLA 186
            + +      E  IG       HG E   S+ LAL P   + DLA
Sbjct: 143 YLWKVARRLMERRIGPAAGRFGHGAEPLASITLALRPDAARPDLA 187


>gi|222479346|ref|YP_002565583.1| Creatininase [Halorubrum lacusprofundi ATCC 49239]
 gi|222452248|gb|ACM56513.1| Creatininase [Halorubrum lacusprofundi ATCC 49239]
          Length = 274

 Score = 55.5 bits (132), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 104/259 (40%), Gaps = 25/259 (9%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D+ +    ++P+G  EQHGPHLPM TD++I   + ERI            +   PI Y  
Sbjct: 20  DSSETPTALIPVGTTEQHGPHLPMGTDSMIPTEICERIAE------DTDALVGPPINYGA 73

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIID---AIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
             M+  G + +TY         + D   ++ + G   IV ++ H  N     + + +A  
Sbjct: 74  SDMHA-GYEGITYLPYRTLATVVRDLAYSLAESGFTDIVFISGHLTNDWAAKVGANQASH 132

Query: 134 RFSMLVVSTS---WSRFTIP--QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
                  + +   W   +    +  +SF   + G H    ET+ ++A+   LV +     
Sbjct: 133 DLPEEHYAYAFPYWDALSSDDMEDYLSF---DAGWHANIGETAAVMAINEGLVDLSETPY 189

Query: 189 FSSRQSEFLRNFKYLRAH---GSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
                 E + N   L  H   G  +F + + D    GV G+  DAT + GE       + 
Sbjct: 190 DDPDMPEDIENPGALLDHLPIGKGAF-YRVSD---TGVWGDPSDATAELGEEYFETITHA 245

Query: 246 FIQLLNDINSFDVSIFDKD 264
             +L+N        I+ +D
Sbjct: 246 VAELINTFQEVRDDIYVRD 264


>gi|254514605|ref|ZP_05126666.1| creatininase [gamma proteobacterium NOR5-3]
 gi|219676848|gb|EED33213.1| creatininase [gamma proteobacterium NOR5-3]
          Length = 233

 Score = 55.5 bits (132), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 57/100 (57%), Gaps = 5/100 (5%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
            VLPLG+ EQH  +L ++ D+I++  +A  + +  P  +PV   P  P G +   M   G
Sbjct: 21  CVLPLGSTEQHA-YLSLSVDSILSEKMA--VDAASPLDVPV--FPAVPYGVTPYFMGFPG 75

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           T +LT +        ++D++   G R+++I+N HGGNSP+
Sbjct: 76  TVSLTMSTYELVLREVLDSLYTHGFRRVLIVNGHGGNSPV 115


>gi|292900677|ref|YP_003540046.1| amidohydrolase [Erwinia amylovora ATCC 49946]
 gi|291200525|emb|CBJ47654.1| putative amidohydrolase [Erwinia amylovora ATCC 49946]
 gi|312170999|emb|CBX79258.1| creatininase [Erwinia amylovora ATCC BAA-2158]
          Length = 250

 Score = 55.5 bits (132), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 87/189 (46%), Gaps = 22/189 (11%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTII----AAGLAERIKSILPPRLPVT 65
           +S  +C++  +   ++  +G  EQHGPHLP+N DT+I    A  LA   + I+ P  P++
Sbjct: 13  SSESICSNV-EGRTLIWAIGGIEQHGPHLPLNVDTLIPEAFAKALALDCQGIMLPVQPLS 71

Query: 66  CMPVEPIGYSIEH---MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
              +   G  ++    ++VDG+  + Y          + ++  +  R+IVI+N H  N  
Sbjct: 72  VRSLPQSGGGLQFPGTLFVDGSTFIDY------LADTLKSLCSLPFRQIVIINGHYENEG 125

Query: 123 LV-----SIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
            +      + ST A    S L     +  S   + + +  FP      H G  ETS+M+ 
Sbjct: 126 FIFEALDRVRSTGAFAERSALAFSWWSMVSSSWVVENLPGFPGWH-AEHAGMTETSLMMY 184

Query: 176 LAPHLVKMD 184
           L P LV  +
Sbjct: 185 LKPELVSCE 193


>gi|167043903|gb|ABZ08591.1| putative creatinine amidohydrolase [uncultured marine crenarchaeote
           HF4000_APKG3H9]
          Length = 233

 Score = 55.5 bits (132), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 99/220 (45%), Gaps = 23/220 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH--MYV 81
           V++P+G+ EQHG HLP+ TD+ I   +A R    L  +      P    G S EH  ++ 
Sbjct: 22  VIIPVGSLEQHGAHLPITTDSDIVTEIASR----LAKKCGFIVFPTISYGVSEEHAPLFN 77

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
                    + ++    I  ++ K  I+ +VILN H GN+  V   +T   + +   ++ 
Sbjct: 78  ASISDTLLPDLLK---GIFHSLVKNKIKSVVILNGHHGNARAVQHSTTP--LSYWRKIIK 132

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR-QSEFLRNF 200
             +  +        F + E   H G +ETS+MLA++  +      +   ++  SE  +  
Sbjct: 133 LRYYSY------WHFMKHEFD-HAGFVETSLMLAISDKVKMKKAKKGLITKGMSE--KEI 183

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           + ++   + S G+     N  GV G+   AT K GE  L+
Sbjct: 184 QRIKKLSTESGGFPKVAKN--GVWGDPTSATKKDGEKFLA 221


>gi|313902638|ref|ZP_07836037.1| Creatininase [Thermaerobacter subterraneus DSM 13965]
 gi|313467076|gb|EFR62591.1| Creatininase [Thermaerobacter subterraneus DSM 13965]
          Length = 292

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 91/230 (39%), Gaps = 29/230 (12%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIK----SILPPRLPVTCMPVEPIG 73
           AR D   +LPL + E HGPH+P+ TD I+A GLA R++    ++L P    T  P +   
Sbjct: 43  ARAD-FALLPLASLEWHGPHMPLGTDLILAEGLARRLRGDFTALLYPPFTYTACPGKTRH 101

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           Y        GT  L    A+     ++  I   G  ++++LNAH  N  +    +     
Sbjct: 102 YP-------GTVALRAEVALAALCDVLRGILGAGFVRVMMLNAHDANMAIGRAAAEAVSG 154

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEI------GIHGGEIETSMMLALAPHLVKMDLAE 187
            F   ++  +W +    +        E         HGG  E +   AL P  V   LA 
Sbjct: 155 EFRASILLVNWWQMVTTEETAGMFRAEAGDGRPGRGHGGPFEAAATAALDPGSVDPALAA 214

Query: 188 NFSSRQSEFL-RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
               R+     R F  + +H S    W+       G  G   DAT  KG 
Sbjct: 215 ELPPRRPPAAERPFVLVESHPSP---WA-------GYAGFVRDATEAKGR 254


>gi|160881359|ref|YP_001560327.1| creatininase [Clostridium phytofermentans ISDg]
 gi|160430025|gb|ABX43588.1| Creatininase [Clostridium phytofermentans ISDg]
          Length = 233

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 72/167 (43%), Gaps = 18/167 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE---HMY 80
           +++P+G  EQHGPHLP+N DT+ A   AE + +         C+    I Y +     + 
Sbjct: 21  LIIPVGTCEQHGPHLPLNNDTLCAEYFAEELSN------ATGCLVAPTINYGVNLPCDIS 74

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT T++          I+D  +K G     I+  HG   P    + T   +  ++ ++
Sbjct: 75  FTGTTTISKDTLKNIITEIVDWWKKQGFENFFIITFHG--DPFH--IDTLCNISENVYLI 130

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
                 +T   GI+    T    H  E ETS+ L L P  V+  L E
Sbjct: 131 EAYEIDYT---GILDKQST--MRHACEAETSVALWLYPEKVRTMLME 172


>gi|325261148|ref|ZP_08127886.1| putative creatinine amidohydrolase [Clostridium sp. D5]
 gi|324032602|gb|EGB93879.1| putative creatinine amidohydrolase [Clostridium sp. D5]
          Length = 246

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 100/238 (42%), Gaps = 18/238 (7%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
           +F  N      + R+   V++ LG+ E+HG HLP+ TDTI+A   A+ I      R  + 
Sbjct: 4   LFYQNWTAASKNIRESEGVLITLGSVEEHGLHLPLGTDTILAQAFAQEICE----RENMY 59

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
             P    G        + T ++  A    + L  ++++ +   R+I++ + H GN  ++ 
Sbjct: 60  YYPCITYGQVWSARDFESTISINPACLENYCLQAVESVMRARPRRIILFSFHNGNHKVID 119

Query: 126 -IVSTEARMRFSMLVVSTSWSRFTIPQG-IISFPETEIGI-HGGEIETSMMLALAPHLVK 182
            ++ T         V     +      G I++ P     I H GE+ETS+ML +   LV 
Sbjct: 120 DVLRTLTDRGDGENVFHIKAAGIEKKAGHILTTPLWNGSIWHAGELETSLMLYVNEELVD 179

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           M  A       +EF         +G     W  ++    G  G+A  AT +KG  L  
Sbjct: 180 MKAA------TAEFP---PVPLLYGKKPIPW--REFLESGAFGDASAATAEKGRELFE 226


>gi|88704946|ref|ZP_01102658.1| Creatininase [Congregibacter litoralis KT71]
 gi|88700641|gb|EAQ97748.1| Creatininase [Congregibacter litoralis KT71]
          Length = 233

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 5/100 (5%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
            VLPLG+ EQH  +L ++ D+I    L+E++ +     L V   P  P G +   M   G
Sbjct: 21  CVLPLGSTEQHA-YLSLSVDSI----LSEKMATDAAEPLHVPVFPAVPYGVTPYFMGFPG 75

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           T +LT          ++D++   G R+++I+N HGGNSP+
Sbjct: 76  TVSLTMQTYEALVRDVLDSLYTHGFRRVLIVNGHGGNSPV 115


>gi|13472999|ref|NP_104566.1| hypothetical protein mlr3472 [Mesorhizobium loti MAFF303099]
 gi|14023747|dbj|BAB50352.1| mlr3472 [Mesorhizobium loti MAFF303099]
          Length = 313

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 79/174 (45%), Gaps = 14/174 (8%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL--PV-TCMPVEPIGYSIEHMY 80
           +++P+G  EQ GP + +    +    LAE+I   L   L  PV + +P   I     HM 
Sbjct: 90  IIVPIGGTEQSGPAMALGKHNVRVKFLAEKIAGQLGNALVAPVISYVPEGTIDPPSAHMR 149

Query: 81  VDGTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM-- 137
             GT T++  E  E  LA    + R  G + IV++  HGG       V+      +S   
Sbjct: 150 FPGTITIS-DEIFEQLLASAARSFRLHGFKTIVLIGDHGGYQADERHVADRLNAEWSKSP 208

Query: 138 LVVSTSWSRFTIPQGI-------ISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           + V  +   + I QG            ++EIG H G  +TS+MLA+ P +V+ D
Sbjct: 209 VRVFAALQYYQITQGAYVDKLLSAGARQSEIGTHAGLADTSLMLAIDPSMVRKD 262


>gi|292486929|ref|YP_003529799.1| creatininase [Erwinia amylovora CFBP1430]
 gi|291552346|emb|CBA19391.1| creatininase [Erwinia amylovora CFBP1430]
          Length = 250

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 87/189 (46%), Gaps = 22/189 (11%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTII----AAGLAERIKSILPPRLPVT 65
           +S  +C++  +   ++  +G  EQHGPHLP+N DT+I    A  LA   + I+ P  P++
Sbjct: 13  SSESICSNV-EGRTLIWAIGGIEQHGPHLPLNVDTLIPEAFAKALALDCQGIMLPVQPLS 71

Query: 66  CMPVEPIGYSIEH---MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
              +   G  ++    ++VDG+  + Y          + ++  +  R+IVI+N H  N  
Sbjct: 72  VRFLPQSGGGLQFPGTLFVDGSTFIDY------LADTLKSLCSLPFRQIVIINGHYENEG 125

Query: 123 LV-----SIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
            +      + ST A    S L     +  S   + + +  FP      H G  ETS+M+ 
Sbjct: 126 FIFEALDRVRSTGAFAERSALAFSWWSMVSSSWVVENLPGFPGWH-AEHAGMTETSLMMY 184

Query: 176 LAPHLVKMD 184
           L P LV  +
Sbjct: 185 LKPELVSCE 193


>gi|126465634|ref|YP_001040743.1| hypothetical protein Smar_0732 [Staphylothermus marinus F1]
 gi|126014457|gb|ABN69835.1| Uncharacterized protein putative amidase-like protein
           [Staphylothermus marinus F1]
          Length = 229

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 78/186 (41%), Gaps = 19/186 (10%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL------PPRLPVTCMPVEPIGYSI 76
           I ++P G+YE HG  LP++TD++I    AE I S+          + +   PV   GYSI
Sbjct: 17  IAIIPTGSYEYHGEDLPLDTDSVI----AEEIVSLCINNFKYEKNINIHIYPVLKYGYSI 72

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRK-MGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
           E +   GT  +     ++   +I+D+I K +     + +N HGGN  L+ + S +     
Sbjct: 73  EWLKYPGTINVDPKIYLDLLDSIVDSIEKNISPAGYIFVNGHGGNYSLLEVFSRKKFYEL 132

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL-AENFSSRQS 194
               +     R     G+          HG   E  +   L    +K +   E   S  +
Sbjct: 133 KKPFIIIDIWRIASGYGLKY-------CHGCLFEQQLYSCLTSKSIKENYREEQICSSYN 185

Query: 195 EFLRNF 200
           E L+ +
Sbjct: 186 ELLKGY 191


>gi|171911207|ref|ZP_02926677.1| hypothetical protein VspiD_08535 [Verrucomicrobium spinosum DSM
           4136]
          Length = 261

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 70/161 (43%), Gaps = 8/161 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGL-AERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           + VLP+GA E H  HLP  TD+     L +E  +        V  +P  P G     + +
Sbjct: 28  VAVLPMGATEAHNWHLPYGTDSFQNVALCSEAGRQAWEQGAKVAILPNIPFGVQTGQLDI 87

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
                +  +  +     +I ++  +GI K+V+ N HGG+      +  E + ++  + +S
Sbjct: 88  PFCINMNPSTQLALLNDVIASLVGVGIPKLVVFNGHGGSD--FKQMLRELQAKWPQIFLS 145

Query: 142 TS-WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           T  W       GI       +G H  E ETS+ML   P LV
Sbjct: 146 TVFWPNIDSGAGIFDV----LGDHADERETSLMLHFHPELV 182


>gi|260655430|ref|ZP_05860918.1| putative creatinine amidohydrolase [Jonquetella anthropi E3_33 E1]
 gi|260629878|gb|EEX48072.1| putative creatinine amidohydrolase [Jonquetella anthropi E3_33 E1]
          Length = 266

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 2/104 (1%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A+ D + + PLG+ EQHG   P+ TD II   +A R+++  P +  V  +P  P G    
Sbjct: 15  AKDDLVALQPLGSTEQHGSIGPLGTDFIIPHEMARRVEAQFPDK--VVLLPTIPYGVCPS 72

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
                G+  +          +++  + + G+++ + LN HGGN+
Sbjct: 73  FESFAGSIDIGDEALATILTSVVRDLSRHGVKRFIFLNGHGGNT 116


>gi|261855406|ref|YP_003262689.1| creatininase [Halothiobacillus neapolitanus c2]
 gi|261835875|gb|ACX95642.1| Creatininase [Halothiobacillus neapolitanus c2]
          Length = 265

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 70/162 (43%), Gaps = 5/162 (3%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH-MYVD 82
            +LP+GA EQHGPH+    D+ +A  L     +    +  V  +P  P G S+ H     
Sbjct: 24  AILPVGATEQHGPHMGCGMDSELAGQLCRDAAA----QTGVFLLPTLPYGCSVGHSRRWP 79

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT  +     I+    I D +   GI ++ I+N+H  N+  +       R     L+V+ 
Sbjct: 80  GTLAVQPKTLIDLVKEIGDWVHSAGINRLFIINSHVTNAAPLRCALEMLRAEHDGLMVAL 139

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             S    P+   +        H    ET++M  LAP LV+ D
Sbjct: 140 INSAQISPRVRDAHHADGDDWHANAAETALMQYLAPELVRED 181


>gi|33864081|ref|NP_895641.1| creatininase [Prochlorococcus marinus str. MIT 9313]
 gi|33635665|emb|CAE21989.1| Creatininase [Prochlorococcus marinus str. MIT 9313]
          Length = 262

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V+LPLG+ EQHGP   + TD + A  LA  +      R  V   P +  G +  H+   G
Sbjct: 35  VILPLGSTEQHGPTGAIGTDALTAEALALEVGR----RTGVLVTPTQAFGMAEHHLGFAG 90

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  A  +     ++ ++   G  +I ++N HGGN
Sbjct: 91  TMSLKPATLLALIHDLVISLANHGFERIFVINGHGGN 127


>gi|288919782|ref|ZP_06414107.1| Creatininase [Frankia sp. EUN1f]
 gi|288348790|gb|EFC83042.1| Creatininase [Frankia sp. EUN1f]
          Length = 273

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 103/239 (43%), Gaps = 35/239 (14%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR---------LPVTCMPVEPIG 73
           +V++P+G+ EQHGPHLP+ TDT IA  +AE     L            +PV   P  P+ 
Sbjct: 16  LVLVPVGSCEQHGPHLPLTTDTTIAVAVAEGAAEHLRQHQHLRQHGAAVPVLVAP--PVI 73

Query: 74  Y--SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTE 130
           Y  S EH    GT ++         + ++ ++R      IV +NAHGGN   L   VS  
Sbjct: 74  YTASGEHQGFPGTMSIGTQALRLLLVELVRSMRDWS-GPIVFVNAHGGNLRGLAEAVSQL 132

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFP---------ETEIGIHGGEIETSMMLALAPHLV 181
                 +  +++   R +  +G              +     H G  ETS+ML LAP  V
Sbjct: 133 RHEGHDVAWLASGAGRDSASRGSAGHDDAGHDDAGRDAATDSHAGFTETSLMLHLAPEQV 192

Query: 182 KMDLAENFSSRQ-SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           +M  A+  ++   +E +                 +  + P GV+G+   A+ + GE LL
Sbjct: 193 RMRRAQPGNTAPLAELMPAIAAG----------GVAAVAPSGVLGDPTAASARAGEELL 241


>gi|114777819|ref|ZP_01452750.1| Creatininase [Mariprofundus ferrooxydans PV-1]
 gi|114551810|gb|EAU54350.1| Creatininase [Mariprofundus ferrooxydans PV-1]
          Length = 244

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 57/111 (51%), Gaps = 12/111 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP+  + TD I    IAAG+AE+ + ++ P +          G S  HM
Sbjct: 21  IIIPIGSTEQHGPNGLIGTDAICPTRIAAGIAEQEQILIAPTINY--------GMSQHHM 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
              GT TL     I+  + ++ ++ + G      +N HGGN   V+   +E
Sbjct: 73  AFPGTVTLRPTTLIQVVIDVVTSLHRHGFTHFYFVNGHGGNIAPVTTAFSE 123


>gi|289524184|ref|ZP_06441038.1| putative creatinine amidohydrolase [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
 gi|289502840|gb|EFD24004.1| putative creatinine amidohydrolase [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
          Length = 369

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 103/253 (40%), Gaps = 24/253 (9%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI---GYS 75
           RK+ IV +P+G  E HG H     DT +   + E I+     +     + + P+   G+ 
Sbjct: 70  RKNDIVFVPIGCTENHGLHANSGLDTFMVTQILEGIRRYTAKKGHEVNLALPPLNYGGHP 129

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA-RMR 134
             H+ + GT  +      E  + ++  +   G RKI+++N HG    L S V     R +
Sbjct: 130 YHHVGMPGTIIMPKEVVEETLIYVMLGLWNDGYRKIILINNHGHLWMLESAVQEFCKRFQ 189

Query: 135 FSMLVVSTSWSR----FTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN-- 188
              + +   W R    F  P       ET   +H  E ETS+   L P ++ M   ++  
Sbjct: 190 LPGIFMVIDWHRAVREFFFPVDREDSLETHF-VHADESETSVAQLLFPDMIDMKYVQDAE 248

Query: 189 ---------FSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
                    F      F R   + +  G  +     +   P+GVVG+   A  KK +  +
Sbjct: 249 GESFLPDGHFDKSVDPFHRPMAWSQGEGHMAI---ERAATPEGVVGHPSKANPKKAKRPI 305

Query: 240 SYFANCFIQLLND 252
           +   + ++ LL+D
Sbjct: 306 AAILS-YLTLLHD 317


>gi|293392803|ref|ZP_06637121.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291424662|gb|EFE97873.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 233

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           AR D  V+L LG+ EQH  +L + TD ++A+ LAE+       RL +   P  P G +  
Sbjct: 16  ARDD-RVILSLGSTEQHA-YLSLCTDHLLASRLAEQAGE----RLGIAVYPGLPFGMAPY 69

Query: 78  HMYVDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
                GT  L   TY   +E    ++ ++ + G R+I +LN HGGNSP+
Sbjct: 70  FSQFPGTINLRPATYNALLED---LLSSLYQSGFRRIFLLNGHGGNSPV 115


>gi|296115792|ref|ZP_06834418.1| creatininase [Gluconacetobacter hansenii ATCC 23769]
 gi|295977769|gb|EFG84521.1| creatininase [Gluconacetobacter hansenii ATCC 23769]
          Length = 303

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 82/181 (45%), Gaps = 20/181 (11%)

Query: 20  KDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS--- 75
           + W  V++P+G  EQ GP + +    + A  L++RI   +   L    +   P G +   
Sbjct: 75  QGWTSVIIPVGGTEQSGPFIAVGKHNVRATVLSQRIAHEVGHMLVAPTIAYVPEGGTSPR 134

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
             HM   GT ++  A   E      +++R  G R+IV+L  HGG    +  V+     R+
Sbjct: 135 TSHMRFAGTLSIPPAVFRELVTGAAESLRVQGFRRIVLLGDHGGYQKDLRTVAQVLNRRW 194

Query: 136 SML------------VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +              VV+ S++ +   +G+      ++G H    +TS+MLA+ P +V+ 
Sbjct: 195 AGTGAHVIYLGAYYDVVAGSYADYLRRRGL----GADVGTHADLSDTSLMLAVQPDMVRQ 250

Query: 184 D 184
           D
Sbjct: 251 D 251


>gi|317968660|ref|ZP_07970050.1| hypothetical protein SCB02_03893 [Synechococcus sp. CB0205]
          Length = 258

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A  +A  +      RL V   P +  G +  H+   G
Sbjct: 29  VIIPLGSTEQHGPTGAIGTDALTAEAVALEVGR----RLGVLVTPAQAFGMAEHHLGFAG 84

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  +  +     +I ++ + G  +I ++N HGGN
Sbjct: 85  TMSLQPSTLLAVLHDLILSLARHGFERIYVINGHGGN 121


>gi|169630912|ref|YP_001704561.1| hypothetical protein MAB_3832c [Mycobacterium abscessus ATCC 19977]
 gi|169242879|emb|CAM63907.1| Conserved hypothetical protein (creatininase?) [Mycobacterium
           abscessus]
          Length = 248

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 95/230 (41%), Gaps = 54/230 (23%)

Query: 27  PLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP---VTCMPVEPIGYSIEHMYVDG 83
           PLG+ EQHGPHLP++TDT IA  +A    + L            P    G S EH    G
Sbjct: 33  PLGSTEQHGPHLPLDTDTRIAGAVATGAAAELAADGGDGRTALAPAIAYGASGEHQSFAG 92

Query: 84  TKTL----------TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIV---ST 129
           T ++           YA +   W            R+IVI+N HGGN   LVS V    +
Sbjct: 93  TISIGTEVLGRLLVEYARSAIQW-----------CRRIVIVNGHGGNIQGLVSAVRLLRS 141

Query: 130 EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENF 189
           E R          +W    +  G           H G +ETS++L ++P +V+ +  E  
Sbjct: 142 EGR--------DVAWWACAVEGG---------DAHAGHVETSLLLHISPDVVRRE--EVL 182

Query: 190 SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           +   +        +RA G       +  ++  GV+G+   A+ + G  +L
Sbjct: 183 AGNVAPLHELMAPMRAGG-------VAAVSAIGVLGDPTTASSQDGARML 225


>gi|114797561|ref|YP_762179.1| creatininase [Hyphomonas neptunium ATCC 15444]
 gi|114737735|gb|ABI75860.1| creatininase [Hyphomonas neptunium ATCC 15444]
          Length = 251

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 2/118 (1%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           K   +V+P+G++EQHGP+  + TD +    +A   +S+ P  + +   P   +G +  H+
Sbjct: 17  KSKTIVIPIGSFEQHGPNGFIGTDALCPEIIANHAESLAPDDILIG--PTFAVGCAQHHL 74

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
              GT TL  +  I   +   +++ + G  ++  LN HGGN   +    +E   R S 
Sbjct: 75  GFPGTVTLRPSTMIASMVDWTESLMRHGFERLYWLNGHGGNIATIEAAFSEIHARRSF 132


>gi|166368004|ref|YP_001660277.1| creatininase [Microcystis aeruginosa NIES-843]
 gi|166090377|dbj|BAG05085.1| creatininase [Microcystis aeruginosa NIES-843]
          Length = 255

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 54/101 (53%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP   + TD +    IA G+ +++++++ P L V        G ++ H 
Sbjct: 21  IIIPIGSTEQHGPTGLIGTDALCAEAIAKGVGKQVRAMVAPTLNV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              GT +L  +  I+  L  +  + + G R+   +N HGGN
Sbjct: 73  AFPGTISLRPSTLIQVILDYVTCLARAGFRQFFFINGHGGN 113


>gi|283785247|ref|YP_003365112.1| hypothetical protein ROD_15291 [Citrobacter rodentium ICC168]
 gi|282948701|emb|CBG88293.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 233

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 58/108 (53%), Gaps = 11/108 (10%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           ++D  V+LPLG+ EQH  +L + TD I+A+ LA  +      +L +   P  P G +   
Sbjct: 16  KQDNRVILPLGSTEQHA-YLSLCTDHILASRLATEVGE----QLDIPVYPGLPFGMAPYF 70

Query: 79  MYVDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               GT  L   TY   I     +++++ + G R+I +LN HGGNSP+
Sbjct: 71  TAFPGTINLQPATYNALIND---LLESLYQSGFRRIFLLNGHGGNSPV 115


>gi|121610815|ref|YP_998622.1| creatininase [Verminephrobacter eiseniae EF01-2]
 gi|121555455|gb|ABM59604.1| Creatininase [Verminephrobacter eiseniae EF01-2]
          Length = 225

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 61/110 (55%), Gaps = 11/110 (10%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +D  VV+P+G+ EQH  +L +  D I++  +A  +++  P ++PV   P  P G++   M
Sbjct: 9   RDDRVVVPIGSTEQHA-YLSLCVDAILSEQVA--VQAAEPLQVPV--YPALPFGFTPSFM 63

Query: 80  YVDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126
              GT +L   TY   I     ++D +   G ++++I+N HGGN P  S+
Sbjct: 64  GFPGTISLRLETYVAVIRD---MLDCLATHGFKRVLIVNGHGGNQPAASV 110


>gi|11282018|pir||T44251 creatininase (EC 3.5.2.10) [validated] - Arthrobacter sp.  (strain
           TE1826)
 gi|3116224|dbj|BAA25929.1| creatininase [Arthrobacter sp.]
          Length = 258

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 72/176 (40%), Gaps = 17/176 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY-----SIE 77
            ++LP+G+ EQHGPHLP+  D +I+   +  I       L     PV   GY     S  
Sbjct: 21  FLILPVGSTEQHGPHLPLGVDAVISTQFSLAIAR----ELNAAVAPVLSYGYKSLPASGG 76

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS----IVSTEARM 133
                GT  L  +        +++     G +KI+I +AH  N   +S    ++    + 
Sbjct: 77  GPMFPGTIDLKGSTLTSLVYDLLEEFIADGWKKILIFSAHFENEAFLSEACDLLLRNQKE 136

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIG----IHGGEIETSMMLALAPHLVKMDL 185
            F  +++   W   +       F E         H    ETS+M+  +P LVK DL
Sbjct: 137 EFPKVLICNWWDNLSAETMSKVFDEVRFPGWALEHAAISETSLMMHFSPELVKEDL 192


>gi|116626877|ref|YP_829033.1| creatininase [Candidatus Solibacter usitatus Ellin6076]
 gi|116230039|gb|ABJ88748.1| Creatininase [Candidatus Solibacter usitatus Ellin6076]
          Length = 314

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 75/167 (44%), Gaps = 14/167 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +V++P+ + E+HGP  P+ TD +   G+ E    ++  +  V   P+   G S  HM   
Sbjct: 53  MVIIPVASLEEHGPQTPIGTDFL--NGVEE--AKLIAKKTDVLVAPILLPGISPYHMEFP 108

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT T+++  A   +   + ++   G R+I+ +NAH GN  L + V+     R +    + 
Sbjct: 109 GTITISHDTAQRVYFEAVQSLIHHGFRRILFVNAHTGNQYLTAYVAD----RINQETPAI 164

Query: 143 SWSRFTIPQGIISFPETEIGI------HGGEIETSMMLALAPHLVKM 183
           +    T  QG      T          H G  ETS  + L P LV +
Sbjct: 165 ALELHTAMQGGAGAGPTNRSTPLPFDRHAGVGETSSAMYLIPTLVDL 211


>gi|315497781|ref|YP_004086585.1| creatininase [Asticcacaulis excentricus CB 48]
 gi|315415793|gb|ADU12434.1| Creatininase [Asticcacaulis excentricus CB 48]
          Length = 256

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 62/133 (46%), Gaps = 23/133 (17%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           V++P+G+ EQHGP   + TD +   I A  AE+   IL         P   IG +  H+ 
Sbjct: 29  VIIPIGSNEQHGPMGLLGTDWLCPEIIAHAAEKQGDIL-------VAPTFNIGMAQHHLG 81

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             GT +L   T+  AIE W   + ++ + G  +I  LN HGGN     + S EA   FS 
Sbjct: 82  FAGTISLRPSTFMAAIEDW---VKSLARHGFERIYFLNGHGGN-----VASIEA--AFSE 131

Query: 138 LVVSTSWSRFTIP 150
           +    SW     P
Sbjct: 132 IYSQWSWKGTRCP 144


>gi|218248213|ref|YP_002373584.1| Creatininase [Cyanothece sp. PCC 8801]
 gi|218168691|gb|ACK67428.1| Creatininase [Cyanothece sp. PCC 8801]
          Length = 248

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 60/124 (48%), Gaps = 12/124 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP   + TD I    IA G+ E +++++ P + V        G ++ H 
Sbjct: 21  LIIPIGSTEQHGPTGLIGTDAICAEAIAKGVGEEVQAMVAPTINV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              GT +L     I+  L  +  + + G R+   +N HGGN   +    +E     + L 
Sbjct: 73  AFPGTISLRPTTLIQVILDYLTCLTEAGFRRFFFINGHGGNIATLKAAFSEVYYHLAHLR 132

Query: 140 VSTS 143
           +S +
Sbjct: 133 LSEA 136


>gi|218531934|ref|YP_002422750.1| creatininase [Methylobacterium chloromethanicum CM4]
 gi|218524237|gb|ACK84822.1| Creatininase [Methylobacterium chloromethanicum CM4]
          Length = 266

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 86/215 (40%), Gaps = 24/215 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-D 82
            +LP+GA EQHGPHL    D ++A  L   + +    R  V  +P  P G S+ H     
Sbjct: 30  ALLPIGATEQHGPHLGCGMDFVLADLLCRAVSA----RTRVPMLPALPYGCSLGHSRRWP 85

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSMLVVS 141
           GT  L      E    I +     G+R++ ++NAH  N +PL   +         ++V  
Sbjct: 86  GTLALDPVVMTELVRQIGEQAYHSGVRRLFLVNAHVTNAAPLRCALELLRAAHDDLMVAL 145

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE-------------- 187
            + +  +       F + E   H    ET++M A AP LV+ D                 
Sbjct: 146 VNTATVSERVRAAHFADAE-DWHANRAETALMQAQAPALVREDRIAGADDPDRTQNLVFA 204

Query: 188 ---NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLN 219
              N +SR        +   A G+  F W ++DL 
Sbjct: 205 HPVNRTSRNGVTGFPSQASAAEGAELFAWMVEDLT 239


>gi|255017449|ref|ZP_05289575.1| hypothetical protein LmonF_06108 [Listeria monocytogenes FSL
           F2-515]
          Length = 121

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA EQHG HLP+  D  +A  LAE +      +     +P  P GYS     + 
Sbjct: 25  VAILPLGATEQHGHHLPLGVDIFLADHLAELVSE----KTGAVVIPPMPFGYSWVWRDIP 80

Query: 83  GTKTLT--YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           GT ++   + EAI   +A   ++ + G++ +V++N H  N+
Sbjct: 81  GTISIQQHHVEAIIKDVA--HSVSRYGVKMLVLINGHDSNN 119


>gi|317049154|ref|YP_004116802.1| Creatininase [Pantoea sp. At-9b]
 gi|316950771|gb|ADU70246.1| Creatininase [Pantoea sp. At-9b]
          Length = 231

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 57/105 (54%), Gaps = 5/105 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQH   L ++ D+I    LAER+ +       +   PV P G +       G
Sbjct: 21  VIVPLGSTEQHA-LLSLSVDSI----LAERVATEAAEPYGIPVFPVLPFGMTPAFSDYPG 75

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           T +L+    +     I++ +++ G R+I+ +N HGGN+P  +I+S
Sbjct: 76  TISLSMHTYVCLLNDILNNLKRQGFRRILFINGHGGNAPAQNIIS 120


>gi|300788797|ref|YP_003769088.1| creatinine amidohydrolase [Amycolatopsis mediterranei U32]
 gi|299798311|gb|ADJ48686.1| creatinine amidohydrolase [Amycolatopsis mediterranei U32]
          Length = 250

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 101/254 (39%), Gaps = 31/254 (12%)

Query: 11  SLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVE 70
           SLP   D  +  +++LP+GA E HGPH P+ TD +I+ G+ ER    L     V  + + 
Sbjct: 14  SLP---DDERVPVLLLPVGAIEPHGPHAPLGTDPLISRGMCERAAERLAADDDVHVLVLP 70

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIID---AIRKMGIRKIVILNAHGGNSPLVSIV 127
            + Y +          +   E   H L ++D   A+    + +I+++N H   + LV++ 
Sbjct: 71  EVPYGVTRFAAGFAGGIHIGEETLHSL-LVDIGAALIAQRLGRILLVNNHFEPAHLVTLR 129

Query: 128 STEARMRFSM--------LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
                + F+         LV      R T       F   E   H G  ETS++LA  P 
Sbjct: 130 RAAETLNFAYDGRVALLELVRRRHAERLT-----DEFRSGE--CHAGRYETSLVLADRPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV   L           L +     A      G+    +      G   +AT ++GE   
Sbjct: 183 LVDQTLMRT--------LPHVPVSLAAAPADGGFREMGMT-DAYCGKPAEATAREGEETF 233

Query: 240 SYFANCFIQLLNDI 253
           S   +  ++ + ++
Sbjct: 234 STLTDLLVEAIREL 247


>gi|159027077|emb|CAO89262.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 255

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 53/101 (52%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP   + TD +    IA G+  ++++++ P L V        G ++ H 
Sbjct: 21  IIIPIGSTEQHGPTGLIGTDALCAEAIAKGVGTQVRAMVAPTLNV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              GT +L  +  I+  L  +  + + G R+   +N HGGN
Sbjct: 73  AFPGTISLRPSTLIQVILDYVTCLARAGFRQFFFINGHGGN 113


>gi|124024119|ref|YP_001018426.1| creatininase [Prochlorococcus marinus str. MIT 9303]
 gi|123964405|gb|ABM79161.1| Creatininase [Prochlorococcus marinus str. MIT 9303]
          Length = 262

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V+LPLG+ EQHGP   + TD + A  +A  +      R  V   P +  G +  H+   G
Sbjct: 35  VILPLGSTEQHGPTGAIGTDALTAEAVALEVGR----RTGVLVTPTQAFGMAEHHLGFAG 90

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  A  +     ++ ++   G  +I ++N HGGN
Sbjct: 91  TMSLKPATLLALIHDLVMSLANHGFERIFVINGHGGN 127


>gi|226357758|ref|YP_002787498.1| creatinine amidohydrolase (creatininase) [Deinococcus deserti
           VCD115]
 gi|226320001|gb|ACO47994.1| putative creatinine amidohydrolase (creatininase) [Deinococcus
           deserti VCD115]
          Length = 242

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 63/119 (52%), Gaps = 17/119 (14%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           N + + A  R+D   VLPLG+ EQHG  + +  D I+   LA+ + + L        +PV
Sbjct: 7   NWMQVEAYLREDDRCVLPLGSTEQHG-FMSLAVDNILPERLAQEVAAPL-------GVPV 58

Query: 70  EP-IGYSIEHMY--VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            P + Y I   +    G+ TL   TY   +     ++D++ + G R+I+I+N HGGNSP
Sbjct: 59  FPTLNYGITPYFRAYPGSVTLRVQTYLSVVRD---VLDSLYEQGFRRILIVNGHGGNSP 114


>gi|33239716|ref|NP_874658.1| amidase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
 gi|33237241|gb|AAP99310.1| Predicted amidase [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
          Length = 266

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 50/97 (51%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           ++LP+G+ EQHGP   + TD + A  +A  +      R  V   P +P G +  H+   G
Sbjct: 39  IILPIGSTEQHGPTGAIGTDAMTAEAVAREVGI----RTGVLVTPTQPYGMAEHHLGFPG 94

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  +   +    ++ ++   G ++I I+N HGGN
Sbjct: 95  TMSLRSSTLQKLIHDLLISLVMHGFQRIFIINGHGGN 131


>gi|226355119|ref|YP_002784859.1| creatininase [Deinococcus deserti VCD115]
 gi|226317109|gb|ACO45105.1| putative Creatininase [Deinococcus deserti VCD115]
          Length = 225

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 55/107 (51%), Gaps = 11/107 (10%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           ++D   VLPLG  EQH   L + TD++    LAERI       L V   P  P G +   
Sbjct: 7   QRDDRCVLPLGCTEQHA-TLSLATDSL----LAERISLEAAGPLGVPVFPALPYGITPTF 61

Query: 79  MYVDGT---KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           M   GT   +T TY   +E    ++ ++   G R+I+++N HGGN+P
Sbjct: 62  MAYPGTLSLRTSTYLSVLED---LLGSLYTHGFRRILVVNGHGGNAP 105


>gi|116072093|ref|ZP_01469361.1| hypothetical protein BL107_08074 [Synechococcus sp. BL107]
 gi|116065716|gb|EAU71474.1| hypothetical protein BL107_08074 [Synechococcus sp. BL107]
          Length = 262

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A  +A  +      R  V   P +  G +  H+   G
Sbjct: 35  VIIPLGSTEQHGPTGAIGTDALTAEAIALEVGR----RTGVLVTPAQAFGMAEHHLGFAG 90

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  A  +     ++ ++ + G  ++ ++N HGGN
Sbjct: 91  TMSLQPATLLAVMQDLVLSLARHGFERVFVINGHGGN 127


>gi|257060466|ref|YP_003138354.1| creatininase [Cyanothece sp. PCC 8802]
 gi|256590632|gb|ACV01519.1| Creatininase [Cyanothece sp. PCC 8802]
          Length = 248

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 12/124 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP   + TD I    IA G+ E + +++ P + V        G ++ H 
Sbjct: 21  LIIPIGSTEQHGPTGLIGTDAICAEAIAKGVGEEVHAMVAPTINV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              GT +L     I+  L  +  + + G R+   +N HGGN   +    +E     + L 
Sbjct: 73  AFPGTISLRPTTLIQVILDYLTCLTEAGFRRFFFINGHGGNIATLKAAFSEVYYHLAHLR 132

Query: 140 VSTS 143
           +S +
Sbjct: 133 LSEA 136


>gi|329848306|ref|ZP_08263334.1| creatinine amidohydrolase family protein [Asticcacaulis
           biprosthecum C19]
 gi|328843369|gb|EGF92938.1| creatinine amidohydrolase family protein [Asticcacaulis
           biprosthecum C19]
          Length = 245

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 73/173 (42%), Gaps = 24/173 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           V++P+G+ EQHGP   + TD +   I A  AE+   +L         P   IG +  H+ 
Sbjct: 21  VIIPIGSNEQHGPMGLLGTDWLCPEIIAHAAEKSGDLL-------IAPTFNIGMAQHHLS 73

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS- 136
             GT +L   T+  AI  W   ++++ + G  +I  LN HGGN   +    +E    +S 
Sbjct: 74  FSGTISLRPSTFMAAISDW---VNSLARHGFDRIYFLNGHGGNVATIEAAFSEIYSDYSY 130

Query: 137 -------MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
                  +L +   W    I +       T  G H    E ++  A  P  VK
Sbjct: 131 AAEPCPFILKLRNWWDLPGISRLCAKLYPTGHGTHATPSEIAVTFAAYPDRVK 183


>gi|262198265|ref|YP_003269474.1| creatininase [Haliangium ochraceum DSM 14365]
 gi|262081612|gb|ACY17581.1| Creatininase [Haliangium ochraceum DSM 14365]
          Length = 257

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 93/229 (40%), Gaps = 16/229 (6%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVTCMPVEPIGYSIEHMYVD 82
            +LP+GA E HGPHLP+ TD IIA  +A R    L  R L    +P  P+ Y+       
Sbjct: 24  ALLPVGAVEAHGPHLPLATDVIIAEAMARRGAERLQARGLSAVLLP--PLAYTAAGFAAG 81

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKM---GIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              TL         + ++D  R +   G   + I NAH   + + S+      +  S + 
Sbjct: 82  FAGTLAMRPETVTAM-VVDIGRGLAAHGFGLLAIANAHLDPTHIGSLKRAGEELADSGVT 140

Query: 140 VSTSWSRFT-IPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
           +  ++   T  P  +    E   G  H G+ E SM+LA  P LV+ +L    +   +   
Sbjct: 141 IGFAFPDVTRKPWALRLSDEFRSGACHAGQYEGSMVLAERPELVREELRAQLAPNPASLS 200

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
              +     G  SF    +   P+   G+   AT  +G+  ++      
Sbjct: 201 VAIRA----GHTSF---EEAGGPRAYFGDPAAATADEGQATIATLGEIL 242


>gi|188583122|ref|YP_001926567.1| creatininase [Methylobacterium populi BJ001]
 gi|179346620|gb|ACB82032.1| Creatininase [Methylobacterium populi BJ001]
          Length = 262

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 92/227 (40%), Gaps = 38/227 (16%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           R     +LP+GA EQHGPHL    D ++A  L   + +    R  V  +P  P G S+ H
Sbjct: 21  RAAQAALLPVGATEQHGPHLGCGMDFVLADTLCREVSA----RTGVPMLPTLPYGCSLGH 76

Query: 79  MYV-DGTKTLTYAEAIEHWLAIIDAIRKM-------GIRKIVILNAHGGN-SPLVSIVST 129
                GT  L         L + D +R++       G+R++ ++N H  N +PL   +  
Sbjct: 77  SRRWPGTIALDP-------LVMTDLVRQIGAQAYHSGVRRLFLVNGHVTNAAPLRCALEL 129

Query: 130 EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK------- 182
                  ++V   + +  +       F + +   H    ET++M ALAP LV+       
Sbjct: 130 LRAAHDDLMVALVNTATVSERVRAAHFADAD-DWHANRAETALMQALAPALVREGRIVDA 188

Query: 183 ------MDLA----ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLN 219
                  DL      N +SR        +   A G+  F W ++DL 
Sbjct: 189 DDPDRTQDLVFAHPVNRTSRNGVTGSPSQASAAEGAELFAWMVEDLT 235


>gi|78185623|ref|YP_378057.1| hypothetical protein Syncc9902_2056 [Synechococcus sp. CC9902]
 gi|78169917|gb|ABB27014.1| conserved hypothetical protein [Synechococcus sp. CC9902]
          Length = 262

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A  +A  +      R  V   P +  G +  H+   G
Sbjct: 35  VIIPLGSTEQHGPTGAIGTDALTAEAIALEVGR----RTGVLVTPAQAFGMAEHHLGFAG 90

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  A  +     ++ ++ + G  ++ ++N HGGN
Sbjct: 91  TMSLQPATLLAVMQDLVLSLARHGFERVFVINGHGGN 127


>gi|240140549|ref|YP_002965029.1| Creatininase [Methylobacterium extorquens AM1]
 gi|240010526|gb|ACS41752.1| Creatininase [Methylobacterium extorquens AM1]
          Length = 266

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 87/215 (40%), Gaps = 24/215 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-D 82
            +LP+GA EQHGPHL    D ++A  L   + +    R  V  +P  P G S+ H     
Sbjct: 30  ALLPIGATEQHGPHLGCGMDFVLADLLCRAVSA----RTRVPMLPALPYGCSLGHSRRWP 85

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSMLVVS 141
           GT  L      E    I       G+R++ ++NAH  N +PL   +         ++V  
Sbjct: 86  GTIALDPVVMTELVRQIGSQAYHSGVRRLFLVNAHVTNAAPLRCALELLRAAHDDLMVAL 145

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD-LAE------------- 187
            + +  +       F + E   H    ET++M A AP LV+ D + E             
Sbjct: 146 INTATVSERVRAAHFADAE-DWHANRAETALMQAQAPALVREDRIVEADDPDRTHNLVFA 204

Query: 188 ---NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLN 219
              N +SR        +   A G+  F W ++DL 
Sbjct: 205 HPVNRTSRNGVTGSPSQASAAEGAELFAWMVEDLT 239


>gi|18313738|ref|NP_560405.1| hypothetical protein PAE2983 [Pyrobaculum aerophilum str. IM2]
 gi|18161293|gb|AAL64587.1| conserved hypothetical protein [Pyrobaculum aerophilum str. IM2]
          Length = 209

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 71/163 (43%), Gaps = 26/163 (15%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDT----IIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           + +LP+G+YEQHGPHLP   D      IA   AERI + + P +  TC        S EH
Sbjct: 2   LCILPVGSYEQHGPHLPPTVDAEIAYYIANKTAERIGARVLPPIFYTC--------SEEH 53

Query: 79  MYVDGTKTLTYAEAIEHWLAII-DAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
                T ++     I ++  ++  A+ K G   +V++  HGG    V +VS +       
Sbjct: 54  RDFQNTISVRCTSFIPYFEEVVRSAVEKCG--ALVVIVGHGGVWDAVKLVSEQLNYELGP 111

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
            V+  +      P+            H G  ETS+ LA+   L
Sbjct: 112 SVLPVNIWALISPRD-----------HAGTDETSIYLAVGGSL 143


>gi|88807983|ref|ZP_01123494.1| hypothetical protein WH7805_07471 [Synechococcus sp. WH 7805]
 gi|88788022|gb|EAR19178.1| hypothetical protein WH7805_07471 [Synechococcus sp. WH 7805]
          Length = 262

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A  +A  +      R  V   PV+  G +  H+   G
Sbjct: 35  VIIPLGSTEQHGPTGAIGTDALTAEAVALELGR----RSGVLVTPVQAFGMAEHHLGFAG 90

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  A  +     ++ ++   G  +I+++N HGGN
Sbjct: 91  TMSLQPATLLAVLHDLVLSLATHGFERILVVNGHGGN 127


>gi|253574112|ref|ZP_04851454.1| creatininase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251846589|gb|EES74595.1| creatininase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 248

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 90/193 (46%), Gaps = 21/193 (10%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDT----IIAAGLAERIKSILP 59
           +I   +N+  +    ++    +LP+GA E HGPHLP+ TD      +A  LAER +S++ 
Sbjct: 1   MIFQYENAYDIAEKIKRMPCAILPIGAVEAHGPHLPLGTDNLLAERLALRLAERTESLVL 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
           P LP   +      +S+++    G+  ++    I     I +++ + G+R  V+LN H G
Sbjct: 61  PTLPYGQV------WSLQNF--PGSINVSNEALIRMLYDIGESLYRQGLRIYVMLNGHLG 112

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFT--IPQGIISFPETEIG----IHGGEIETSMM 173
           N+     +   AR+ +  +     +  F     Q I    ET        H  E+ETS M
Sbjct: 113 NA---VALKEAARLLYKDIPELKVYYFFYPGTKQVIEQVRETPASHASYFHACELETSYM 169

Query: 174 LALAPHLVKMDLA 186
           L LA   V MD A
Sbjct: 170 LYLAGEYVDMDKA 182


>gi|163853129|ref|YP_001641172.1| creatininase [Methylobacterium extorquens PA1]
 gi|163664734|gb|ABY32101.1| Creatininase [Methylobacterium extorquens PA1]
          Length = 266

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 89/215 (41%), Gaps = 24/215 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-D 82
            +LP+GA EQHGPHL    D ++A  L   + +    R  V  +P  P G S+ H     
Sbjct: 30  ALLPIGATEQHGPHLGCGMDFVLADLLCRAVSA----RTRVPMLPALPYGCSLGHSRRWP 85

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSMLVVS 141
           GT  L      E    I +     G+R++ ++NAH  N +PL   +         ++V  
Sbjct: 86  GTLALDPVVMTELVRQIGEQAYHSGVRRLFLVNAHVTNAAPLRCALELLRAAHDDLMVAL 145

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM---------DLAEN--FS 190
            + +  +       F + E   H    ET++M A AP LV+          D  +N  F+
Sbjct: 146 VNTATVSERVRAAHFADAE-DWHANRAETALMQAQAPALVREGRIAEADDPDRTQNLVFA 204

Query: 191 SRQSEFLRN------FKYLRAHGSHSFGWSMKDLN 219
              +   RN       +   A G+  F W ++DL 
Sbjct: 205 HPVNRTSRNGVTGFPSQANAAEGAELFAWMVEDLT 239


>gi|254418407|ref|ZP_05032131.1| creatininase subfamily [Brevundimonas sp. BAL3]
 gi|196184584|gb|EDX79560.1| creatininase subfamily [Brevundimonas sp. BAL3]
          Length = 257

 Score = 52.0 bits (123), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 77/174 (44%), Gaps = 25/174 (14%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           VV+P+G+ EQHGP   + TD +   I A  AER  + L         P   IG +  H+ 
Sbjct: 25  VVVPIGSNEQHGPTGLLGTDWLCPEIIAHEAERSDAAL------MVAPTFNIGMAQHHLA 78

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS- 136
             GT +L   T+  AI  W   + ++ + G  +I  LN HGGN   +    +E    +S 
Sbjct: 79  FAGTISLRPSTFMAAITDW---VSSLSRHGFERIYFLNGHGGNVATIEATFSEIYAEWSF 135

Query: 137 ------MLVVSTSWSRFTIPQGIIS--FPETEIGIHGGEIETSMMLALAPHLVK 182
                  ++   +W      QG+ +  FP T  G+H    E ++  A  P  +K
Sbjct: 136 VEDEPPFVLKLKNWWDLPGVQGLCNSIFP-TGHGMHATPSEIAVTQAAYPDRIK 188


>gi|148238675|ref|YP_001224062.1| amidase [Synechococcus sp. WH 7803]
 gi|147847214|emb|CAK22765.1| Possible amidase [Synechococcus sp. WH 7803]
          Length = 262

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A    E +   L  R  V   PV+  G +  H+   G
Sbjct: 35  VIIPLGSTEQHGPTGAIGTDALTA----EAVALELGRRSGVLVTPVQAFGMAEHHLGFAG 90

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  A  +     ++ ++   G  +I ++N HGGN
Sbjct: 91  TMSLQPATLLAVLHDMVLSLATHGFERIFVVNGHGGN 127


>gi|33864829|ref|NP_896388.1| hypothetical protein SYNW0293 [Synechococcus sp. WH 8102]
 gi|33632352|emb|CAE06808.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 317

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A  +A  +      R  V   P +  G +  H+   G
Sbjct: 90  VIVPLGSTEQHGPTGAIGTDALTAEAVALEVGR----RTGVLVTPAQAFGMAEHHLGFAG 145

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  A  +     ++ ++ + G  ++ ++N HGGN
Sbjct: 146 TMSLQPATLLAVMHDLVLSLARHGFERVFVINGHGGN 182


>gi|159902798|ref|YP_001550142.1| hypothetical protein P9211_02571 [Prochlorococcus marinus str. MIT
           9211]
 gi|159887974|gb|ABX08188.1| Uncharacterized protein, putative amidase [Prochlorococcus marinus
           str. MIT 9211]
          Length = 265

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 53/108 (49%), Gaps = 4/108 (3%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           ++LP+G+ EQHGP   + TD + A  +A  +      R  V   P +  G +  H+   G
Sbjct: 38  IILPIGSTEQHGPTGAIGTDALTAEAVALEVGK----RAGVLVAPTQAYGMAEHHLGFPG 93

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
           T +L  +  +     ++ ++ + G  ++ ++N HGGN   V    ++A
Sbjct: 94  TMSLQSSTLLNVVHDLLLSLARHGFERVFVVNGHGGNIATVKAAFSQA 141


>gi|319782322|ref|YP_004141798.1| creatininase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168210|gb|ADV11748.1| Creatininase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 268

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 76/168 (45%), Gaps = 14/168 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY--SIEHMY 80
           +V+LPLGA EQHGPHLP+  D  +A  +A             +    EP  Y  S  H  
Sbjct: 36  VVILPLGAVEQHGPHLPLGVDCWLAEAVALAAAEGQ-----ASIRVAEPFAYGSSEHHRS 90

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             GT +L+    I   + +   + + G    V+LN HGGN   + +  T    R    +V
Sbjct: 91  FSGTMSLSPQIFIAVLVDLCTCLAEDGFLP-VMLNGHGGNRAAIQVAITTLGKRG---IV 146

Query: 141 STSWSRFTIPQGII--SFPETEIGI-HGGEIETSMMLALAPHLVKMDL 185
           +  +S F +   +   + P+   G  H   +ETS+M+ +    V+ DL
Sbjct: 147 TAGFSYFDLIADVAAQALPDAATGTGHACALETSLMMHVLGDSVRRDL 194


>gi|87301900|ref|ZP_01084734.1| hypothetical protein WH5701_01205 [Synechococcus sp. WH 5701]
 gi|87283468|gb|EAQ75423.1| hypothetical protein WH5701_01205 [Synechococcus sp. WH 5701]
          Length = 272

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 50/97 (51%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A  +A  +      R  V   PV+  G +  H+   G
Sbjct: 46  VIVPLGSTEQHGPTGAIGTDALTAEAVALEVGR----RTGVLVTPVQAFGMAEHHLGFAG 101

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  +  +     ++ ++ + G  +I ++N HGGN
Sbjct: 102 TISLQPSTLLAVIHDVVLSLARHGFERIFVINGHGGN 138


>gi|159905351|ref|YP_001549013.1| creatininase [Methanococcus maripaludis C6]
 gi|327507634|sp|A9A8V8|ARFB_METM6 RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|159886844|gb|ABX01781.1| Creatininase [Methanococcus maripaludis C6]
          Length = 221

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 7/113 (6%)

Query: 17  DARKDWIVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           D +   I ++ LG++ E HG  LP++TD  IA+ +A  +  I   +     +P      S
Sbjct: 13  DEKVHEIGIIALGSFLENHGSALPIDTDAKIASYIALNVSIITGAKFLGVVIP------S 66

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
            E+ YV      +  + I +   +I+  RK+GI K +I+N HGGN+ ++  +S
Sbjct: 67  TEYSYVKHGIHDSIEDVITYIKYLIENGRKIGINKFLIVNCHGGNTIILDELS 119


>gi|226950860|ref|YP_002805951.1| creatininase family protein [Clostridium botulinum A2 str. Kyoto]
 gi|226842178|gb|ACO84844.1| creatininase family protein [Clostridium botulinum A2 str. Kyoto]
          Length = 279

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 104/226 (46%), Gaps = 21/226 (9%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR---LPVTCMPVEPIGYSIEHM 79
           ++ + L   E+HGPHLP+ TD I A  L + +   L  +         P  PIGY+   M
Sbjct: 23  VIFVALSPIEEHGPHLPLGTDYISAKDLLKAVIDNLEKQNNAYNYIIHPSFPIGYNECVM 82

Query: 80  YVDGTKTLTYAEAIEHWLAII-DAIRKMGIRKIVILNAH------GGNSPLVSIVSTEAR 132
              GT +   ++ IE+ +  + ++I + G +K+VI+N H              I++ E  
Sbjct: 83  NYPGTISFK-SKTIENIIVDLGESISRAGFKKMVIVNHHLDLGHIKAIENAKDILNKECS 141

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFP--ETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
           ++   +  S  +S+       I+    + E  IH    ETS ML   P LVK    + +S
Sbjct: 142 LKVLEVASSIIYSQSKKENAKIARNDLDMEREIHADVRETSFMLFKHPELVK----DCYS 197

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           + +  ++   +++++ G     + +++    G +G+    + +KG+
Sbjct: 198 TLEPIYMDMKEFIKSDGRCWREYGIEE----GYIGSPAKGSKEKGK 239


>gi|168181938|ref|ZP_02616602.1| putative creatinine amidohydrolase [Clostridium botulinum Bf]
 gi|237796869|ref|YP_002864421.1| putative creatinine amidohydrolase [Clostridium botulinum Ba4 str.
           657]
 gi|182674892|gb|EDT86853.1| putative creatinine amidohydrolase [Clostridium botulinum Bf]
 gi|229263726|gb|ACQ54759.1| putative creatinine amidohydrolase [Clostridium botulinum Ba4 str.
           657]
          Length = 279

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 106/228 (46%), Gaps = 25/228 (10%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR---LPVTCMPVEPIGYSIEHM 79
           ++++ L   E+HGPHLP+ TD I A  L +     L  +         P  PIGY+   M
Sbjct: 23  VILVALSPIEEHGPHLPLGTDYIAAKDLLKATIDSLEKQNNLYNYIIYPSLPIGYNESIM 82

Query: 80  YVDGTKTLTYAEAIEHWLAIID---AIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR-- 134
              GT +   +E IE+   IID   +I + G +K+VI+N H     + +I + +  +   
Sbjct: 83  NYPGTVSFK-SETIEN--IIIDLGESISRAGFKKMVIVNHHLDLGHIKAIENAKDILNKG 139

Query: 135 --FSMLVVSTS--WSRFTIPQGII--SFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
               +L V++S  +S+       I  S  + E  IH    ETS ML   P LVK    + 
Sbjct: 140 CSLKILEVASSIIYSQSEKENAKIVNSDLDMESEIHADVRETSFMLFKHPELVK----DC 195

Query: 189 FSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           +++  S ++   ++++   S    W    +  +G +G+    + +KGE
Sbjct: 196 YNTLDSIYMDMKEFIK---SSERCWRRYGIE-EGYIGSPAKGSKEKGE 239


>gi|78211840|ref|YP_380619.1| hypothetical protein Syncc9605_0288 [Synechococcus sp. CC9605]
 gi|78196299|gb|ABB34064.1| conserved hypothetical protein [Synechococcus sp. CC9605]
          Length = 262

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A  +A  +      R  V   P +  G +  H+   G
Sbjct: 35  VIIPLGSTEQHGPTGAIGTDALTAEAVALEVGR----RTGVLVTPAQAFGMAEHHLGFAG 90

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  A  +     ++ ++ + G  ++ ++N HGGN
Sbjct: 91  TMSLQPATLLAVLHDLVLSLGRHGFERVFVINGHGGN 127


>gi|260436341|ref|ZP_05790311.1| creatininase [Synechococcus sp. WH 8109]
 gi|260414215|gb|EEX07511.1| creatininase [Synechococcus sp. WH 8109]
          Length = 262

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A  +A  +      R  V   P +  G +  H+   G
Sbjct: 35  VIIPLGSTEQHGPTGAIGTDALTAEAVALEVGR----RTGVLVTPAQAFGMAEHHLGFAG 90

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  A  +     ++ ++ + G  ++ ++N HGGN
Sbjct: 91  TMSLQPATLLAVLHDLVLSLGRHGFERVFVINGHGGN 127


>gi|83945664|ref|ZP_00958009.1| Creatininase [Oceanicaulis alexandrii HTCC2633]
 gi|83850865|gb|EAP88725.1| Creatininase [Oceanicaulis alexandrii HTCC2633]
          Length = 245

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 10/116 (8%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++P+G+ EQHGP+  + TD I    +A    +       +   P   +G +  H+   G
Sbjct: 21  IIIPIGSTEQHGPNGLVGTDAICPEVIAREAGA----EAGILVGPTFNVGVAQHHLGFPG 76

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           + TL   T   AI  W   ID++ + G  KI  LN HGGN   ++    E+   +S
Sbjct: 77  SMTLRPTTMIAAINDW---IDSLARHGFEKIYFLNGHGGNIATIAAAFAESYANWS 129


>gi|115361250|ref|YP_778387.1| creatininase [Burkholderia ambifaria AMMD]
 gi|115286578|gb|ABI92053.1| Creatininase [Burkholderia ambifaria AMMD]
          Length = 259

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 52/100 (52%), Gaps = 9/100 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++P GA EQHGPHLP++ D   A  LA  I + L   L     P    G S  HM   G
Sbjct: 31  VIIPCGAIEQHGPHLPLSMDADHADALAVEIATSLGRTL---IAPTIQAGCSKHHMAFPG 87

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L   TYA A+ H   +  ++   G ++I + +AH GN
Sbjct: 88  TISLQEHTYA-ALCHDYCV--SLATHGFKRIYLFSAHVGN 124


>gi|23010663|ref|ZP_00051275.1| COG1402: Uncharacterized protein, putative amidase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 232

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 74/177 (41%), Gaps = 41/177 (23%)

Query: 29  GAYEQHGPHLPMNTDT----IIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM--YVD 82
           GA E HGPH+P +TDT     IA  LA+RI +++ P          P+ Y I     +  
Sbjct: 1   GATEAHGPHMPTDTDTHQVEHIAWLLAQRIDALVAP----------PVAYGISKTFEFFP 50

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST------EARMRFS 136
           GT +L+          I  A+ + G   ++ILN +  N      V+       +A   F 
Sbjct: 51  GTISLSIPTYQAMLFEIGAALVRQGFEHLIILNGNRPNGTANDAVARHLVDELDAAHTFK 110

Query: 137 MLVVSTSWS---------RFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           +  VS  W          R ++P G+          HG E ET   LA  P LVKM+
Sbjct: 111 VSAVS-YWEPAAEKIHALRRSVPGGM---------GHGCEFETGFQLATRPELVKME 157


>gi|114568587|ref|YP_755267.1| creatininase [Maricaulis maris MCS10]
 gi|114339049|gb|ABI64329.1| Creatininase [Maricaulis maris MCS10]
          Length = 253

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 104/251 (41%), Gaps = 42/251 (16%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++P+G+ EQHGP+  + TD I      E I +       +   P   +G +  H+   G
Sbjct: 21  IIIPIGSTEQHGPNGLVGTDAI----CPEVIAAEAGAEAGLLVGPTFNVGIAQHHLGFAG 76

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           + TL   T    I  W   I+++ + G  +I  LN HGGN   ++    E    FS+  V
Sbjct: 77  SMTLRPSTMIAVINDW---IESLTRHGFDRIYFLNGHGGNITTINAAFAEYYANFSLDGV 133

Query: 141 ST-------SWSRFTIPQGIIS-----FPETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
           +        +W  + +P G++      FP  E G+H    E S+     PH +K      
Sbjct: 134 ACPVQLMQRNW--WELP-GVMDTCRKLFPVGE-GMHATASEVSVTYYAHPHAIK------ 183

Query: 189 FSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLSYFANCFI 247
               Q E       +   G  S     ++  P G +G +   AT +KG  ++S+     I
Sbjct: 184 ----QVEMSPKIAPV---GGFSDAADYRERFPDGRIGSDPSQATPEKGAEIVSFAKQALI 236

Query: 248 QLLNDINSFDV 258
                +N FDV
Sbjct: 237 AEC--VNFFDV 245


>gi|303244614|ref|ZP_07330947.1| Creatininase [Methanothermococcus okinawensis IH1]
 gi|302485040|gb|EFL47971.1| Creatininase [Methanothermococcus okinawensis IH1]
          Length = 227

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 64/117 (54%), Gaps = 8/117 (6%)

Query: 25  VLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           ++ LG++ E HG  LP++TD  IA+ ++  +  +   +     +P      S E+ YV  
Sbjct: 20  IIALGSFLENHGSILPIDTDAKIASYISLNVAILTGAKFLGVVLP------STEYDYVKH 73

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
                  E IE+   II+  +K+G++K +I+N HGGN+ L+S +  +   ++S+ ++
Sbjct: 74  GIHNKPEEVIEYLKYIINEGKKLGVKKFLIINCHGGNT-LISNLLNDLENQYSVRII 129


>gi|45359268|ref|NP_988825.1| creatininase [Methanococcus maripaludis S2]
 gi|74553319|sp|Q6LWK4|ARFB_METMP RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|45048143|emb|CAF31261.1| conserved hypothetical archeal protein [Methanococcus maripaludis
           S2]
          Length = 221

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 54/100 (54%), Gaps = 7/100 (7%)

Query: 23  IVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           I ++ LG++ E HG  LP++TD  IA+ +A  +  I   +     +P      S E+ YV
Sbjct: 19  IGIIALGSFLENHGSALPIDTDAKIASYIALNVSIITGAKFLGIVLP------STEYSYV 72

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
                 +  + I +   +++  RK+GI+K +I+N HGGN+
Sbjct: 73  KHGIHDSIEDVINYIKYLVENGRKIGIKKFLIINCHGGNT 112


>gi|254563039|ref|YP_003070134.1| Creatininase [Methylobacterium extorquens DM4]
 gi|254270317|emb|CAX26313.1| Creatininase [Methylobacterium extorquens DM4]
          Length = 266

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 91/227 (40%), Gaps = 18/227 (7%)

Query: 27  PLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV-DGTK 85
           P+GA EQHGPHL    D ++A  L   + +    R  V  +P  P G S+ H     GT 
Sbjct: 33  PIGATEQHGPHLGCGMDFVLADLLCRAVSA----RTRVPMLPALPYGCSLGHSRRWPGTL 88

Query: 86  TLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSMLVVSTSW 144
            L      E    I       G+R++ ++NAH  N +PL   +         ++V   + 
Sbjct: 89  ALDPVVMTELVRQIGSQAYHSGVRRLFLVNAHVTNAAPLRCALELLRAAHDDLMVALVNT 148

Query: 145 SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLR 204
           +  +       F + E   H    ET++M A AP LV+    E+  ++  +  R    + 
Sbjct: 149 ATVSERVRAAHFADAE-DWHANRAETALMQAQAPALVR----EDRIAKADDPDRTHNLVF 203

Query: 205 AHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
           AH        +   +  GV G+   A   +G  L ++       L+ 
Sbjct: 204 AH-------PVNRTSRNGVTGSPSRANAAEGAELFAWMVEDLTALVR 243


>gi|58039381|ref|YP_191345.1| hypothetical protein GOX0917 [Gluconobacter oxydans 621H]
 gi|58001795|gb|AAW60689.1| Hypothetical protein GOX0917 [Gluconobacter oxydans 621H]
          Length = 285

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 76/175 (43%), Gaps = 18/175 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS---IEHMY 80
           V++P+G  EQ GP++ +    + A  LA+ I       L    +   P G +     HM 
Sbjct: 65  VIIPVGGTEQSGPYMAVGKHNVRAQVLADAIAVQAGHTLVAPVVAYVPEGSTSPRTSHMK 124

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR-------- 132
             GT ++  A          ++ R  G R+IV+L  HGG    ++ V+ E          
Sbjct: 125 FPGTISVPPAVFEGLLKGAAESFRVQGFRRIVLLGDHGGYQSFMAQVAQELNRAWKGQAV 184

Query: 133 ---MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
              +R    VV   ++     QG  +    E+G+H    +TS+MLA+ P LV+ D
Sbjct: 185 VLYLRDYYEVVPHQYADALRAQGHAA----EVGLHAELSDTSLMLAVDPSLVRQD 235


>gi|332703983|ref|ZP_08424071.1| Creatininase [Desulfovibrio africanus str. Walvis Bay]
 gi|332554132|gb|EGJ51176.1| Creatininase [Desulfovibrio africanus str. Walvis Bay]
          Length = 241

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 13/128 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE-HMYVD 82
           +++PLG+ EQHG  LP+ TD  IA  +A+        R      P+   G S+  HM   
Sbjct: 21  IIIPLGSVEQHGLALPLGTDAFIAQAMAQEAGR----RTQRLVAPILAPGMSLYVHMDFP 76

Query: 83  GTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
           GT +    TY   I   +A   ++ + G R  +++N HGGN   +   +  A M + +  
Sbjct: 77  GTISFMPDTYTAMIRDCVA---SLHRHGFRNFLLVNGHGGNEGCIQ--NAMAEMGYRLPG 131

Query: 140 VSTSWSRF 147
           +  +W+++
Sbjct: 132 MKYTWAQW 139


>gi|150399755|ref|YP_001323522.1| creatininase [Methanococcus vannielii SB]
 gi|327507641|sp|A6UQY8|ARFB_METVS RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|150012458|gb|ABR54910.1| Creatininase [Methanococcus vannielii SB]
          Length = 238

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 70/141 (49%), Gaps = 14/141 (9%)

Query: 23  IVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           I ++ LG++ E HG  LP++TD  IA+ +   +  +   +     +P      S E+ YV
Sbjct: 21  IGIIALGSFLENHGSALPIDTDAKIASYIGLNVSILTGAKFLGVVIP------STEYSYV 74

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
                 +  E +E+   +I+  +K+GI K +I+N HGGN+ +  ++S     + S+++ +
Sbjct: 75  KHGIHNSPNEVVEYIKIMIEHSKKIGINKFLIINCHGGNTLIKDLISELNDKKTSVILEN 134

Query: 142 TSWSRFTIPQGIISFPETEIG 162
             ++         +F E  IG
Sbjct: 135 VCFTH-------AAFEEIAIG 148


>gi|149174106|ref|ZP_01852734.1| hypothetical protein PM8797T_12993 [Planctomyces maris DSM 8797]
 gi|148847086|gb|EDL61421.1| hypothetical protein PM8797T_12993 [Planctomyces maris DSM 8797]
          Length = 241

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 73/166 (43%), Gaps = 13/166 (7%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           ++P+ A EQH  HL M  D      +A  +  +L P   V   P   IG S  HM   GT
Sbjct: 33  IIPVAATEQHLEHLAMEHDWRSVMLVATEVARLLSPE--VIVAPSMNIGISEHHMRHPGT 90

Query: 85  KTLTYAEAIEHWLAII-DAIRKM---GIRKIVILNAHGGN-SPLVSIVST-EARMRFSML 138
            +         WL+++ D IR M   G   I++LN HGGN +P + +    + R+  + L
Sbjct: 91  LSALPGS----WLSVLFDTIRSMQHAGFTNILVLNGHGGNIAPCLGMWGQFQQRLEIN-L 145

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
              + W+       + +        H  E ET+  +A  P  V+++
Sbjct: 146 HFESYWNLLPEEVALANLKTKRWPGHAQEFETAFAMAAFPENVRLE 191


>gi|226939419|ref|YP_002794492.1| Creatininase [Laribacter hongkongensis HLHK9]
 gi|226714345|gb|ACO73483.1| Creatininase [Laribacter hongkongensis HLHK9]
          Length = 258

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 96/232 (41%), Gaps = 30/232 (12%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM--- 79
           ++++P+GA EQHGPH+ MN D +    L  ++  I+  ++     P    GY  +     
Sbjct: 25  VLLIPVGAIEQHGPHMSMNVDVL----LPTKVSEIVAGQINGLVAPPIMYGYKSQQRSGG 80

Query: 80  --YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL----VSIVSTEARM 133
             ++ GT +L      +    +I    + G R+   +N H  N+      + +   E R 
Sbjct: 81  GHHLCGTTSLDGQTLTDISHTLIREFVRHGFRRFAFVNGHYENNYFLIEGIDLALRELRW 140

Query: 134 RF--SMLVVSTSWSRFTIPQGIIS-FPETEIGI---HGGEIETSMMLALAPHLVKMDLAE 187
                + V+  S+  F     I   +PE   G    HGG +ETS+ML L P  V M   E
Sbjct: 141 EGIPDVKVMMLSYWDFVDESTIEKLYPEGFTGWDLEHGGVMETSLMLHLFPEYVDM---E 197

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
                    L N+          F    +   P G + +A  +T +KG+ LL
Sbjct: 198 RVDHGDPAVLPNYDV--------FPIKPELTPPSGCLSSAAKSTPEKGKILL 241


>gi|56750872|ref|YP_171573.1| hypothetical protein syc0863_d [Synechococcus elongatus PCC 6301]
 gi|81299476|ref|YP_399684.1| hypothetical protein Synpcc7942_0665 [Synechococcus elongatus PCC
           7942]
 gi|56685831|dbj|BAD79053.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81168357|gb|ABB56697.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 248

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 55/101 (54%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP   + TD I    IA G+A+R ++++ P + V        G ++ H+
Sbjct: 21  IIIPIGSTEQHGPTGLIGTDAICAEAIAQGVADRTQALVGPTINV--------GMALHHL 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              G+ +L  +  ++  +  + ++ + G R    +N HGGN
Sbjct: 73  GFPGSVSLRPSTLLQVIVDYLSSLAQHGFRHFYFINGHGGN 113


>gi|318042703|ref|ZP_07974659.1| hypothetical protein SCB01_13399 [Synechococcus sp. CB0101]
          Length = 258

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A  +A  +      R  V   P +  G +  H+   G
Sbjct: 29  VIVPLGSTEQHGPTGAIGTDALTAEAVALEVGR----RSGVLVTPAQAFGMAEHHLGFAG 84

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  +  +     ++ ++ + G  +I ++N HGGN
Sbjct: 85  TMSLQPSTLLAVMHDLVLSLARHGFERIYVINGHGGN 121


>gi|254441879|ref|ZP_05055371.1| creatininase subfamily [Octadecabacter antarcticus 307]
 gi|198250656|gb|EDY74972.1| creatininase subfamily [Octadecabacter antarcticus 307]
          Length = 238

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 5/105 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
            +LP+G+ EQH   L +  D I    LA+++ +     L +   PV P G +       G
Sbjct: 21  CILPIGSTEQHA-QLSLCVDMI----LADKVSNDAAGPLNIPVFPVMPYGLAPYFNAYPG 75

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           T  L     +     +I ++R+ G R+I+I+N HGGN+P+ ++  
Sbjct: 76  TICLRVETLMAVMRDVIASVRRAGFRQILIVNGHGGNNPVAALAQ 120


>gi|302339939|ref|YP_003805145.1| creatinine amidohydrolase [Spirochaeta smaragdinae DSM 11293]
 gi|301637124|gb|ADK82551.1| creatinine amidohydrolase, putative [Spirochaeta smaragdinae DSM
           11293]
          Length = 372

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 100/254 (39%), Gaps = 17/254 (6%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI--- 72
           A  +K+ +V++P+G  E HG H     DT +   + E ++     +     + + PI   
Sbjct: 70  AKRKKNDVVLVPIGCSECHGDHNNTGLDTFMVTQICEGVRRYTAKQGREVNLALPPINYG 129

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV-SIVSTEA 131
           G+   H+ + GT  +      E  +  +  +   G RKI+++N HG    LV +I     
Sbjct: 130 GHPYHHLGMPGTIIIPGEIVREMVIYTMLGLWNDGYRKIILVNNHGHLWNLVDAIQEFMK 189

Query: 132 RMRFSMLVVSTSWSR----FTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD--- 184
           R +   +V    W R    F          ET   IH  E ETS  L L   +V M    
Sbjct: 190 RFQLPAIVQVIDWHRAVREFFFCTDKKDSMETNF-IHAAEAETSTALLLFKEMVNMKYVR 248

Query: 185 --LAENFSSRQSEFLRNFKYLRAHG-SHSFGWSM--KDLNPKGVVGNAMDATVKKGEGLL 239
             + E F       L    Y R H  S   G S   +   P+GVVG    A   K +  +
Sbjct: 249 DAVGEGFLPDGHFDLSVDPYRRPHRWSEGEGHSAIERAATPEGVVGFPSKADPYKAKRPI 308

Query: 240 SYFANCFIQLLNDI 253
           +        ++NDI
Sbjct: 309 AAILKYLTMMVNDI 322


>gi|304445988|pdb|3NO4|A Chain A, Crystal Structure Of A Creatinine Amidohydrolase
           (Npun_f1913) From Nostoc Punctiforme Pcc 73102 At 2.00 A
           Resolution
 gi|304445989|pdb|3NO4|B Chain B, Crystal Structure Of A Creatinine Amidohydrolase
           (Npun_f1913) From Nostoc Punctiforme Pcc 73102 At 2.00 A
           Resolution
 gi|304445990|pdb|3NO4|C Chain C, Crystal Structure Of A Creatinine Amidohydrolase
           (Npun_f1913) From Nostoc Punctiforme Pcc 73102 At 2.00 A
           Resolution
          Length = 267

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 56/124 (45%), Gaps = 12/124 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++ P+G+ EQHGP   + TD I    IAAG+ +   +I+ P + V        G ++ H 
Sbjct: 40  IIFPIGSTEQHGPTGLIGTDAICAEAIAAGVGDATGAIVGPTINV--------GXALHHT 91

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              GT +L  +  I+     +  + K G  K   +N HGGN   +    +E       L 
Sbjct: 92  AFPGTISLRPSTLIQVVRDYVTCLAKAGFSKFYFINGHGGNIATLKAAFSETYAHLEDLQ 151

Query: 140 VSTS 143
           ++ +
Sbjct: 152 IANA 155


>gi|150402904|ref|YP_001330198.1| creatininase [Methanococcus maripaludis C7]
 gi|327507635|sp|A6VHX1|ARFB_METM7 RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|150033934|gb|ABR66047.1| Creatininase [Methanococcus maripaludis C7]
          Length = 221

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 7/107 (6%)

Query: 23  IVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           I ++ LG++ E HG  LP++TD  IA+ +A  +  I   +     +P      S E+ YV
Sbjct: 19  IGIIALGSFLENHGSALPIDTDAKIASYIALNVSIITGAKFLGVVLP------STEYSYV 72

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
                 +  + I +   +++  RK+GI K +I+N HGGN+ +   +S
Sbjct: 73  KHGIHDSIKDVINYIKYLVENGRKIGINKFLIINCHGGNTLIKDEIS 119


>gi|186471828|ref|YP_001863146.1| creatininase [Burkholderia phymatum STM815]
 gi|184198137|gb|ACC76100.1| Creatininase [Burkholderia phymatum STM815]
          Length = 249

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 65/134 (48%), Gaps = 23/134 (17%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           ++   +V+P+G+ EQHGP   + TD +   I A  AE+   IL         P   IG +
Sbjct: 16  KRSRAIVVPIGSNEQHGPTGLLGTDWLCPEIIAREAEKTADIL-------VAPTFNIGMA 68

Query: 76  IEHMYVDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
             H+   GT +L   T+  AI  W   I ++   G ++I+ LN HGGN     I S EA 
Sbjct: 69  QHHLGFPGTISLRPSTFIAAIGDW---IRSLATHGFQQILFLNGHGGN-----IASIEA- 119

Query: 133 MRFSMLVVSTSWSR 146
             FS   V  S+++
Sbjct: 120 -AFSEAYVEASFAK 132


>gi|251773038|gb|EES53594.1| Creatininase [Leptospirillum ferrodiazotrophum]
          Length = 241

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 65/158 (41%), Gaps = 6/158 (3%)

Query: 27  PLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKT 86
           P+G+ EQHGP+  + TD ++A  LA R+       L     P    G S  H+   GT +
Sbjct: 24  PVGSVEQHGPNGLIGTDHLVAEALARRVGE----DLGELVAPTLAYGMSHHHLGFPGTSS 79

Query: 87  LTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF--SMLVVSTSW 144
           L+    I     I+    + G R+   +N HGGN   +    +E  +    +   +S  W
Sbjct: 80  LSPRTMILLVCDILSGFYRNGFRRFYFVNGHGGNDSSLKAAFSEFLLDHPDARTALSNWW 139

Query: 145 SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
               + +    F     G H    E ++   L PHL +
Sbjct: 140 LLPEVTEQEKIFFGDSNGYHATCGEVAVTWHLYPHLER 177


>gi|83593494|ref|YP_427246.1| creatininase [Rhodospirillum rubrum ATCC 11170]
 gi|83576408|gb|ABC22959.1| Creatininase [Rhodospirillum rubrum ATCC 11170]
          Length = 247

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 4/108 (3%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++P+G+ EQHGP   + TD I A  ++ R   +L         P   +G +  HM   G
Sbjct: 21  VIIPIGSTEQHGPSGLIGTDAITAEVVSWRAGEVLD----TLVAPTIAVGMAHHHMAFPG 76

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
           + TL  +  I      I A+   G  + + +N HGGN P +     EA
Sbjct: 77  SMTLRPSTLIAVIRDTILALSSHGFTRFLFVNGHGGNIPSIQSAFYEA 124


>gi|218440526|ref|YP_002378855.1| creatininase [Cyanothece sp. PCC 7424]
 gi|218173254|gb|ACK71987.1| Creatininase [Cyanothece sp. PCC 7424]
          Length = 250

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 49/101 (48%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP   + TD I    IA G+ E   +++ P L V        G ++ H 
Sbjct: 21  IIIPIGSTEQHGPIGLIGTDAICAEVIAKGVGESTSAMVSPTLNV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              GT +L  +  I+  L  I  + K G      +N HGGN
Sbjct: 73  AFPGTISLRPSTLIQVVLDYITCLAKSGFTHFFFINGHGGN 113


>gi|186682313|ref|YP_001865509.1| creatininase [Nostoc punctiforme PCC 73102]
 gi|186464765|gb|ACC80566.1| Creatininase [Nostoc punctiforme PCC 73102]
          Length = 248

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 56/124 (45%), Gaps = 12/124 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++ P+G+ EQHGP   + TD I    IAAG+ +   +I+ P + V        G ++ H 
Sbjct: 21  IIFPIGSTEQHGPTGLIGTDAICAEAIAAGVGDATGAIVGPTINV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              GT +L  +  I+     +  + K G  K   +N HGGN   +    +E       L 
Sbjct: 73  AFPGTISLRPSTLIQVVRDYVTCLAKAGFSKFYFINGHGGNIATLKAAFSETYAHLEDLQ 132

Query: 140 VSTS 143
           ++ +
Sbjct: 133 IANA 136


>gi|87125066|ref|ZP_01080913.1| hypothetical protein RS9917_03653 [Synechococcus sp. RS9917]
 gi|86167386|gb|EAQ68646.1| hypothetical protein RS9917_03653 [Synechococcus sp. RS9917]
          Length = 263

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V+LPLG+ EQHGP   + TD + A  +A  +      R  V   P +  G +  H+   G
Sbjct: 36  VILPLGSTEQHGPTGAIGTDALTAEAVALELGR----RSGVLVTPTQAFGMAEHHLGFAG 91

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  +  +     ++ ++   G  +I ++N HGGN
Sbjct: 92  TMSLQPSTLLSVLHDLVLSLAGHGFERIFVVNGHGGN 128


>gi|297156223|gb|ADI05935.1| hypothetical protein SBI_02814 [Streptomyces bingchenggensis BCW-1]
          Length = 273

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 105/241 (43%), Gaps = 23/241 (9%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP-RLPVTCMPVEPIGYS 75
           D  +   +V P+GA EQHGPHLP++ D+++A   A  I + L    +PV  +    +  S
Sbjct: 18  DVLRGRTLVWPIGATEQHGPHLPLSVDSVLAEEFAAEIAAELDGFTVPVQSIGARSLPQS 77

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
              +   GT  +     I      + ++  +   +++++N H  N P +     + R + 
Sbjct: 78  GGGLSFPGTVYVGGETLIRFLAETLRSLAGLPFARLIVVNGHYENEPFIFEALDQIRQQG 137

Query: 136 SM---LVVSTSWSRFTIPQGIISFPETEIGI-------HGGEIETSMMLALAPHLV-KMD 184
                 V++ SW  +++ Q   S+   E+G        H G  ETS+ML L P LV    
Sbjct: 138 DFGHREVIAFSW--WSMVQD--SWLAAEVGDFPGWHAEHAGLTETSLMLHLRPDLVTDTR 193

Query: 185 LAENFSSRQSEFLRNFKYLRAHGS---HSFGWSMKDLNPK---GVVGNAMDATVKKGEGL 238
           L  +   R   +L      +        S   S  DL  K    V+  ++ A V++GEGL
Sbjct: 194 LDHDRPPRSGVYLHPIDLAQTTNQGILSSTSGSSADLGEKLFRHVIAESV-AMVREGEGL 252

Query: 239 L 239
           L
Sbjct: 253 L 253


>gi|172038872|ref|YP_001805373.1| putative creatininase [Cyanothece sp. ATCC 51142]
 gi|171700326|gb|ACB53307.1| putative creatininase [Cyanothece sp. ATCC 51142]
          Length = 248

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 62/125 (49%), Gaps = 14/125 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP   + TD I    IA G+ E+ ++I+ P + V        G ++ H 
Sbjct: 21  IIIPIGSTEQHGPIGLIGTDAICAEAIAKGVGEQTQTIVGPTINV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSML 138
              G+ +L  +  I+  L  +  + + G  +   +N HGGN SPL +  S E     S L
Sbjct: 73  AFPGSMSLRPSTLIQVILDYLTHLTQAGFTRYFFINGHGGNISPLKAAFS-ETYYHLSTL 131

Query: 139 VVSTS 143
            +  S
Sbjct: 132 NIPHS 136


>gi|113476481|ref|YP_722542.1| creatininase [Trichodesmium erythraeum IMS101]
 gi|110167529|gb|ABG52069.1| Creatininase [Trichodesmium erythraeum IMS101]
          Length = 248

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 50/101 (49%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++LP+G+ EQHGP   + TD I    I+ G+ E +++++ P + V        G ++ H 
Sbjct: 21  IILPIGSTEQHGPTGLIGTDAICAEAISKGVGETVQALVGPTINV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              GT +L     I+     I  + K G  K   +N HGGN
Sbjct: 73  DFPGTISLRPTTMIQVIRDYIVCLTKSGFTKFFFINGHGGN 113


>gi|119509487|ref|ZP_01628635.1| Creatininase [Nodularia spumigena CCY9414]
 gi|119465893|gb|EAW46782.1| Creatininase [Nodularia spumigena CCY9414]
          Length = 248

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 50/101 (49%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++LP+G+ EQHGP   + TD I    IA G+ +  ++++ P + V        G ++ H 
Sbjct: 21  IILPIGSTEQHGPTGLIGTDAICAEAIARGVGDATQALIGPTINV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              GT +L  +  I+     I  + K G  K   +N HGGN
Sbjct: 73  AFPGTISLRPSTMIQVVRDYITCLTKAGFAKFYFINGHGGN 113


>gi|288959664|ref|YP_003450005.1| creatininase [Azospirillum sp. B510]
 gi|288911972|dbj|BAI73461.1| creatininase [Azospirillum sp. B510]
          Length = 248

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 52/101 (51%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP+  + TD I    IA G+ +   +++ P +PV        G ++ HM
Sbjct: 21  IIMPIGSTEQHGPNGLVGTDAICAEVIARGVGDATGALVGPTIPV--------GMAVHHM 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              G+ TL  +  I      + ++ + G  +   +N HGGN
Sbjct: 73  EFPGSMTLKPSTLIAVLRDYVGSLVEHGFARFFFVNGHGGN 113


>gi|254431671|ref|ZP_05045374.1| creatininase [Cyanobium sp. PCC 7001]
 gi|197626124|gb|EDY38683.1| creatininase [Cyanobium sp. PCC 7001]
          Length = 271

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A  +A  +      R  V   P +  G +  H+   G
Sbjct: 43  VIVPLGSTEQHGPTGAIGTDALTAEAVALEVGR----RSGVLVTPAQAFGMAEHHLGFAG 98

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  +  +     ++ ++   G  +I ++N HGGN
Sbjct: 99  TVSLQPSTLMAVLHDVVLSLAGHGFERIFVINGHGGN 135


>gi|300868556|ref|ZP_07113173.1| creatininase [Oscillatoria sp. PCC 6506]
 gi|300333434|emb|CBN58365.1| creatininase [Oscillatoria sp. PCC 6506]
          Length = 251

 Score = 49.7 bits (117), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 58/124 (46%), Gaps = 12/124 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++LP+G+ EQHGP   + TD I    IA G+ E++K+++ P + V        G ++ H 
Sbjct: 21  MILPIGSTEQHGPTGLIGTDAICAEAIAKGVGEQVKAMVGPTINV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              G+ +L  +  +      I  + K G  K   +N HGGN   +    +E     S L 
Sbjct: 73  DFPGSVSLRPSTLMLVIRDYITCLAKSGFTKFFFINGHGGNIATMKAAFSETYAHLSDLN 132

Query: 140 VSTS 143
           +  +
Sbjct: 133 IKNA 136


>gi|302381530|ref|YP_003817353.1| creatininase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192158|gb|ADK99729.1| Creatininase [Brevundimonas subvibrioides ATCC 15264]
          Length = 250

 Score = 49.7 bits (117), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 56/121 (46%), Gaps = 15/121 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           VV+P+G+ EQHGP   + TD +   I A  AE+    L         P   IG +  H+ 
Sbjct: 21  VVIPIGSNEQHGPTGLLGTDWMCPEIIAHAAEKTDDGL------VVAPTFNIGMAQHHLA 74

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             GT +L   T+  AI  W   + ++ + G  +I  LN HGGN   +    +E    +S 
Sbjct: 75  FAGTISLRPSTFMAAITDW---VSSLHRHGFERIYFLNGHGGNVATIEATFSELYAEWSF 131

Query: 138 L 138
           +
Sbjct: 132 M 132


>gi|91787495|ref|YP_548447.1| creatininase [Polaromonas sp. JS666]
 gi|91696720|gb|ABE43549.1| Creatininase [Polaromonas sp. JS666]
          Length = 259

 Score = 49.7 bits (117), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 70/171 (40%), Gaps = 12/171 (7%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL---PVTCMPVEPIGYSIEHMY 80
           +++P+G  EQ GPH+ +    +    LA RI   L   L    V+ +P   +     HM 
Sbjct: 38  IIIPVGGTEQSGPHMALGKHNVRVQALAGRIADKLGNTLVAPVVSYVPEGRVSPPSGHMR 97

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV---------STEA 131
             GT ++     +        ++++ G   IV +  HGG   L+  V         +++ 
Sbjct: 98  FAGTISVPDDAFVAVLSGAARSLKQHGFLHIVFIGDHGGYQNLLKEVAQRLNREWTTSKT 157

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           R  +       +   F         P  +IG H G  +TS+MLA+ P  V+
Sbjct: 158 RAHYISAYYRAADEDFAQALRARGLPSNQIGTHAGLADTSLMLAIDPGRVR 208


>gi|67923616|ref|ZP_00517087.1| Creatininase [Crocosphaera watsonii WH 8501]
 gi|67854540|gb|EAM49828.1| Creatininase [Crocosphaera watsonii WH 8501]
          Length = 248

 Score = 49.7 bits (117), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 12/119 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP   + TD I    IA G+ E  ++++ P + V        G ++ H 
Sbjct: 21  IIIPIGSTEQHGPTGLIGTDAICAEAIAKGVGEATQTVVGPTINV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
              G+ +L  +  I+  L  + ++   G  +   +N HGGN   +    +E+    S L
Sbjct: 73  AFPGSMSLRPSTLIQVILDYLTSLTAAGFTRYFFINGHGGNIATLKAAFSESYYHLSHL 131


>gi|78060165|ref|YP_366740.1| amidase-like protein [Burkholderia sp. 383]
 gi|77964715|gb|ABB06096.1| amidase-like protein [Burkholderia sp. 383]
          Length = 287

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 76/180 (42%), Gaps = 18/180 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG-YS--IEHMY 80
           +++P+GA EQ GP++ +         L+ERI   L   +    +   P G Y+    HM 
Sbjct: 66  ILIPIGATEQSGPYVALGKHNARVRVLSERIAEGLGNAIVAPVIAYVPEGGYAPPTSHMR 125

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV---------SIVS 128
             GT T+    + + +E   +  ++ R  G   IV L  HGG    +         S   
Sbjct: 126 FPGTITVPDDVFEKTLE---SAANSFRVHGFTNIVFLGDHGGYQNDIKQSVARLNKSWAG 182

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
           T AR         TS   +         P  +IG H G  +TS++LA+ P +V++D   N
Sbjct: 183 TGARAFVPSAYYGTSSDGYDQILREHGVPAADIGTHAGLADTSLLLAVEPRMVRVDKLRN 242


>gi|167044598|gb|ABZ09271.1| putative creatinine amidohydrolase [uncultured marine crenarchaeote
           HF4000_APKG7F11]
          Length = 251

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 97/243 (39%), Gaps = 40/243 (16%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +    V++P+G+ EQHG HLP+ TD+ I   +A R    L  +      P    G S EH
Sbjct: 16  KSKQTVIIPVGSLEQHGAHLPITTDSDIVTEIASR----LAKKCGFIVFPTINYGVSYEH 71

Query: 79  MYVDGTKTLTYA-EAIEHWLAIIDAIRKMGIRK-----------IVILNAHGGNSPLVSI 126
             +       Y  E I     II ++  M   K            +ILN H GN+   ++
Sbjct: 72  DPLTNINIADYNLEKI--LFDIITSLFHMAPGKETRGKVTSKLSYIILNGHHGNAE--AL 127

Query: 127 VSTEARMRFSMLVVSTSWSRFTIPQGIIS------FPETEIGIHGGEIETSMMLALAPHL 180
           V+ EA+++   L      +    P G +       F E E   H G +ETS+ML ++   
Sbjct: 128 VNLEAKLKDKYLGKGFPHA----PHGRLRVYSYWHFMEHEFD-HAGFVETSLMLTIS--- 179

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWS---MKDLNPKGVVGNAMDATVKKGEG 237
              D  +   +++   + N   L    +            +   GV G+   AT K GE 
Sbjct: 180 ---DKVKMKKAKKGLIIDNLSKLEQSAAKKLSTQEGGFPQVAKNGVWGDPTSATKKDGEK 236

Query: 238 LLS 240
            L+
Sbjct: 237 FLA 239


>gi|126737597|ref|ZP_01753327.1| Creatininase [Roseobacter sp. SK209-2-6]
 gi|126720990|gb|EBA17694.1| Creatininase [Roseobacter sp. SK209-2-6]
          Length = 253

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 98/228 (42%), Gaps = 21/228 (9%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGL----AERIKSILPPRLPVTCMPVEPIGY 74
           RK   ++LP+G+ EQHGP   + TDTI A  +    AE   +I+ P L  T  P      
Sbjct: 16  RKGAAIILPVGSTEQHGPMGRIGTDTICAKAVALLAAEACDAIVAPPLAYTPAPF----- 70

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARM 133
              +    GT ++       H  AI+  +   G   + ++N HG N +PL +I ++    
Sbjct: 71  ---NTAFPGTVSMPEEIFQAHAGAIVTGLLAQGFLGVFVVNGHGANLAPLRAIANS---C 124

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
           +   + + + W     P+ +        G   G   T   +A+  +L+ +  + + S   
Sbjct: 125 KPEQMRIRSWWE----PEEVNGLRRDLYGDWEGMHATPSEVAITQYLLGVLPSGDASEAP 180

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGN-AMDATVKKGEGLLS 240
           ++  + +    +   H      + + P G VG+ +  AT + GE +L+
Sbjct: 181 TKLTQEYIQEHSGDRHGRPEEHRQMFPDGRVGSHSALATPEDGERILA 228


>gi|75907458|ref|YP_321754.1| creatininase [Anabaena variabilis ATCC 29413]
 gi|75701183|gb|ABA20859.1| Creatininase [Anabaena variabilis ATCC 29413]
          Length = 251

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 12/106 (11%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           +K   ++LP+G+ EQHGP   + TD I    IA G+ E   +I+ P + V        G 
Sbjct: 16  QKSTGIILPIGSTEQHGPTGLIGTDAICAEAIARGVGEATGAIVAPTINV--------GM 67

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           ++ H    GT +L  +  I      + ++ K G  K   +N HGGN
Sbjct: 68  ALHHTAFPGTISLRPSTLILLVRDYVTSLAKAGFTKFYFINGHGGN 113


>gi|126658416|ref|ZP_01729565.1| Creatininase [Cyanothece sp. CCY0110]
 gi|126620348|gb|EAZ91068.1| Creatininase [Cyanothece sp. CCY0110]
          Length = 243

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 61/125 (48%), Gaps = 14/125 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP   + TD I    IA G+ E+ ++I+ P + V        G ++ H 
Sbjct: 16  MIIPIGSTEQHGPTGLIGTDAICAEAIAKGVGEQTQTIVGPTINV--------GMALHHT 67

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN-SPLVSIVSTEARMRFSML 138
              G+ +L  +  I+  L  +  + + G      +N HGGN SPL +  S E     S L
Sbjct: 68  AFPGSMSLRPSTLIQVILDYLTYLTQAGFTHYFFINGHGGNISPLKAAFS-ETYTHLSSL 126

Query: 139 VVSTS 143
            +  S
Sbjct: 127 NIPQS 131


>gi|330820016|ref|YP_004348878.1| creatininase [Burkholderia gladioli BSR3]
 gi|327372011|gb|AEA63366.1| creatininase [Burkholderia gladioli BSR3]
          Length = 249

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 79/182 (43%), Gaps = 32/182 (17%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           ++   +V+P+G+ EQHGP   + TD +   I A  A++   IL         P   IG +
Sbjct: 16  KRSRTIVVPIGSNEQHGPTGLLGTDWLCPEIIAVEAQKSADIL-------VAPTFNIGMA 68

Query: 76  IEHMYVDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE-- 130
             H+   GT +L   T+  AI  W   ++++   G  KI+ LN HGGN   +    +E  
Sbjct: 69  QHHLGFPGTISLRPSTFIAAICDW---VNSLAVHGFEKILFLNGHGGNVASIEAAFSEIY 125

Query: 131 -----ARMRFSMLVVSTSWSRFTIPQGII-----SFPETEIGIHGGEIETSMMLALAPHL 180
                AR R    +   +W      +G+       FP T  G+H    E ++     PH 
Sbjct: 126 AQASFARRRCGFALKLKNWWDL---EGVTEIANRQFP-TGHGVHATPSEIAVTQWALPHT 181

Query: 181 VK 182
           +K
Sbjct: 182 IK 183


>gi|77458487|ref|YP_347992.1| creatininase [Pseudomonas fluorescens Pf0-1]
 gi|77382490|gb|ABA74003.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 249

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 60/129 (46%), Gaps = 23/129 (17%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           +V+P+G+ EQHGP   + TD +   I A  A++   IL         P   IG +  H+ 
Sbjct: 21  IVIPIGSNEQHGPTGLLGTDWMCPEIIAHEAQKSADIL-------IAPTFNIGMAQHHLG 73

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             GT +L   T+  AI  W   + A    G  KI  LN HGGN     I S EA   FS 
Sbjct: 74  FPGTISLRPSTFIAAIADWTRSLAA---HGFEKIFFLNGHGGN-----IASIEA--AFSE 123

Query: 138 LVVSTSWSR 146
           L    S++R
Sbjct: 124 LYAEASFAR 132


>gi|113953418|ref|YP_729571.1| creatininase [Synechococcus sp. CC9311]
 gi|113880769|gb|ABI45727.1| creatininase [Synechococcus sp. CC9311]
          Length = 262

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++PLG+ EQHGP   + TD + A    E +   L  R  V   P +  G +  H+   G
Sbjct: 35  IIIPLGSTEQHGPTGAIGTDALTA----EAVALELGRRSGVLVTPAQAYGMAEHHLGFAG 90

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  A  +     ++ ++   G  +I ++N HGGN
Sbjct: 91  TMSLQPATLMAVMHDLVLSLATHGFERIFVVNGHGGN 127


>gi|148243306|ref|YP_001228463.1| amidase [Synechococcus sp. RCC307]
 gi|147851616|emb|CAK29110.1| Possible amidase [Synechococcus sp. RCC307]
          Length = 256

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 48/97 (49%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A  +A  +      R  V   P +  G +  H+   G
Sbjct: 27  VIVPLGSTEQHGPTGAIGTDALTAEAVALEVGR----RSGVLVTPTQAFGMAEHHLGFAG 82

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  +  +     ++ ++   G  ++ ++N HGGN
Sbjct: 83  TVSLQPSTLLAVLRDVVLSLATHGFERVFVINGHGGN 119


>gi|332709116|ref|ZP_08429084.1| uncharacterized protein, putative amidase [Lyngbya majuscula 3L]
 gi|332352122|gb|EGJ31694.1| uncharacterized protein, putative amidase [Lyngbya majuscula 3L]
          Length = 248

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 57/121 (47%), Gaps = 12/121 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++LP+G+ EQHGP   + TD I    IA G++E   +++ P + V        G ++ H 
Sbjct: 21  IILPIGSTEQHGPTGLIGTDAICAEAIAKGVSEATNALVAPTINV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              G+ +L  +  I+     +  + + G  K   +N HGGN   +    +E+    S L 
Sbjct: 73  AFPGSISLKPSTLIQVIKDYLTCLTRAGFTKFFFINGHGGNIATLKAAFSESYAHLSDLQ 132

Query: 140 V 140
           +
Sbjct: 133 I 133


>gi|187776648|ref|ZP_02993121.1| hypothetical protein CLOSPO_00163 [Clostridium sporogenes ATCC
           15579]
 gi|187775307|gb|EDU39109.1| hypothetical protein CLOSPO_00163 [Clostridium sporogenes ATCC
           15579]
          Length = 279

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 81/171 (47%), Gaps = 13/171 (7%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR---LPVTCMPVEPIGYSIEHMY 80
           V + L   E+HGPHLP+ TD I A  L + +   L  +         P  PIGY+   M 
Sbjct: 24  VFVALSPIEEHGPHLPLGTDYISAKDLLKAVIDNLEKQNNAYNYIIHPSFPIGYNECVMN 83

Query: 81  VDGTKTLTYAEAIEHWLAII-DAIRKMGIRKIVILNAH--GGNSPLVS----IVSTEARM 133
             GT +   ++ IE+ +  + ++I + G +K+VI+N H   G+  ++     I++ E  +
Sbjct: 84  YPGTISFK-SKTIENIVVDLGESISRAGFKKMVIVNHHLDLGHIKVIENAKDILNKECSL 142

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPE--TEIGIHGGEIETSMMLALAPHLVK 182
           +   +  S  +S+    +  I   +   E  IH    ETS ML   P LVK
Sbjct: 143 KVLEVASSIIYSQSAKEKVKIVKNDLNMEREIHADVRETSFMLFKHPELVK 193


>gi|17231775|ref|NP_488323.1| hypothetical protein all4283 [Nostoc sp. PCC 7120]
 gi|17133418|dbj|BAB75982.1| all4283 [Nostoc sp. PCC 7120]
          Length = 249

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 12/106 (11%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           +K   ++LP+G+ EQHGP   + TD I    IA G+ E   +I+ P + V        G 
Sbjct: 16  QKSTGIILPIGSTEQHGPTGLIGTDAICAEAIAHGVGEATGAIVAPTINV--------GM 67

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           ++ H    GT +L  +  I      + ++ K G  K   +N HGGN
Sbjct: 68  ALHHAAFPGTISLRPSTLILLVRDYVTSLAKAGFTKFYFINGHGGN 113


>gi|116075648|ref|ZP_01472907.1| Creatininase [Synechococcus sp. RS9916]
 gi|116066963|gb|EAU72718.1| Creatininase [Synechococcus sp. RS9916]
          Length = 262

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 4/97 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A  +A  +      R  V   P +  G +  H+   G
Sbjct: 35  VIIPLGSTEQHGPTGAIGTDALTAEAVALELGR----RSGVLVTPAQAFGMAEHHLGFAG 90

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L  +  +     ++ ++   G  +I ++N HGGN
Sbjct: 91  TMSLQPSTLMAVLHDLVLSLATHGFERIFVVNGHGGN 127


>gi|229591003|ref|YP_002873122.1| hypothetical protein PFLU3560 [Pseudomonas fluorescens SBW25]
 gi|229362869|emb|CAY49779.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 248

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 59/126 (46%), Gaps = 17/126 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           VV+P+G+ EQHGP   + TD +    +A   +        +   P   IG +  H+   G
Sbjct: 21  VVIPIGSNEQHGPTGLLGTDWMCPEIIAHEAQQ----HADILIGPTFNIGMAQHHLGFPG 76

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           T +L   T+  AI  W   + ++   G  KI+ LN HGGN     I + EA   FS L  
Sbjct: 77  TISLRPSTFIAAIGDW---VRSLAGHGFEKILFLNGHGGN-----IATIEA--AFSELYA 126

Query: 141 STSWSR 146
             S++R
Sbjct: 127 EASFAR 132


>gi|254282683|ref|ZP_04957651.1| creatininase [gamma proteobacterium NOR51-B]
 gi|219678886|gb|EED35235.1| creatininase [gamma proteobacterium NOR51-B]
          Length = 249

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 9/100 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++P+G+ EQHGP   + TD+I    +A+      P  L     P   +G +  H+   G
Sbjct: 21  IIVPIGSMEQHGPTGLIGTDSICPEVIAKAAAEDNPDLL---VGPTFNVGCAQHHLGFPG 77

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           + TL   T   AI  W A   ++R+ G  +I  LN HGGN
Sbjct: 78  SMTLRPSTMIAAIGDWCA---SLRRHGFERIYWLNGHGGN 114


>gi|209527276|ref|ZP_03275786.1| Creatininase [Arthrospira maxima CS-328]
 gi|209492264|gb|EDZ92609.1| Creatininase [Arthrospira maxima CS-328]
          Length = 250

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 56/124 (45%), Gaps = 12/124 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++LP+G+ EQHGP   + TD I    IA G+ E  ++++ P L V        G ++ H 
Sbjct: 21  IILPIGSTEQHGPTGLIGTDAICAEAIAKGVGEATQALVGPTLNV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              GT +L  +  I      I  + K G      +N HGGN   +    +E     + L 
Sbjct: 73  AFPGTISLQPSTLIRVIKDYITFLAKSGFTTFFFINGHGGNIATLKAAFSETYAHLADLN 132

Query: 140 VSTS 143
           ++ S
Sbjct: 133 LANS 136


>gi|206603782|gb|EDZ40262.1| Putative creatininase [Leptospirillum sp. Group II '5-way CG']
          Length = 251

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           ++++P+G+ EQHGP+  + TD ++A  LA  +       + +   P    G S  H+   
Sbjct: 20  VLLIPIGSTEQHGPNGLIGTDHLVAESLARSVGE----EMGILVAPTLAYGMSHHHLAFP 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           G+ +L+    I     ++ +  + G  +   +N HGGN
Sbjct: 76  GSASLSPETLIRVIRDVVTSFARNGFSRFFFINGHGGN 113


>gi|300713022|ref|YP_003738834.1| Creatininase [Halalkalicoccus jeotgali B3]
 gi|299126706|gb|ADJ17043.1| Creatininase [Halalkalicoccus jeotgali B3]
          Length = 273

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 94/247 (38%), Gaps = 17/247 (6%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD- 82
            ++P+G  EQHG HL M TD  I   + ERI         V  +   PI Y    M+   
Sbjct: 27  ALIPVGTTEQHGEHLAMGTDAFIPTEICERIAE------DVDALVGPPINYGASDMHAGY 80

Query: 83  -GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF---SML 138
            G   LTY         I  ++ + G   IV L+ H  N     + + +A       + +
Sbjct: 81  AGITYLTYRTLATVVHDIAYSLAEAGFTDIVFLSGHLTNDWAAKVGANQASHDLPEENYV 140

Query: 139 VVSTSWSRFTIP--QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
                W   +    +  +SF   + G H    ET+ ++A+   LV ++     +      
Sbjct: 141 YAFPYWDALSGDDMEEYLSF---DAGWHANIGETAAVMAIDEDLVDLEETAFDAPDLPMD 197

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
           + N   L  H     G   + ++  GV G+  DAT + GE       +   +L+N     
Sbjct: 198 IENPAALLDHLLIGKGAYYR-ISETGVWGDPSDATAELGEEYFETITHAVAELINTFQDV 256

Query: 257 DVSIFDK 263
              I+ +
Sbjct: 257 RDEIYQR 263


>gi|124515096|gb|EAY56607.1| putative creatininase [Leptospirillum rubarum]
          Length = 251

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           ++++P+G+ EQHGP+  + TD ++A  LA  +       + +   P    G S  H+   
Sbjct: 20  VLLIPIGSTEQHGPNGLIGTDHLVAESLARSVGE----EMGILVAPTLAYGMSHHHLAFP 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           G+ +L+    I     ++ +  + G  +   +N HGGN
Sbjct: 76  GSASLSPETLIRVIRDVVTSFARNGFSRFFFINGHGGN 113


>gi|307151821|ref|YP_003887205.1| Creatininase [Cyanothece sp. PCC 7822]
 gi|306982049|gb|ADN13930.1| Creatininase [Cyanothece sp. PCC 7822]
          Length = 248

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 50/101 (49%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP   + TD I    IA G+ E   +++ P L         +G ++ H 
Sbjct: 21  IIIPIGSTEQHGPTGLIGTDAICAEVIAKGVGEATAAMVGPTL--------HLGMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              GT +L  +  I+  +  I  +   G R+   +N HGGN
Sbjct: 73  AFSGTISLRPSTLIQVVMDYITCLAVSGFRRFFWINGHGGN 113


>gi|257790913|ref|YP_003181519.1| Creatininase [Eggerthella lenta DSM 2243]
 gi|317488372|ref|ZP_07946929.1| creatininase [Eggerthella sp. 1_3_56FAA]
 gi|325830522|ref|ZP_08163975.1| creatininase [Eggerthella sp. HGA1]
 gi|257474810|gb|ACV55130.1| Creatininase [Eggerthella lenta DSM 2243]
 gi|316912525|gb|EFV34077.1| creatininase [Eggerthella sp. 1_3_56FAA]
 gi|325487431|gb|EGC89872.1| creatininase [Eggerthella sp. HGA1]
          Length = 276

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 79/184 (42%), Gaps = 21/184 (11%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL--PVTCMPVEPIGYSIE 77
           KD +V +P+GA EQHG H+ M  D  +   +A      L       +  +   PI Y   
Sbjct: 21  KDAVVFIPVGALEQHGSHMAMCVDAALTKAMAGATAEALVADTDGAMEAVVAAPINYGYR 80

Query: 78  H-------MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV----SI 126
                    ++ GT +L+    I     ++  +   G RKIV++N H  N   +     +
Sbjct: 81  SQQRSGGGFHLSGTTSLSGTTLIALAKDVVFGLILHGARKIVLMNGHYENYQFIFEGAEL 140

Query: 127 VSTEAR---MRFSMLVVSTSWSRFTIPQGIIS-FPETEIG---IHGGEIETSMMLALAPH 179
              +AR   +R   + + + W  F   + I + +P+   G    H G +ETS+ML   P 
Sbjct: 141 ALEKARENGIRDVKIQLLSYWD-FVDDETIEALYPDGFTGWDLEHAGVMETSLMLLFHPD 199

Query: 180 LVKM 183
           LV +
Sbjct: 200 LVDL 203


>gi|312961570|ref|ZP_07776071.1| creatininase [Pseudomonas fluorescens WH6]
 gi|311284249|gb|EFQ62829.1| creatininase [Pseudomonas fluorescens WH6]
          Length = 248

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 62/129 (48%), Gaps = 23/129 (17%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           VV+P+G+ EQHGP   + TD +   I A  A++   IL         P   IG +  H+ 
Sbjct: 21  VVIPIGSNEQHGPTGLLGTDWMCPEIIAHEAQKNADIL-------IGPTFNIGMAQHHLG 73

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             GT +L   T+  AI  W   + ++   G  KI+ LN HGGN     I + EA   FS 
Sbjct: 74  FPGTISLRPSTFIAAIGDW---VRSLAGHGFDKILFLNGHGGN-----IATIEA--AFSE 123

Query: 138 LVVSTSWSR 146
           L    S++R
Sbjct: 124 LYAEASFAR 132


>gi|298247041|ref|ZP_06970846.1| Creatininase [Ktedonobacter racemifer DSM 44963]
 gi|297549700|gb|EFH83566.1| Creatininase [Ktedonobacter racemifer DSM 44963]
          Length = 254

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 103/252 (40%), Gaps = 39/252 (15%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGL--AERIKSILPPRLPVTCMPVEPIGYS 75
           A++ W+ ++P G  EQ GPHLP++ DT  A  L  A   K+     +    +P  P G +
Sbjct: 23  AQQGWLAIIPTGCTEQQGPHLPVDFDTWFAEALMVAAAEKAAQDSAVQAVVLPAMPFGPT 82

Query: 76  IEHM-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
            EH      ++D   +L  A  +E   A + ++   G +++VI    GG++ L  +V   
Sbjct: 83  PEHRNFGSGFIDVPVSLHDA-LVE---ATLTSLVTQGFKRMVIWRGCGGHA-LNGVVE-- 135

Query: 131 ARMRFSMLVVSTSWSRFTIPQGI------ISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
              RF+      +   F  P         ++ P   +G H     TS+ L L P  V+ +
Sbjct: 136 ---RFNQRYQGKA-QAFLPPHPFHEIWCRLADPVIPVG-HADSFTTSISLYLRPETVRQE 190

Query: 185 LAENFSSRQSEFLR-NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
              N  S + ++   N  + R              +  GV+G+   A+ + G+ L     
Sbjct: 191 WITNPHSTEVDWNDPNLDFAR-------------YSSTGVIGDPTYASAELGKRLWEAVV 237

Query: 244 NCFIQLLNDINS 255
                +L +  S
Sbjct: 238 EEAAHMLQEAAS 249


>gi|329894076|ref|ZP_08270061.1| Creatininase [gamma proteobacterium IMCC3088]
 gi|328923248|gb|EGG30568.1| Creatininase [gamma proteobacterium IMCC3088]
          Length = 248

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 10/117 (8%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++P+G+ EQHGP   + TD I    +A+R+         V   P   +G +  H+   G
Sbjct: 21  IIIPIGSMEQHGPTGLIGTDAICPEVIAKRVGD----EHGVLIGPTFNVGCAQHHLGFPG 76

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           T TL   T   AI  W     ++ K G +K+   N HGGN+  +     E   + S 
Sbjct: 77  TMTLRPSTMIAAIADWSL---SLAKHGFKKLYWFNGHGGNTATIQAAFAEVYAQRSF 130


>gi|284053173|ref|ZP_06383383.1| creatininase [Arthrospira platensis str. Paraca]
          Length = 250

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 58/129 (44%), Gaps = 12/129 (9%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           +K   ++LP+G+ EQHGP   + TD I    IA G+ E  ++++ P L V        G 
Sbjct: 16  QKSTGIILPIGSTEQHGPTGLIGTDAICAEAIAKGVGEATQALVGPTLNV--------GM 67

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           ++ H    G+ +L  +  I      I  + K G      +N HGGN   +    +E    
Sbjct: 68  ALHHTAFPGSISLQPSTLIRVIKDYITFLAKSGFTTFFFINGHGGNIATLKAAFSETYAH 127

Query: 135 FSMLVVSTS 143
            + L ++ S
Sbjct: 128 LTDLNLANS 136


>gi|150401093|ref|YP_001324859.1| creatininase [Methanococcus aeolicus Nankai-3]
 gi|327507629|sp|A6UUS5|ARFB_META3 RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|150013796|gb|ABR56247.1| Creatininase [Methanococcus aeolicus Nankai-3]
          Length = 242

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 7/108 (6%)

Query: 22  WIVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
            I ++ LG+Y E HG  LP++TD  IA+ +A  +      +     +P      S E+ Y
Sbjct: 35  QIGIIALGSYLENHGTVLPIDTDIKIASYIALNVAIQTGAKFLGCVLP------STEYEY 88

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V      T  E +E+   +++  +K+GI K +I+N HGGN+ +  ++ 
Sbjct: 89  VKHGIHNTPNEVVEYIDFLVEQGKKIGINKFLIINCHGGNTLINELIE 136


>gi|108803308|ref|YP_643245.1| creatininase [Rubrobacter xylanophilus DSM 9941]
 gi|108764551|gb|ABG03433.1| Creatininase [Rubrobacter xylanophilus DSM 9941]
          Length = 268

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 79/185 (42%), Gaps = 21/185 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD- 82
           V LP+G+ EQHG HLP+ TD I+   LA  +   L        +   P+ Y      +  
Sbjct: 27  VFLPVGSTEQHGYHLPLATDVILPTELALAVADEL------DFLVAPPVAYGYRSRPLSG 80

Query: 83  ------GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA--RMR 134
                 GT +L     +     ++  + + G  +I ++N H  N   V   +  A  R R
Sbjct: 81  GGQGFVGTISLQARTLMSLVEDVLSELIRQGFERIAVVNWHFENQNFVYEAACLALERHR 140

Query: 135 FS---MLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAEN 188
            S   +LV    ++  +       FPE   G    H   +ETS+ML L P LV  D A +
Sbjct: 141 GSSARILVAEHPFAELSEATMKTLFPEGFPGWDYEHASIMETSLMLHLRPELVLFDRAVD 200

Query: 189 FSSRQ 193
            +S++
Sbjct: 201 DASKR 205


>gi|254414299|ref|ZP_05028066.1| creatininase subfamily [Microcoleus chthonoplastes PCC 7420]
 gi|196178974|gb|EDX73971.1| creatininase subfamily [Microcoleus chthonoplastes PCC 7420]
          Length = 248

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 12/112 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++LP+G+ EQHGP   + TD I    IA G+ E   +I+ P + V        G ++ H 
Sbjct: 21  IILPIGSTEQHGPTGLIGTDAICAEAIARGVGEATNAIVSPTISV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
              GT +L  +  I      + ++ + G  +   +N HGGN   V    +E+
Sbjct: 73  GFPGTISLKPSTLIHVIQDYLVSLTRAGFTRFFFINGHGGNVATVKAAFSES 124


>gi|291569175|dbj|BAI91447.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 250

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 58/129 (44%), Gaps = 12/129 (9%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           +K   ++LP+G+ EQHGP   + TD I    IA G+ E  ++++ P L V        G 
Sbjct: 16  QKSTGIILPIGSTEQHGPTGLIGTDAICAEAIAKGVGEATQALVGPTLNV--------GM 67

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           ++ H    G+ +L  +  I      I  + K G      +N HGGN   +    +E    
Sbjct: 68  ALHHTAFPGSISLQPSTLIRVIKDYITFLAKSGFTTFFFINGHGGNIATLKAAFSETYAH 127

Query: 135 FSMLVVSTS 143
            + L ++ S
Sbjct: 128 LADLNLANS 136


>gi|220906393|ref|YP_002481704.1| Creatininase [Cyanothece sp. PCC 7425]
 gi|219863004|gb|ACL43343.1| Creatininase [Cyanothece sp. PCC 7425]
          Length = 259

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 51/101 (50%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++LP+G+ EQHGP   + TD I    IA G+ E+  +++ P + V        G ++ H 
Sbjct: 33  IILPIGSTEQHGPTGLIGTDAICAEAIARGVGEQTHALVAPTINV--------GMALHHT 84

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              G+ +L  +  I      + ++ + G RK   +N HGGN
Sbjct: 85  AFPGSISLRPSTLILVIRDYLVSLARAGFRKFFFINGHGGN 125


>gi|258541117|ref|YP_003186550.1| creatininase [Acetobacter pasteurianus IFO 3283-01]
 gi|256632195|dbj|BAH98170.1| creatininase [Acetobacter pasteurianus IFO 3283-01]
 gi|256635252|dbj|BAI01221.1| creatininase [Acetobacter pasteurianus IFO 3283-03]
 gi|256638307|dbj|BAI04269.1| creatininase [Acetobacter pasteurianus IFO 3283-07]
 gi|256641361|dbj|BAI07316.1| creatininase [Acetobacter pasteurianus IFO 3283-22]
 gi|256644416|dbj|BAI10364.1| creatininase [Acetobacter pasteurianus IFO 3283-26]
 gi|256647471|dbj|BAI13412.1| creatininase [Acetobacter pasteurianus IFO 3283-32]
 gi|256650524|dbj|BAI16458.1| creatininase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653515|dbj|BAI19442.1| creatininase [Acetobacter pasteurianus IFO 3283-12]
          Length = 279

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 80/177 (45%), Gaps = 21/177 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERI-----KSILPPRLPVTCMPVEPIGYSIEH 78
           +++P+G  EQ GP++ +         +A+RI     K+++ P   V  +P         H
Sbjct: 60  LIIPIGGTEQSGPYIAVGKHNTRVMEIAQRIAEKSGKTLVAPV--VAYVPEGSTSPRTSH 117

Query: 79  MYVDGTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE-----AR 132
           M   GT T+   +  E  +A    + +  G R IV +  HGG    +  V+T+     A 
Sbjct: 118 MKFPGTITIP-TDVFEKLIASAAKSFQVQGFRLIVFIGDHGGYQKSLDKVATQLNKEWAG 176

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPET-----EIGIHGGEIETSMMLALAPHLVKMD 184
            +   L V   +S   IP   + +        ++G+H    +TS+MLA+ P +V++D
Sbjct: 177 TQAQALYVKQYYS--VIPHQYVQWLSQHGYAKDVGMHADISDTSLMLAIDPTMVRLD 231


>gi|119871897|ref|YP_929904.1| creatininase [Pyrobaculum islandicum DSM 4184]
 gi|119673305|gb|ABL87561.1| Creatininase [Pyrobaculum islandicum DSM 4184]
          Length = 206

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 31/48 (64%), Gaps = 4/48 (8%)

Query: 23 IVVLPLGAYEQHGPHLPMNTDT----IIAAGLAERIKSILPPRLPVTC 66
          + +LP+G+YEQHGPHLP   DT     IA  LAE+I + + P +  TC
Sbjct: 2  VCILPIGSYEQHGPHLPPTVDTEIAQYIALKLAEKITAQVLPPIWYTC 49


>gi|329891216|ref|ZP_08269559.1| creatinine amidohydrolase family protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328846517|gb|EGF96081.1| creatinine amidohydrolase family protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 259

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 50/103 (48%), Gaps = 15/103 (14%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           V++P+G+ EQHGP   + TD +   I A  AE+    L         P   IG +  H+ 
Sbjct: 25  VIVPIGSNEQHGPTGLLGTDWLCPEIIAHAAEKGDDSL------IVTPTFNIGMAQHHLA 78

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             GT TL   T+  AI  W   + ++ + G  +I  LN HGGN
Sbjct: 79  FPGTITLRPSTFMAAIADW---VSSLTRHGFERIYFLNGHGGN 118


>gi|329114729|ref|ZP_08243486.1| Creatininase [Acetobacter pomorum DM001]
 gi|326695860|gb|EGE47544.1| Creatininase [Acetobacter pomorum DM001]
          Length = 297

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 86/177 (48%), Gaps = 21/177 (11%)

Query: 24  VVLPLGAYEQHGPHLPM---NTDTI-IAAGLAERI-KSILPPRLPVTCMPVEPIGYSIEH 78
           +++P+G  EQ GP++ +   NT  + +A  +AE+  K+++ P   V+ +P   I     H
Sbjct: 78  IIIPVGGTEQSGPYIAVGKHNTRVMDMAQNIAEKSGKTLVAPV--VSYVPEGGISPRTSH 135

Query: 79  MYVDGTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR----- 132
           M   GT T+  A+  E  +A    + +  G R IV +  HGG    +  V+T+       
Sbjct: 136 MKFPGTITIP-ADVFEKLMASAAKSFQVQGFRLIVFIGDHGGYQKSLDKVATQLNKEWFG 194

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPET-----EIGIHGGEIETSMMLALAPHLVKMD 184
           ++   L V   +S   IP     +        ++G+H    +TS+MLA+ P +V++D
Sbjct: 195 IQAQALYVKQYYS--VIPHQYAQWLSQHGYAKDVGMHADISDTSLMLAIDPTMVRLD 249


>gi|170699448|ref|ZP_02890492.1| Creatininase [Burkholderia ambifaria IOP40-10]
 gi|170135648|gb|EDT03932.1| Creatininase [Burkholderia ambifaria IOP40-10]
          Length = 249

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           +V+P+G+ EQHGP   + TD +   I A  AE+   IL         P   IG +  H+ 
Sbjct: 21  IVVPIGSNEQHGPTGLLGTDWLCPEIIAREAEKSADIL-------VGPTFNIGMAQHHLG 73

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             GT +L   T+  AI  W   + A    G  KI+ LN HGGN     I S +A   FS 
Sbjct: 74  FPGTISLRPSTFIAAIGDWTRSLVA---HGFEKILFLNGHGGN-----ISSIDA--AFSE 123

Query: 138 LVVSTSWSR 146
           L    S++R
Sbjct: 124 LYAEASFAR 132


>gi|172062820|ref|YP_001810471.1| creatininase [Burkholderia ambifaria MC40-6]
 gi|171995337|gb|ACB66255.1| Creatininase [Burkholderia ambifaria MC40-6]
          Length = 249

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 60/129 (46%), Gaps = 23/129 (17%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           +V+P+G+ EQHGP   + TD +   I A  AE+   IL         P   IG +  H+ 
Sbjct: 21  IVVPIGSNEQHGPTGLLGTDWLCPEIIAREAEKSADIL-------VGPTFNIGMAQHHLG 73

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             GT +L   T+  AI  W   + A    G  KI+ LN HGGN   VS V       FS 
Sbjct: 74  FPGTISLRPSTFIAAIGDWTRSLVA---HGFEKILFLNGHGGN---VSSVDAA----FSE 123

Query: 138 LVVSTSWSR 146
           L    S++R
Sbjct: 124 LYAEASFAR 132


>gi|154251790|ref|YP_001412614.1| creatininase [Parvibaculum lavamentivorans DS-1]
 gi|154155740|gb|ABS62957.1| Creatininase [Parvibaculum lavamentivorans DS-1]
          Length = 269

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 10/100 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +V+P+G+ EQHGP+  + TD I    +A R  +           P   +G +  H+   G
Sbjct: 42  IVIPIGSTEQHGPNGLIGTDAICPEAIATRAGA----EADFLVGPTFNVGIAQHHLGFPG 97

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T TL   T   A+  W   + ++ + G  +I   N HGGN
Sbjct: 98  TLTLRPSTMIAALHDW---VSSLARHGFERIYFFNGHGGN 134


>gi|171186189|ref|YP_001795108.1| creatininase [Thermoproteus neutrophilus V24Sta]
 gi|170935401|gb|ACB40662.1| Creatininase [Thermoproteus neutrophilus V24Sta]
          Length = 209

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 4/48 (8%)

Query: 23 IVVLPLGAYEQHGPHLPMNTDT----IIAAGLAERIKSILPPRLPVTC 66
          + VLP+G+YEQHGPHLP   D      IA+ LAER    L P +  TC
Sbjct: 2  VCVLPIGSYEQHGPHLPPTVDAEVALYIASRLAERFGGRLLPPIYYTC 49


>gi|119485691|ref|ZP_01619966.1| Creatininase [Lyngbya sp. PCC 8106]
 gi|119457016|gb|EAW38143.1| Creatininase [Lyngbya sp. PCC 8106]
          Length = 246

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP   + TD I    IA G  E   +++ P + V        G ++ HM
Sbjct: 21  IIIPIGSTEQHGPTGLIGTDAICAEAIAKGTGEATNALVSPTINV--------GMALHHM 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              G+ +L  +  I      I ++   G  K   +N HGGN
Sbjct: 73  AFPGSMSLQPSTLINVIKDYITSLAGHGFNKFFFINGHGGN 113


>gi|134046727|ref|YP_001098212.1| creatininase [Methanococcus maripaludis C5]
 gi|327507633|sp|A4G0L4|ARFB_METM5 RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|132664352|gb|ABO35998.1| Creatininase [Methanococcus maripaludis C5]
          Length = 221

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 58/113 (51%), Gaps = 7/113 (6%)

Query: 17  DARKDWIVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           D +   + ++ LG++ E HG  LP++TD  IA+ +A  +      +     +P      S
Sbjct: 13  DEKVHEMGIIALGSFLENHGSALPIDTDAKIASYIALNVSISTGAKFLGVVIP------S 66

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
            E+ YV      +  + I +   +++  RK+GI K +I+N HGGN+ ++  +S
Sbjct: 67  TEYSYVKHGIHDSIEDVITYIKYLVENGRKIGINKFLIINCHGGNTIILDELS 119


>gi|73538948|ref|YP_299315.1| creatininase [Ralstonia eutropha JMP134]
 gi|72122285|gb|AAZ64471.1| Creatininase [Ralstonia eutropha JMP134]
          Length = 251

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 63/133 (47%), Gaps = 21/133 (15%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           ++   +V+P+G+ EQHGP   + TD +   I A  AER K+       +   P   IG +
Sbjct: 16  KRSRTIVIPIGSNEQHGPTGLLGTDWLCPEIIAREAEREKAA-----DILVGPTFNIGMA 70

Query: 76  IEHMYVDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
             H+   GT +L   T+  AI  W     ++   G  KI+ LN HGGN     I S EA 
Sbjct: 71  QHHLGFPGTISLRPSTFIAAIGDW---TRSLVGHGFEKILFLNGHGGN-----IASIEA- 121

Query: 133 MRFSMLVVSTSWS 145
             FS +    S++
Sbjct: 122 -AFSEIYAEASFA 133


>gi|163793697|ref|ZP_02187671.1| hypothetical protein BAL199_11731 [alpha proteobacterium BAL199]
 gi|159180808|gb|EDP65325.1| hypothetical protein BAL199_11731 [alpha proteobacterium BAL199]
          Length = 236

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 5/105 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
            VLP+G+ EQH   L +  D I    LAE++       L V   P  P G +       G
Sbjct: 21  CVLPIGSTEQHA-QLSLCVDMI----LAEKVAVDAAEPLGVPVYPAIPFGIAPYFGAFPG 75

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           + TL     +     ++ + R+ G R+++++N HGGN P+ ++  
Sbjct: 76  SVTLRVETLLAVARDLVASFRRSGFRRVLLVNGHGGNQPVAALAQ 120


>gi|296161222|ref|ZP_06844031.1| Creatininase [Burkholderia sp. Ch1-1]
 gi|295888563|gb|EFG68372.1| Creatininase [Burkholderia sp. Ch1-1]
          Length = 271

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 76/176 (43%), Gaps = 18/176 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI-GYS--IEHMY 80
           +++P+G  EQ GP + +         L++RI   L   L    +   P  GY+    HM 
Sbjct: 50  IIIPIGGTEQSGPDVALGKHNARVKVLSQRIAEGLGNALVAPVIAYVPEGGYAPPTSHMR 109

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV---------SIVS 128
             GT T+    + + +E   +  ++ R  G R IV L  HGG    +         +   
Sbjct: 110 FPGTITVPDDVFEKTLE---SAANSFRIHGFRNIVFLGDHGGYQNDIKRAVAQLNKAWAG 166

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           + AR          S+  +        + + EIG H G  +TS++LA+AP +V+++
Sbjct: 167 SGARAFVPPEYYGASFDGYAQILRQHGYRDDEIGTHAGLADTSLLLAVAPQMVRLE 222


>gi|115358012|ref|YP_775150.1| creatininase [Burkholderia ambifaria AMMD]
 gi|115283300|gb|ABI88816.1| Creatininase [Burkholderia ambifaria AMMD]
          Length = 249

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           +V+P+G+ EQHGP   + TD +   I A  AE+   IL         P   IG +  H+ 
Sbjct: 21  IVVPIGSNEQHGPTGLLGTDWLCPEIIAREAEKSADIL-------VGPTFNIGMAQHHLG 73

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             GT +L   T+  AI  W   + A    G  KI+ LN HGGN     + S +A   FS 
Sbjct: 74  FPGTISLRPSTFIAAIGDWTRSLVA---HGFEKILFLNGHGGN-----VSSIDA--AFSE 123

Query: 138 LVVSTSWSR 146
           L    S++R
Sbjct: 124 LYAEASFAR 132


>gi|302391723|ref|YP_003827543.1| creatininase [Acetohalobium arabaticum DSM 5501]
 gi|302203800|gb|ADL12478.1| Creatininase [Acetohalobium arabaticum DSM 5501]
          Length = 280

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 96/253 (37%), Gaps = 33/253 (13%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           I +LPLG+ EQHG HLP   DT+    +   +AE   ++L   LP       P      H
Sbjct: 30  IAILPLGSIEQHGHHLPTGHDTLQLFPMLEKVAEETGAML---LPTPWYGAHP----HHH 82

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT  L+     +    ++    K G +K ++   HG     V+  +     +    
Sbjct: 83  WDFPGTIPLSNDTLDKLIKDVVKGASKAGFKKFILFFGHG--QAFVTNYTVNDLGKEGYF 140

Query: 139 VVSTSWSRF--TIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR---Q 193
           V+S  + R    +   I   P      H  E ETS+ LA     V M  A +  +     
Sbjct: 141 VLSVMFQRMIRDVHDDIFETP----FWHADEAETSIALAHFAEYVDMSKAVDMDATSLVD 196

Query: 194 SEFLR------NFKYLRAHGSHSFGWSMKDLNPK-----GVVGNAMDATVKKGEGLLSYF 242
            +F+       + K LR           KDL  +     GVVG    AT +KG+    Y 
Sbjct: 197 GDFVDGCTDYASSKPLRFDSGTVSAPEYKDLTNEDGELIGVVGKPSLATEEKGKEYTDYV 256

Query: 243 ANCFIQLLNDINS 255
               I+L+N I  
Sbjct: 257 VERTIKLVNHIKE 269


>gi|16331810|ref|NP_442538.1| hypothetical protein sll0596 [Synechocystis sp. PCC 6803]
 gi|1001770|dbj|BAA10608.1| sll0596 [Synechocystis sp. PCC 6803]
          Length = 244

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 50/101 (49%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++ P+G+ EQHGP   + TD I    IA G+ E   +++ P + V        G ++ H+
Sbjct: 21  IIFPIGSTEQHGPTGLIGTDAICAEAIAKGVGEATGAMVGPTINV--------GMALHHL 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              G+ +L  +  I+  +  + ++   G  +   +N HGGN
Sbjct: 73  AFPGSISLRPSTLIQVVMDYVSSLANAGFSRFYFINGHGGN 113


>gi|295691400|ref|YP_003595093.1| Creatininase [Caulobacter segnis ATCC 21756]
 gi|295433303|gb|ADG12475.1| Creatininase [Caulobacter segnis ATCC 21756]
          Length = 250

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 54/121 (44%), Gaps = 17/121 (14%)

Query: 24  VVLPLGAYEQHGPHLPMNTD----TIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           VV+P+G+ EQHGP   + TD     IIA    +R   +L         P   IG +  H+
Sbjct: 21  VVVPIGSNEQHGPTGLLGTDWLCPEIIAHEAHKRADKVL-------VAPTFNIGMAQHHL 73

Query: 80  YVDGT---KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
              GT   +  T+  AI  W+  + A    G ++I  LN HGGN   +    +E    +S
Sbjct: 74  AFPGTIFLRPSTFIAAIGDWVRSLGA---HGFKRIYFLNGHGGNVASIEAAFSEIYADYS 130

Query: 137 M 137
            
Sbjct: 131 F 131


>gi|134287762|ref|YP_001109928.1| creatininase [Burkholderia vietnamiensis G4]
 gi|134132412|gb|ABO60147.1| Creatininase [Burkholderia vietnamiensis G4]
          Length = 272

 Score = 46.2 bits (108), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 82/189 (43%), Gaps = 36/189 (19%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG-YS--IEHMY 80
           +++P+G  EQ GP + +         L++RI   L   L    +   P G Y+    HM 
Sbjct: 50  IIIPIGGTEQSGPDVALGKHNARVKVLSQRIAEGLGNALVAPVIAYVPEGGYAPPTSHMR 109

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
             GT T+    + + +E   +  ++ +  G   IV L  HGG          +  +R ++
Sbjct: 110 FPGTITVPDDVFEKTLE---SAANSFKVHGFTNIVFLGDHGGY---------QNDIRRAV 157

Query: 138 LVVSTSWS----RFTIPQGIIS--------------FPETEIGIHGGEIETSMMLALAPH 179
             ++ +W+    R  +P    S              + + EIG H G  +TS++LA+AP 
Sbjct: 158 AQLNKTWAGSGARAFVPPEYYSASSDGYAQILRQHGYRDDEIGTHAGLADTSLLLAVAPQ 217

Query: 180 LVKMDLAEN 188
           +V+++   N
Sbjct: 218 MVRLERLRN 226


>gi|113867739|ref|YP_726228.1| creatinine amidohydrolase [Ralstonia eutropha H16]
 gi|113526515|emb|CAJ92860.1| creatinine amidohydrolase [Ralstonia eutropha H16]
          Length = 249

 Score = 46.2 bits (108), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 63/134 (47%), Gaps = 23/134 (17%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           ++   +V+P+G+ EQHGP   + TD +   I A  +E+   IL         P   IG +
Sbjct: 16  KRSRTIVVPIGSNEQHGPTGLLGTDWLCPEIIARESEKSADIL-------VAPTFNIGMA 68

Query: 76  IEHMYVDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
             H+   GT +L   T+  AI  W     ++   G  KI+ LN HGGN     + S +A 
Sbjct: 69  QHHLGFPGTISLRPSTFIAAIGDW---TRSLVVHGFEKILFLNGHGGN-----VSSIDA- 119

Query: 133 MRFSMLVVSTSWSR 146
             FS L    S++R
Sbjct: 120 -AFSELYAEASFAR 132


>gi|298490737|ref|YP_003720914.1| creatininase ['Nostoc azollae' 0708]
 gi|298232655|gb|ADI63791.1| Creatininase ['Nostoc azollae' 0708]
          Length = 251

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 49/101 (48%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++LP+G+ EQHGP   + TD I    I+ G+ +  ++++ P + V        G ++ H 
Sbjct: 21  IILPIGSTEQHGPTGLIGTDAICAEAISRGVGQATQAMVAPTINV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              GT +L  +  I      I  + K G  K   +N HGGN
Sbjct: 73  AFPGTISLRPSTLILVVRDYITCLAKAGFTKFYFINGHGGN 113


>gi|302539143|ref|ZP_07291485.1| predicted protein [Streptomyces sp. C]
 gi|302448038|gb|EFL19854.1| predicted protein [Streptomyces sp. C]
          Length = 253

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 83/174 (47%), Gaps = 18/174 (10%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL-PVTCMPVEPIGYSIEHM 79
           D  V++P+GA E HGPHLP+ +DT+I+   A R+ + +   + P     V   G  +   
Sbjct: 16  DTHVIIPVGALEPHGPHLPLGSDTMISDHFAHRLAAAVAGHVAPSIGYGVATPGQRLGGT 75

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR-----MR 134
           +  G  ++T A        I+ A+   G R++++LN+   N   ++ +   AR     + 
Sbjct: 76  F-PGVISITGATLTALVTEILTALADHGYRRLILLNSAIDN---IAFLCEAARHLTEHVP 131

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGI------HGGEIETSMMLALAPHLVK 182
            + +++   W    + +   +    E G       H G +E+S+++ ++PH V+
Sbjct: 132 GARVMIVNWWD--VVGEDFRNALAEETGTARADDHHAGMVESSLVMHISPHAVR 183


>gi|282896392|ref|ZP_06304413.1| Creatininase [Raphidiopsis brookii D9]
 gi|281198680|gb|EFA73560.1| Creatininase [Raphidiopsis brookii D9]
          Length = 248

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           +++P+G+ EQHGP   + TD +    I+ G+ E  ++++ P + V        G ++ H 
Sbjct: 21  IIIPIGSTEQHGPTGLIGTDAVCAEFISHGVGEATQAMVGPTINV--------GMALHHT 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              GT +L  +  I      + ++ K G  K   +N HGGN
Sbjct: 73  AFPGTISLRPSTLILVVKDYVSSLAKAGFTKFYFINGHGGN 113


>gi|254517313|ref|ZP_05129370.1| creatininase [gamma proteobacterium NOR5-3]
 gi|219674151|gb|EED30520.1| creatininase [gamma proteobacterium NOR5-3]
          Length = 262

 Score = 45.8 bits (107), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 79/180 (43%), Gaps = 22/180 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL--PVTC-MPVEPIGYSIEHMY 80
           V++P    EQ+GPH+ +          A+ I   L   L  PV   +P   I     HM 
Sbjct: 46  VIIPTAGTEQNGPHVVLGKHKYRMNAGADAIARKLGKTLVAPVIVHVPEGNIDPPSGHML 105

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST---EARMR 134
             GT T+    +   +EH      +++  G +KI+++   GGN   +  V+     A   
Sbjct: 106 FPGTITIPEDVFQSLLEH---TARSLKAHGFKKILLIGDSGGNQAGMKAVANLLNNAWQS 162

Query: 135 FSMLVVSTS-------WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
             + V+  S       +  +   +G   F E++IG+H G  +TS +L +AP  V++D  E
Sbjct: 163 EGITVLHVSAWYDDPGYRNYLASKG---FSESQIGVHAGLHDTSTLLYVAPEYVRVDTME 219


>gi|209967095|ref|YP_002300010.1| creatininase, putative [Rhodospirillum centenum SW]
 gi|209960561|gb|ACJ01198.1| creatininase, putative [Rhodospirillum centenum SW]
          Length = 245

 Score = 45.4 bits (106), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 61/128 (47%), Gaps = 13/128 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM-PVEPIGYSIEHMYVD 82
           +++P+G+ EQHGP   + TD I A  +A ++   +       C+ P   +G +  H+   
Sbjct: 21  IIIPIGSTEQHGPTGLLGTDAITAEAIAWKLGEAVG-----ACVGPTLGVGMAHHHLAFA 75

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT +L  +        ++ ++ + G   ++ +N HGGN   V+       M F  +  ++
Sbjct: 76  GTVSLRPSTLAAVVADVVASLHRHGFTHMLFVNGHGGNVATVN-------MAFQEIAAAS 128

Query: 143 SWSRFTIP 150
           S+   ++P
Sbjct: 129 SFGGGSVP 136


>gi|330992323|ref|ZP_08316271.1| creatininase [Gluconacetobacter sp. SXCC-1]
 gi|329760522|gb|EGG77018.1| creatininase [Gluconacetobacter sp. SXCC-1]
          Length = 272

 Score = 45.4 bits (106), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 75/174 (43%), Gaps = 19/174 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS---IEHMY 80
           +++P+G  EQ GP++ +    + A  LA RI       L    +   P G +     HM 
Sbjct: 49  IIIPVGGTEQSGPYIAVGKHDVRAMILARRIARQAGHALVAPVIAYVPEGGTSPRTSHMR 108

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML-- 138
             GT ++T A          ++ R  G  ++V++  HGG    +  V+     R+  L  
Sbjct: 109 FPGTISITPATFRALLADAAESFRVQGFSRVVLIGDHGGYQKDLRAVADLLNRRWRGLGA 168

Query: 139 ----------VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
                     VV  +++ +    G  +    E+G+H    +TS+MLAL P LV+
Sbjct: 169 HVLYIPAYYDVVPGAYATWLRNHGHAA----EVGMHADLSDTSLMLALDPALVR 218


>gi|163795833|ref|ZP_02189797.1| hypothetical protein BAL199_20505 [alpha proteobacterium BAL199]
 gi|159178866|gb|EDP63402.1| hypothetical protein BAL199_20505 [alpha proteobacterium BAL199]
          Length = 248

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 58/129 (44%), Gaps = 19/129 (14%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM--PVEPIGYSIEHMYV 81
           +++P+G+ EQHGP   + TD I    +AER    L       C+  P   +G +  H+  
Sbjct: 21  IIVPIGSTEQHGPIGLIGTDAICPEVIAERAAETL------NCIIGPTISVGMAQHHLAF 74

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            G+  L  +  I      + ++ + G  +   LN HGGN     I +T+A   FS +   
Sbjct: 75  AGSIALRPSTLILVIRDYVLSLARNGFERFYFLNGHGGN-----IATTQA--AFSEIYAE 127

Query: 142 TS----WSR 146
           TS    W R
Sbjct: 128 TSLNPGWQR 136


>gi|88705774|ref|ZP_01103483.1| Creatininase [Congregibacter litoralis KT71]
 gi|88699845|gb|EAQ96955.1| Creatininase [Congregibacter litoralis KT71]
          Length = 249

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 75/178 (42%), Gaps = 23/178 (12%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           ++LP+G+ EQHGP   + TD I    +AE   +  P    +   P   +G +  H+   G
Sbjct: 19  ILLPIGSMEQHGPTGLIGTDAICPTVIAEAAAAEDP---EILIGPTFSVGCAQHHLGFPG 75

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           + TL   T   AI  W     ++R+ G  +I   N HGGN   ++    E   + S    
Sbjct: 76  SMTLRPSTMIAAIADWST---SLRRHGFERIYWFNGHGGNVATIAAAFAEVYAQRSFAGA 132

Query: 141 STSWSRFTIPQ-------GIIS-----FPETEIGIHGGEIETSMMLALAPHLVK-MDL 185
            +      + Q       G++S      P+ E G H    E ++  A  P  V+ +DL
Sbjct: 133 DSDIPALQMKQRNWWELPGVMSTCRRLHPKNE-GSHATASEVAVTYAAYPEQVRNLDL 189


>gi|261350877|ref|ZP_05976294.1| conserved hypothetical protein [Methanobrevibacter smithii DSM
           2374]
 gi|288860215|gb|EFC92513.1| conserved hypothetical protein [Methanobrevibacter smithii DSM
           2374]
          Length = 230

 Score = 45.1 bits (105), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 76/166 (45%), Gaps = 31/166 (18%)

Query: 19  RKDWIVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           R   I V+ LG++ E HGP LP++TD  I A +A +       +      P     Y ++
Sbjct: 15  RVHKIGVIALGSHLENHGPALPIDTDAKIGAHIAFQASLESGAKFLGIVFPA----YELD 70

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRK-MGIRKIVILNAHGGNSPLVSIV-----STEA 131
              +D    ++  E   + ++ +++ +K + I K+VI+N+HGGN PL++ +      T+ 
Sbjct: 71  E--IDHGVHVSLDELKANVISTLNSAKKYLDIEKVVIVNSHGGNIPLMTELYDIEDKTDL 128

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
            + F+  ++ST                   G HGG  E SM   L 
Sbjct: 129 TIIFNNKIISTE------------------GPHGGSGELSMAKVLG 156


>gi|148642244|ref|YP_001272757.1| creatinine amidohydrolase [Methanobrevibacter smithii ATCC 35061]
 gi|222444583|ref|ZP_03607098.1| hypothetical protein METSMIALI_00195 [Methanobrevibacter smithii
           DSM 2375]
 gi|327507637|sp|A5UJL1|ARFB_METS3 RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|148551261|gb|ABQ86389.1| creatinine amidohydrolase [Methanobrevibacter smithii ATCC 35061]
 gi|222434148|gb|EEE41313.1| hypothetical protein METSMIALI_00195 [Methanobrevibacter smithii
           DSM 2375]
          Length = 230

 Score = 45.1 bits (105), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 76/166 (45%), Gaps = 31/166 (18%)

Query: 19  RKDWIVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           R   I V+ LG++ E HGP LP++TD  I A +A +       +      P     Y ++
Sbjct: 15  RVHKIGVIALGSHLENHGPALPIDTDAKIGAHIAFQASLESGAKFLGIVFPA----YELD 70

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRK-MGIRKIVILNAHGGNSPLVSIV-----STEA 131
              +D    ++  E   + ++ +++ +K + I K+VI+N+HGGN PL++ +      T+ 
Sbjct: 71  E--IDHGVHVSLDELKANVISTLNSAKKYLDIEKVVIVNSHGGNIPLMTELYDIEDKTDL 128

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
            + F+  ++ST                   G HGG  E SM   L 
Sbjct: 129 TIIFNNKIISTE------------------GPHGGSGELSMAKVLG 156


>gi|110634703|ref|YP_674911.1| hypothetical protein Meso_2360 [Mesorhizobium sp. BNC1]
 gi|110285687|gb|ABG63746.1| Uncharacterized protein putative amidase-like protein
           [Chelativorans sp. BNC1]
          Length = 254

 Score = 45.1 bits (105), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 5/117 (4%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           ++++PLG+ E  GP  PM  D ++   LA  + S    R      P  P G++     V 
Sbjct: 1   MIIIPLGSQETQGPCNPMG-DFMLVRRLANEVAS----RTGCLVAPTVPFGFADCFSTVP 55

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
           G   ++    +     ++ +    G+R++VI+N H GNS L+ +     R     LV
Sbjct: 56  GGIQVSPETFMSLVRDVLLSFLNHGLRRLVIMNGHTGNSALIDLTVRRLRQERGALV 112


>gi|296108979|ref|YP_003615928.1| Creatininase [Methanocaldococcus infernus ME]
 gi|327507632|sp|D5VQW1|ARFB_METIM RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|295433793|gb|ADG12964.1| Creatininase [Methanocaldococcus infernus ME]
          Length = 222

 Score = 44.7 bits (104), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 55/101 (54%), Gaps = 11/101 (10%)

Query: 23  IVVLPLGAY-EQHGPHLPMNTDTIIAA--GLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           I V+ +G+Y E HG  LP++TD  IA+   L   IK+    +   T +P      S E+ 
Sbjct: 19  IGVIAMGSYLENHGSALPIDTDIKIASYVSLMACIKT--GAKFLGTVIP------STEYS 70

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           YV        ++ +E+   ++   +++GI+K++I+N HGGN
Sbjct: 71  YVKHGIHNKVSDIVEYLTFLLTWAKRIGIKKVIIVNCHGGN 111


>gi|158336441|ref|YP_001517615.1| creatininase [Acaryochloris marina MBIC11017]
 gi|158306682|gb|ABW28299.1| creatininase [Acaryochloris marina MBIC11017]
          Length = 255

 Score = 44.7 bits (104), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 53/106 (50%), Gaps = 12/106 (11%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGY 74
           ++   +++P+G+ EQHGP   + TD I    IA G+ E  ++++ P + V        G 
Sbjct: 23  QRSQGIIMPIGSTEQHGPTGLIGTDAICAEVIAKGVGEATEALVGPTINV--------GM 74

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           ++ H    G+ +L  +  +      + ++ + G R+   +N HGGN
Sbjct: 75  ALHHTEFPGSMSLRPSTLLLVIRDYLVSLARAGFRQFFFINGHGGN 120


>gi|327310581|ref|YP_004337478.1| Creatininase [Thermoproteus uzoniensis 768-20]
 gi|326947060|gb|AEA12166.1| Creatininase [Thermoproteus uzoniensis 768-20]
          Length = 211

 Score = 44.7 bits (104), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 35/63 (55%), Gaps = 6/63 (9%)

Query: 25 VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
          +LP+G+YEQHGP LP   DT IA  +A R+   L  R+      +EPI Y+    + D  
Sbjct: 1  MLPVGSYEQHGPFLPPTVDTEIAIYVARRLAERLGARV------LEPIWYTCSKEHQDFP 54

Query: 85 KTL 87
           T+
Sbjct: 55 PTI 57


>gi|197106872|ref|YP_002132249.1| creatinine amidohydrolase [Phenylobacterium zucineum HLK1]
 gi|196480292|gb|ACG79820.1| creatinine amidohydrolase [Phenylobacterium zucineum HLK1]
          Length = 249

 Score = 44.7 bits (104), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 51/113 (45%), Gaps = 16/113 (14%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI---IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
           VV+P+G+ EQHGP   + TD +   I A  AE+   IL         P   IG +  H+ 
Sbjct: 21  VVIPIGSNEQHGPTGLLGTDWLCPEIIAHEAEKQGDIL-------VAPTFNIGMAQHHLD 73

Query: 81  VDGTKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
             GT  L   T+  AI  W     ++   G  K+  LN HGGN   +    +E
Sbjct: 74  FPGTIALRPSTFMLAIGDW---CRSLGHAGFEKLYFLNGHGGNVATIEAAFSE 123


>gi|16127808|ref|NP_422372.1| hypothetical protein CC_3578 [Caulobacter crescentus CB15]
 gi|221236629|ref|YP_002519066.1| creatinine amidohydrolase family protein [Caulobacter crescentus
           NA1000]
 gi|13425320|gb|AAK25540.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220965802|gb|ACL97158.1| creatinine amidohydrolase family protein [Caulobacter crescentus
           NA1000]
          Length = 251

 Score = 44.7 bits (104), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 53/121 (43%), Gaps = 16/121 (13%)

Query: 24  VVLPLGAYEQHGPHLPMNTD----TIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           VV+P+G+ EQHGP   + TD     IIA   ++R          V   P   IG +  H+
Sbjct: 21  VVVPIGSNEQHGPTGLLGTDWLCPEIIAHEASKRASD------KVLVAPTFNIGMAQHHL 74

Query: 80  YVDGT---KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
              GT   +  T+  AI  W+  + A    G  +I  LN HGGN   +    +E    +S
Sbjct: 75  AFPGTIFLRPSTFIAAIGDWVRSLGA---HGFTRIYFLNGHGGNVASIEAAFSEIYADYS 131

Query: 137 M 137
            
Sbjct: 132 F 132


>gi|167644085|ref|YP_001681748.1| creatininase [Caulobacter sp. K31]
 gi|167346515|gb|ABZ69250.1| Creatininase [Caulobacter sp. K31]
          Length = 249

 Score = 44.3 bits (103), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 53/119 (44%), Gaps = 13/119 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM--PVEPIGYSIEHMYV 81
           VV+P+G+ EQHGP   + TD      L   I S    +L  T +  P   +G +  H+  
Sbjct: 21  VVVPIGSNEQHGPTGLLGTDW-----LCPEIISHEASKLSDTVLVAPTFNVGMAQHHLAF 75

Query: 82  DGT---KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
            GT   +  T+  AI  W+  + A    G  KI  LN HGGN   +    +E    +S 
Sbjct: 76  PGTIFLRPSTFIAAIGDWVRSLGA---HGFEKIYFLNGHGGNVASIEAAFSEIYADYSF 131


>gi|300712869|ref|YP_003738681.1| Creatininase [Halalkalicoccus jeotgali B3]
 gi|299126553|gb|ADJ16890.1| Creatininase [Halalkalicoccus jeotgali B3]
          Length = 252

 Score = 44.3 bits (103), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 72/174 (41%), Gaps = 16/174 (9%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++P G+ EQHGPHL +  D   A  +   +   L   L     PV   G S  HM   G
Sbjct: 27  ILVPAGSVEQHGPHLGILKDAAWAEAMGVELAKELGDTL---VAPVIRPGCSDHHMGFSG 83

Query: 84  T---KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           T   +  T    +E +   +D+    G   IV+ + HGGN P ++ +           ++
Sbjct: 84  TISYRPETLMRVLEDYCRSLDS---HGFEHIVLFSLHGGNFPAMNAILPSIADEVDAQII 140

Query: 141 STSWSRFTIPQGIISFPETEIGI----HGGEIETSMMLALAPHLVKMDLAENFS 190
           +       I   + S  + EI      HGG   T+ +  L P LV   L E F+
Sbjct: 141 TLLDKELLIDPLMESLAQMEIPSEARGHGGAAVTASVWYLRPDLV---LEEEFT 191


>gi|254421441|ref|ZP_05035159.1| creatininase subfamily [Synechococcus sp. PCC 7335]
 gi|196188930|gb|EDX83894.1| creatininase subfamily [Synechococcus sp. PCC 7335]
          Length = 249

 Score = 44.3 bits (103), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++ P+G+ EQHGP   + TD I    +A G+ E   +++ P + V        G ++ H+
Sbjct: 21  IIFPIGSTEQHGPTGLIGTDAICAEAVAKGVGEATGALVGPTINV--------GMALHHL 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              G+ +L  +  I      +  + + G  +   +N HGGN
Sbjct: 73  AFPGSVSLRPSTLIALIQDYVKPLARHGFERFYFVNGHGGN 113


>gi|22298935|ref|NP_682182.1| hypothetical protein tlr1392 [Thermosynechococcus elongatus BP-1]
 gi|22295116|dbj|BAC08944.1| tlr1392 [Thermosynechococcus elongatus BP-1]
          Length = 249

 Score = 43.9 bits (102), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 10/100 (10%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++P+G+ EQHGP   M TD + A  +A+ +  I          P   +G ++ H    G
Sbjct: 22  MIIPIGSTEQHGPMGLMGTDALCAEAIAKGVGEI----TQALVGPTISVGMALHHTAFPG 77

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           T +L   T    I  +L    ++ + G ++   +N HGGN
Sbjct: 78  TISLRPSTLMLVIRDYLV---SLVRAGFQRFFFINGHGGN 114


>gi|167768936|ref|ZP_02440989.1| hypothetical protein ANACOL_00253 [Anaerotruncus colihominis DSM
           17241]
 gi|167668576|gb|EDS12706.1| hypothetical protein ANACOL_00253 [Anaerotruncus colihominis DSM
           17241]
          Length = 280

 Score = 43.9 bits (102), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 81/182 (44%), Gaps = 29/182 (15%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKS-ILPPRLPVTCMPVEP-----I 72
           +V  P+G+ E HGPH+ M  DTI    +A   A R    ++PP    T  P  P     +
Sbjct: 37  LVYQPVGSMEWHGPHMGMGMDTINAHAVALEAARRTGGVVMPPLYIGTETPRSPETLRKL 96

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHW-----LAII----DAIRKMGIRKIVILNAHGGNSPL 123
           G+S +   V G      + A  +W      AII      + +MG  ++V+LN HG ++  
Sbjct: 97  GFSGDERVV-GMDFPQNSVASFYWPPDLFEAIIRRQTQMLLEMGFSQVVLLNGHGADA-Q 154

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI-HGGEIETSMMLALAPHLVK 182
           V I+   +R     L V +     TI   +  F     G+ H G  ET++   L P  V+
Sbjct: 155 VEILERVSR----ELSVQSGRCVMTI---MALFDGCGAGLGHAGLAETAIFAHLCPEAVE 207

Query: 183 MD 184
           +D
Sbjct: 208 LD 209


>gi|291548841|emb|CBL25103.1| Uncharacterized protein, putative amidase [Ruminococcus torques
           L2-14]
          Length = 247

 Score = 43.5 bits (101), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 89/193 (46%), Gaps = 35/193 (18%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGL----AERIKSILPPRLPVTCMPVEPI----GY 74
           +  LPLG  E HGPH+P+  D I +  L    AE++  ++   LP+  M  + +    G 
Sbjct: 23  VAYLPLGTLEWHGPHMPLGADGIQSKELFVRVAEKVGGVV---LPMLFMGPDRVFYDRGT 79

Query: 75  SIEHMYVDGTKTL-TYA----EAIEHWL----------AIIDAIRKMGIRKIVILNAHGG 119
           +   M ++    L TY     +   +W+          +I   + + GIR IV+ + HG 
Sbjct: 80  AFYGMDINTEGALNTYCVQQMKGSAYWMEKGQFQDNLRSIFAQLSRAGIR-IVVGHGHGP 138

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           ++     +  EA  ++ + ++ T+W+ F     +    +     H G  ETS+++A+ P 
Sbjct: 139 STNAFQELKEEAAEKYGLRIL-TAWT-FADDDRLKYQND-----HAGANETSIVMAVRPE 191

Query: 180 LVKM-DLAENFSS 191
           LV    + EN S+
Sbjct: 192 LVDFGQVKENESN 204


>gi|145591563|ref|YP_001153565.1| creatininase [Pyrobaculum arsenaticum DSM 13514]
 gi|145283331|gb|ABP50913.1| Creatininase [Pyrobaculum arsenaticum DSM 13514]
          Length = 212

 Score = 43.5 bits (101), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 8/67 (11%)

Query: 23 IVVLPLGAYEQHGPHLPMNTDTIIAAGLA-ERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
          + +LP+G+YEQHGPH+P   D  +A  +A E +K +    LP       PI Y+    + 
Sbjct: 5  LCILPVGSYEQHGPHMPPTVDAEVAQFVAREVVKKVGGSELP-------PIYYTCSEEHR 57

Query: 82 DGTKTLT 88
          D  +T++
Sbjct: 58 DFPQTIS 64


>gi|271966106|ref|YP_003340302.1| hypothetical protein Sros_4714 [Streptosporangium roseum DSM 43021]
 gi|270509281|gb|ACZ87559.1| Uncharacterized protein putative amidase-like protein
           [Streptosporangium roseum DSM 43021]
          Length = 265

 Score = 43.5 bits (101), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 89/219 (40%), Gaps = 41/219 (18%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V+LPLG  E HGPHLP+ TD   +  L +  +  L  R  V  +   P  + I   +V G
Sbjct: 28  VLLPLGVIEAHGPHLPLGTDVYGSYLLCKLTRRRLAER-GVESLIAPPYYWGIN--FVTG 84

Query: 84  TKTLTY---AEAIEHWLA-IIDAIRKMGIRKIVILNAHG------------------GNS 121
               ++    E  E  L+ I+D I   G  ++ ++N  G                  G++
Sbjct: 85  AFPGSFRVRREIAEGLLSDILDTILGTGFTRVFLVNHQGDIRHKQMVADVVRSKNADGHT 144

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            +  +    +  R         W  +  P+      +T    HGGE ET+++    P LV
Sbjct: 145 GVQWLDDGSSLARLEQTGDEPMWRLYDPPERWRGGLKT----HGGETETALVGRYFPELV 200

Query: 182 KMDLAE-----NFSSRQ-SEFLRNFKY------LRAHGS 208
             D  E     N S+R+ +E+ R  ++      L  HGS
Sbjct: 201 NWDEQEHLAPANLSARELAEWRRGEEHAPKVTPLAYHGS 239


>gi|261402903|ref|YP_003247127.1| Creatininase [Methanocaldococcus vulcanius M7]
 gi|327507640|sp|C9RGE3|ARFB_METVM RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|261369896|gb|ACX72645.1| Creatininase [Methanocaldococcus vulcanius M7]
          Length = 226

 Score = 42.7 bits (99), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 51/97 (52%), Gaps = 7/97 (7%)

Query: 25  VLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V+ LG++ E HG  LP++TD  IA+ +A     +   +     +P      S E+ YV  
Sbjct: 21  VIALGSFLENHGAVLPIDTDIKIASYIALNASILTGAKFLGVVIP------STEYEYVKH 74

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
                  E +++   +I+  +K+G+ +I+I+N HGGN
Sbjct: 75  GIHNKVDEILDYLRFMINWGKKIGVEEIIIVNCHGGN 111


>gi|15668287|ref|NP_247080.1| hypothetical protein MJ_0116 [Methanocaldococcus jannaschii DSM
           2661]
 gi|2495807|sp|Q57580|ARFB_METJA RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|1498883|gb|AAB98097.1| conserved hypothetical protein [Methanocaldococcus jannaschii DSM
           2661]
          Length = 225

 Score = 42.7 bits (99), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 7/97 (7%)

Query: 25  VLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           ++ LG++ E HG  LP++TD  IA+ +A +   +   +     +P      S E+ YV  
Sbjct: 20  IIALGSFLENHGAVLPIDTDIKIASYIALKASILTGAKFLGVVIP------STEYEYVKH 73

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
                  E   +   +I+  +K+G+ K +I+N HGGN
Sbjct: 74  GIHNKPEEVYSYMRFLINEGKKIGVEKFLIVNCHGGN 110


>gi|126459737|ref|YP_001056015.1| creatininase [Pyrobaculum calidifontis JCM 11548]
 gi|126249458|gb|ABO08549.1| Creatininase [Pyrobaculum calidifontis JCM 11548]
          Length = 213

 Score = 42.4 bits (98), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 25/35 (71%)

Query: 23 IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
          + +LP+G+YEQHGPHLP   D  +A  +A+R+  +
Sbjct: 2  LCLLPVGSYEQHGPHLPPTVDAEVALYVAKRLAEV 36


>gi|320160479|ref|YP_004173703.1| putative creatinine amidohydrolase [Anaerolinea thermophila UNI-1]
 gi|319994332|dbj|BAJ63103.1| putative creatinine amidohydrolase [Anaerolinea thermophila UNI-1]
          Length = 226

 Score = 42.4 bits (98), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 9/113 (7%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           N + + A  ++D  ++L LG  EQHG +L + TD  I   LA+        +  V   P 
Sbjct: 7   NWMDVEAYLQQDDRLILVLGTIEQHG-YLSLATDVRIPLALADAASQ----KTGVLVAP- 60

Query: 70  EPIGYSIEHMYVD--GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            P+ Y +   ++   GT +L  +  ++    ++ +    G R+I++LN HGGN
Sbjct: 61  -PVNYGVSPYFLTYPGTFSLRLSTFLDTVEDLVRSAYAQGFRRILVLNGHGGN 112


>gi|254514920|ref|ZP_05126981.1| creatininase [gamma proteobacterium NOR5-3]
 gi|219677163|gb|EED33528.1| creatininase [gamma proteobacterium NOR5-3]
          Length = 249

 Score = 42.4 bits (98), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 9/117 (7%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           ++LP+G+ EQHGP   + TD I    +AE   +       +   P   +G +  H+   G
Sbjct: 21  ILLPIGSMEQHGPTGLIGTDAICPQVIAEAAAADD---PDILVGPTFSVGCAQHHLGFAG 77

Query: 84  TKTL---TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           + TL   T    I  W A   ++R+ G  +I  +N HGGN   ++    E     S+
Sbjct: 78  SMTLRPSTMIAVIADWCA---SLRRHGFERIYWINGHGGNIATIAAAFAEVYAERSL 131


>gi|289192464|ref|YP_003458405.1| Creatininase [Methanocaldococcus sp. FS406-22]
 gi|288938914|gb|ADC69669.1| Creatininase [Methanocaldococcus sp. FS406-22]
          Length = 231

 Score = 42.4 bits (98), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 23  IVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           I ++ LG++ E HG  LP++TD  IA+ +A +   +   +     +P      S E+ YV
Sbjct: 24  IGIIALGSFLENHGAVLPIDTDIKIASYIALKASILTGAKFLGVVIP------STEYEYV 77

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
                    +   +   +I+  +K+GI K +I+N HGGN
Sbjct: 78  KHGIHNKPEDVYSYLRFLINEGKKIGIEKFLIVNCHGGN 116


>gi|327507750|sp|D3S4A5|ARFB_METSF RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
          Length = 225

 Score = 42.0 bits (97), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 23  IVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           I ++ LG++ E HG  LP++TD  IA+ +A +   +   +     +P      S E+ YV
Sbjct: 18  IGIIALGSFLENHGAVLPIDTDIKIASYIALKASILTGAKFLGVVIP------STEYEYV 71

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
                    +   +   +I+  +K+GI K +I+N HGGN
Sbjct: 72  KHGIHNKPEDVYSYLRFLINEGKKIGIEKFLIVNCHGGN 110


>gi|256810769|ref|YP_003128138.1| Creatininase [Methanocaldococcus fervens AG86]
 gi|327507630|sp|C7P7V6|ARFB_METFA RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|256793969|gb|ACV24638.1| Creatininase [Methanocaldococcus fervens AG86]
          Length = 225

 Score = 42.0 bits (97), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 55/106 (51%), Gaps = 9/106 (8%)

Query: 17  DARKDWIVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           D +   + ++ LG++ E HG  LP++TD  IA+ +A +   +   +     +P      S
Sbjct: 12  DEKVHKVGIIALGSFLENHGAVLPIDTDIKIASYIALKAAILTGAKFLGVVIP------S 65

Query: 76  IEHMYVDGTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAHGGN 120
            E+ YV         E I ++L  +I+  +K+G+ K +I+N HGGN
Sbjct: 66  TEYEYVKHG-IHNKPEDIYYYLRFLINEGKKIGVEKFLIVNCHGGN 110


>gi|288560539|ref|YP_003424025.1| creatinine amidohydrolase ArfB [Methanobrevibacter ruminantium M1]
 gi|327507636|sp|D3E3M2|ARFB_METRM RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|288543249|gb|ADC47133.1| creatinine amidohydrolase ArfB [Methanobrevibacter ruminantium M1]
          Length = 234

 Score = 41.6 bits (96), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 75/157 (47%), Gaps = 21/157 (13%)

Query: 23  IVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           I ++ LG++ E HGP LP++TD  IA+ +A +       +      P   +   I H   
Sbjct: 19  IGIIALGSHLENHGPALPIDTDAKIASHIAFQASLESGAKFLGVIYPAHEL-KEINHGIH 77

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRK-MGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
              + LT     +  + ++ + +K + I  ++I+N HGGN P+V+ +  +   R  +L+ 
Sbjct: 78  VSLEDLT-----DEIVKVLKSAKKFLRISSVIIVNGHGGNLPIVTTL-YDIEERTGLLI- 130

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
                  T+   II   E+E G HGG  E SM  AL 
Sbjct: 131 -------TLNSKII---ESE-GPHGGSGELSMAKALG 156


>gi|225570205|ref|ZP_03779230.1| hypothetical protein CLOHYLEM_06301 [Clostridium hylemonae DSM
           15053]
 gi|225161000|gb|EEG73619.1| hypothetical protein CLOHYLEM_06301 [Clostridium hylemonae DSM
           15053]
          Length = 339

 Score = 41.2 bits (95), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 53/255 (20%), Positives = 99/255 (38%), Gaps = 24/255 (9%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS--- 75
           +K+ +V++P+G  E HG H     DT     + E ++           +   P+ Y    
Sbjct: 42  KKNDVVLVPVGCTECHGMHTVSALDTFQCQSIVEGVRRATAKDGREVSLAYNPLPYGAHP 101

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL-VSIVSTEARMR 134
             H+ + GT  +    A+E  +A +  +   G RK + +N HG    L  ++     R +
Sbjct: 102 YHHLGMPGTVMVPQRVAVEVLVATMLGLWNDGFRKQIYINNHGQLWVLETALHEFLYRYQ 161

Query: 135 FSMLVVSTSWSR----FTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
              ++    W R    F  P       +T   +H  E ETS+ +   P  + +DL+    
Sbjct: 162 LPCIIQVMDWHRAIREFFYPGAKEDMVKTPF-VHADECETSVGMLCFPEGM-VDLSHADE 219

Query: 191 SRQSEFLRNFKYLRAHGS--HSFGWSMKDL--------NPKGVVGNAMDATVKKGE---- 236
           +    +    ++  +  S      WS  ++         P+GVVG+   A  +K +    
Sbjct: 220 THPKSYFEPGRFDNSTDSFHRPQRWSETEMTSPITYKGTPEGVVGSPAIAEARKAKRPIL 279

Query: 237 GLLSYFANCFIQLLN 251
               Y   C  ++L+
Sbjct: 280 AACEYLTFCVDEILD 294


>gi|86261641|emb|CAI47654.1| putative amidohydrolase [Streptoalloteichus hindustanus]
          Length = 272

 Score = 40.4 bits (93), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 73/177 (41%), Gaps = 31/177 (17%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           +  +P+G+ E H  H+P   DT  A  + ER       R     +P  P G+ ++  +  
Sbjct: 38  VAYVPVGSLEWHSAHMPYGVDTDKATAICERAAR----RHGGIVLPGSPWGF-MQGNWRG 92

Query: 83  GTKTLTYAEAI-EHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            T      E I + +  I+  +  +G R  V+++ H      + I     R+R       
Sbjct: 93  ATHPGLRVETIFQLYTDILRGLSTVGFRAAVVVSGHWTTKQTIPIACALERVRNE----- 147

Query: 142 TSWSRFTIPQGIISF----------PETEIGI-HGGEIETSMMLALAP---HLVKMD 184
                 T  +G+++F          PE  + + H G +ETS+  AL P   HL ++D
Sbjct: 148 ------TGLRGMVTFDGSDDDCGFDPELHLDMDHAGALETSVYGALFPENVHLERLD 198


>gi|319400350|gb|EFV88585.1| protein essB [Staphylococcus epidermidis FRI909]
          Length = 441

 Score = 40.0 bits (92), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 62/143 (43%), Gaps = 14/143 (9%)

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGE-IETSMMLALAPHLVKMDLAENFSS 191
           +R+  L+++     F       +  E  + +H G   E  ++ +     +K  L E ++ 
Sbjct: 149 LRYKSLIITA----FNQKVNFDALVEGNLELHKGTPFENKIIQSKNLSELKQFLTEQYNK 204

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNA---------MDATVKKGEGLLSYF 242
           +QS++ +NF Y+R    ++F W    ++  GV+  A         M+   +  +G  SY 
Sbjct: 205 QQSDYTQNFSYVRKRKYNTFKWLGIAMSIIGVLLIACLAYLYFFVMNNEEQVEKGYQSYV 264

Query: 243 ANCFIQLLNDINSFDVSIFDKDV 265
              + Q+LND    D    DK+ 
Sbjct: 265 KADYTQVLNDYKDLDGKNLDKEA 287


>gi|84489969|ref|YP_448201.1| creatinine amidohydrolase [Methanosphaera stadtmanae DSM 3091]
 gi|121695224|sp|Q2NF45|ARFB_METST RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|84373288|gb|ABC57558.1| predicted creatinine amidohydrolase [Methanosphaera stadtmanae DSM
           3091]
          Length = 233

 Score = 40.0 bits (92), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 67/129 (51%), Gaps = 14/129 (10%)

Query: 23  IVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
           I ++ LG++ E HG  LP++TD+ IAA +A  + +    +   T + +     + E+ Y+
Sbjct: 23  IGIIALGSHRENHGAALPIDTDSKIAANVALNVAT----KTGATFLGI--FYGATEYDYI 76

Query: 82  DGTKTLTYAEAIEHWL--AIIDAIRKMGIRKIVILNAHGGNSPLVSIV-----STEARMR 134
                L   + +   +   +I+  +++ I+ ++I+N HGGN+ ++  +      TE ++ 
Sbjct: 77  KHGHHLKKDDLVNKQIIPQLINIKKQLNIKSVIIVNGHGGNNLIIEDIDKISKKTELKII 136

Query: 135 FSMLVVSTS 143
           F+  ++ + 
Sbjct: 137 FNNSIIESE 145


>gi|318078915|ref|ZP_07986247.1| hypothetical protein SSA3_19930 [Streptomyces sp. SA3_actF]
          Length = 167

 Score = 39.7 bits (91), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 99  IIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPE 158
           I+D++   G R+++++N HGGN  ++ +      +R  +   + S+              
Sbjct: 5   ILDSLAATGHRRVLVVNGHGGNDEIMRLAVKRFALRAEVTAAACSYWSLGEAAADAEHAA 64

Query: 159 TEIGIHGGEIETSMMLALAPHLVK 182
              G H G  ETS+MLA  P LV+
Sbjct: 65  LVPG-HAGWYETSLMLAAHPGLVR 87


>gi|146319524|ref|YP_001199236.1| D-alanyl-D-alanine carboxypeptidase [Streptococcus suis 05ZYH33]
 gi|145690330|gb|ABP90836.1| D-alanyl-D-alanine carboxypeptidase [Streptococcus suis 05ZYH33]
          Length = 415

 Score = 39.7 bits (91), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 67/143 (46%), Gaps = 22/143 (15%)

Query: 50  LAERIKSILPPRLPVTCMPVEPIG----YSIEHMYVDGT---------KTLTYAEAIEHW 96
           +A R+    P  L +T +     G    YS   M  DGT         KT T   A   +
Sbjct: 194 IARRLILDYPQVLDITSLNAYDFGGYTYYSTNQMLSDGTHARGGVDGLKTGTSNSAGSSF 253

Query: 97  LAIIDAIRKMGIRKI-VILNAHGG-NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGII 154
           LA     ++ G+R I V+LNA+ G  SP    V+T   M +    V +++S  T+ +   
Sbjct: 254 LA---TTQQAGMRIITVVLNANDGLTSPENRFVATNDLMNY----VYSNFSLVTLVKKSE 306

Query: 155 SFPETEIGIHGGEIETSMMLALA 177
           +F +++I +  GE ETS ++A A
Sbjct: 307 AFGDSKIKVFNGEKETSPVVAAA 329


>gi|253752532|ref|YP_003025673.1| D-alanyl-D-alanine carboxypeptidase [Streptococcus suis SC84]
 gi|253754358|ref|YP_003027499.1| D-alanyl-D-alanine carboxypeptidase [Streptococcus suis P1/7]
 gi|251816821|emb|CAZ52465.1| putative D-alanyl-D-alanine carboxypeptidase [Streptococcus suis
           SC84]
 gi|251820604|emb|CAR47361.1| putative D-alanyl-D-alanine carboxypeptidase [Streptococcus suis
           P1/7]
 gi|319758942|gb|ADV70884.1| D-alanyl-D-alanine carboxypeptidase [Streptococcus suis JS14]
          Length = 413

 Score = 39.7 bits (91), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 67/143 (46%), Gaps = 22/143 (15%)

Query: 50  LAERIKSILPPRLPVTCMPVEPIG----YSIEHMYVDGT---------KTLTYAEAIEHW 96
           +A R+    P  L +T +     G    YS   M  DGT         KT T   A   +
Sbjct: 192 IARRLILDYPQVLDITSLNAYDFGGYTYYSTNQMLSDGTHARGGVDGLKTGTSNSAGSSF 251

Query: 97  LAIIDAIRKMGIRKI-VILNAHGG-NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGII 154
           LA     ++ G+R I V+LNA+ G  SP    V+T   M +    V +++S  T+ +   
Sbjct: 252 LA---TTQQAGMRIITVVLNANDGLTSPENRFVATNDLMNY----VYSNFSLVTLVKKSE 304

Query: 155 SFPETEIGIHGGEIETSMMLALA 177
           +F +++I +  GE ETS ++A A
Sbjct: 305 AFGDSKIKVFNGEKETSPVVAAA 327


>gi|146321721|ref|YP_001201432.1| D-alanyl-D-alanine carboxypeptidase [Streptococcus suis 98HAH33]
 gi|145692527|gb|ABP93032.1| D-alanyl-D-alanine carboxypeptidase [Streptococcus suis 98HAH33]
 gi|292559140|gb|ADE32141.1| Serine-type D-Ala-D-Ala carboxypeptidase [Streptococcus suis GZ1]
          Length = 415

 Score = 39.7 bits (91), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 67/143 (46%), Gaps = 22/143 (15%)

Query: 50  LAERIKSILPPRLPVTCMPVEPIG----YSIEHMYVDGT---------KTLTYAEAIEHW 96
           +A R+    P  L +T +     G    YS   M  DGT         KT T   A   +
Sbjct: 194 IARRLILDYPQVLDITSLNAYDFGGYTYYSTNQMLSDGTHARGGVDGLKTGTSNSAGSSF 253

Query: 97  LAIIDAIRKMGIRKI-VILNAHGG-NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGII 154
           LA     ++ G+R I V+LNA+ G  SP    V+T   M +    V +++S  T+ +   
Sbjct: 254 LA---TTQQAGMRIITVVLNANDGLTSPENRFVATNDLMNY----VYSNFSLVTLVKKSE 306

Query: 155 SFPETEIGIHGGEIETSMMLALA 177
           +F +++I +  GE ETS ++A A
Sbjct: 307 AFGDSKIKVFNGEKETSPVVAAA 329


>gi|253756292|ref|YP_003029432.1| D-alanyl-D-alanine carboxypeptidase [Streptococcus suis BM407]
 gi|251818756|emb|CAZ56593.1| putative D-alanyl-D-alanine carboxypeptidase [Streptococcus suis
           BM407]
          Length = 413

 Score = 39.7 bits (91), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 67/143 (46%), Gaps = 22/143 (15%)

Query: 50  LAERIKSILPPRLPVTCMPVEPIG----YSIEHMYVDGT---------KTLTYAEAIEHW 96
           +A R+    P  L +T +     G    YS   M  DGT         KT T   A   +
Sbjct: 192 IARRLILDYPQVLDITSLNAYDFGGYTYYSTNQMLSDGTHARGGVDGLKTGTSNSAGSSF 251

Query: 97  LAIIDAIRKMGIRKI-VILNAHGG-NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGII 154
           LA     ++ G+R I V+LNA+ G  SP    V+T   M +    V +++S  T+ +   
Sbjct: 252 LA---TTQQAGMRIITVVLNANDGLTSPENRFVATNDLMNY----VYSNFSLVTLVKKSE 304

Query: 155 SFPETEIGIHGGEIETSMMLALA 177
           +F +++I +  GE ETS ++A A
Sbjct: 305 AFGDSKIKVFNGEKETSPVVAAA 327


>gi|297619846|ref|YP_003707951.1| Creatininase [Methanococcus voltae A3]
 gi|327507639|sp|D7DV18|ARFB_METV3 RecName: Full=2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-
           one 5'-monophosphate deformylase; Short=FAPy
           deformylase; AltName: Full=Formamide hydrolase
 gi|297378823|gb|ADI36978.1| Creatininase [Methanococcus voltae A3]
          Length = 260

 Score = 39.7 bits (91), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 54/108 (50%), Gaps = 7/108 (6%)

Query: 17  DARKDWIVVLPLGAY-EQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           D++   I V+ +G+Y E HG  LP++TD  IA+ +A      L   L      +  +  +
Sbjct: 17  DSKVHEIGVIAMGSYLENHGSALPIDTDIKIASYVA------LNVALTTGAKFLGTVCTA 70

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
            E+ Y+      +  + +E    II    K+G+ K +I+N HGGNS +
Sbjct: 71  TEYDYIKHGIHNSLEDILEELEEIIIKYSKIGVNKFLIINCHGGNSDV 118


>gi|328544746|ref|YP_004304855.1| Creatininase [polymorphum gilvum SL003B-26A1]
 gi|326414488|gb|ADZ71551.1| Creatininase [Polymorphum gilvum SL003B-26A1]
          Length = 272

 Score = 39.7 bits (91), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 85/232 (36%), Gaps = 31/232 (13%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           AR     +LP+G  E HGPHLP  TD   A  L +  +      L   C+   P  + I 
Sbjct: 23  ARSGAAALLPVGVIECHGPHLPTGTDAYTALKLCQLTRRYA-AELGRRCVIAPPYYWGIN 81

Query: 78  HMYVD--GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG--NSPLVSIVSTE--- 130
            +  +  G+  +    A      +I ++     + ++I++ HG   ++ ++  V TE   
Sbjct: 82  GILNEFPGSFRIRAETAAALLSDVIGSLFANAFQDVLIVSHHGDRLHNEMIRDVLTELHV 141

Query: 131 -ARMRFSMLVVSTSWSRFT-----------IP----QGIISFPETEI-GIHGGEIETSMM 173
               R   L     W  F            +P      +  F  T I G+H  E ET+ M
Sbjct: 142 QGHTRARWLYAPFRWRMFERLGMSGEEPIWVPWAPTPALDDFKVTGILGVHADEYETAAM 201

Query: 174 LALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG 225
           +   P  V  D        +   L + +  R  G  +     K L P G  G
Sbjct: 202 VRFFPDTVDYDALRGLPPTRLT-LEDLQDWRKGGEDA-----KRLTPDGYFG 247


>gi|302024467|ref|ZP_07249678.1| D-alanyl-D-alanine carboxypeptidase [Streptococcus suis 05HAS68]
          Length = 402

 Score = 39.7 bits (91), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 67/143 (46%), Gaps = 22/143 (15%)

Query: 50  LAERIKSILPPRLPVTCMPVEPIG----YSIEHMYVDGT---------KTLTYAEAIEHW 96
           +A R+    P  L +T +     G    YS   M  DGT         KT T   A   +
Sbjct: 181 IARRLILDYPQVLDITSLNAYDFGGYTYYSTNQMLSDGTHARGGVDGLKTGTSNSAGSSF 240

Query: 97  LAIIDAIRKMGIRKI-VILNAHGG-NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGII 154
           LA     ++ G+R I V+LNA+ G  SP    V+T   M +    V +++S  T+ +   
Sbjct: 241 LA---TTQQAGMRIITVVLNANDGLTSPENRFVATNDLMNY----VYSNFSLVTLVKKGE 293

Query: 155 SFPETEIGIHGGEIETSMMLALA 177
           +F +++I +  GE ETS ++A A
Sbjct: 294 AFEDSKIKVFNGEKETSPVVAAA 316


>gi|223933668|ref|ZP_03625645.1| Serine-type D-Ala-D-Ala carboxypeptidase [Streptococcus suis
           89/1591]
 gi|330833493|ref|YP_004402318.1| serine-type D-Ala-D-Ala carboxypeptidase [Streptococcus suis ST3]
 gi|223897661|gb|EEF64045.1| Serine-type D-Ala-D-Ala carboxypeptidase [Streptococcus suis
           89/1591]
 gi|329307715|gb|AEB82131.1| Serine-type D-Ala-D-Ala carboxypeptidase [Streptococcus suis ST3]
          Length = 413

 Score = 39.3 bits (90), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 67/143 (46%), Gaps = 22/143 (15%)

Query: 50  LAERIKSILPPRLPVTCMPVEPIG----YSIEHMYVDGT---------KTLTYAEAIEHW 96
           +A R+    P  L +T +     G    YS   M  DGT         KT T   A   +
Sbjct: 192 IARRLILDYPQVLDITSLNAYDFGGYTYYSTNQMLSDGTHARGGVDGLKTGTSNSAGSSF 251

Query: 97  LAIIDAIRKMGIRKI-VILNAHGG-NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGII 154
           LA     ++ G+R I V+LNA+ G  SP    V+T   M +    V +++S  T+ +   
Sbjct: 252 LA---TTQQAGMRIITVVLNANDGLTSPENRFVATNDLMNY----VYSNFSLVTLVKKGE 304

Query: 155 SFPETEIGIHGGEIETSMMLALA 177
           +F +++I +  GE ETS ++A A
Sbjct: 305 AFEDSKIKVFNGEKETSPVVAAA 327


>gi|218678407|ref|ZP_03526304.1| creatininase [Rhizobium etli CIAT 894]
          Length = 75

 Score = 39.3 bits (90), Expect = 0.65,   Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 24 VVLPLGAYEQHGPHLPMNTDTIIAAGLAERI 54
          V LPLG+ EQHG H+ +N D +I   + ER+
Sbjct: 25 VFLPLGSTEQHGHHMSLNVDVVIPTQICERV 55


>gi|242243560|ref|ZP_04798004.1| virulence protein EssB [Staphylococcus epidermidis W23144]
 gi|242232911|gb|EES35223.1| virulence protein EssB [Staphylococcus epidermidis W23144]
          Length = 441

 Score = 39.3 bits (90), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 61/143 (42%), Gaps = 14/143 (9%)

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGE-IETSMMLALAPHLVKMDLAENFSS 191
           +R+  L+++     F       +  E  + +H G   E  ++ +     +K  L E ++ 
Sbjct: 149 LRYKSLIITA----FNQKVNFDALVEGNLELHKGTPFENKIIQSKNLSELKQFLTEQYNK 204

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNA---------MDATVKKGEGLLSYF 242
           +QS++ +NF Y+R    ++F W    ++  GV+  A         M    +  +G  SY 
Sbjct: 205 QQSDYTQNFSYVRKRKYNTFKWLGIAMSIIGVLLIACLAYLYFFVMKNEEQVEKGYQSYV 264

Query: 243 ANCFIQLLNDINSFDVSIFDKDV 265
              + Q+LND    D    DK+ 
Sbjct: 265 KADYTQVLNDYKDLDGKNLDKEA 287


>gi|291335276|gb|ADD94895.1| hypothetical protein [uncultured marine bacterium
           MedDCM-OCT-S09-C166]
          Length = 121

 Score = 38.9 bits (89), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           V++PLG+ EQHGP   + TD + A  +A  +      R  V   P +  G +  H+   G
Sbjct: 35  VIIPLGSTEQHGPTGAIGTDALTAEAVALEVGR----RTGVLVTPAQAFGMAEHHLGFAG 90

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVIL 114
           T +L  A  +     ++ ++ + G  ++ ++
Sbjct: 91  TMSLQPATLLAVLHDLVLSLGRHGFERVYVI 121


>gi|282900445|ref|ZP_06308394.1| hypothetical protein CRC_01813 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194638|gb|EFA69586.1| hypothetical protein CRC_01813 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 166

 Score = 38.5 bits (88), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 12/93 (12%)

Query: 32  EQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTL 87
           EQHGP   + TD +    I+ G+ E  ++++ P + V        G ++ H    GT +L
Sbjct: 29  EQHGPTGLIGTDAVCAEFISHGVGEATQAMVGPTINV--------GMALHHSAFPGTISL 80

Query: 88  TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             +  I      I ++ K G  K   +N HGGN
Sbjct: 81  RPSTLILVVRDYISSLAKAGFTKFYFINGHGGN 113


>gi|303258367|ref|ZP_07344370.1| creatininase [Burkholderiales bacterium 1_1_47]
 gi|302858813|gb|EFL81901.1| creatininase [Burkholderiales bacterium 1_1_47]
          Length = 62

 Score = 38.5 bits (88), Expect = 0.95,   Method: Composition-based stats.
 Identities = 14/30 (46%), Positives = 22/30 (73%)

Query: 23 IVVLPLGAYEQHGPHLPMNTDTIIAAGLAE 52
          + ++P+G+ EQH  HLP+ TDT +A  +AE
Sbjct: 23 VAIVPIGSVEQHSYHLPLGTDTYVAMTIAE 52


>gi|291521860|emb|CBK80153.1| Uncharacterized protein, putative amidase [Coprococcus catus GD/7]
          Length = 258

 Score = 38.1 bits (87), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 94/233 (40%), Gaps = 19/233 (8%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR--LPVTCMPVEPIGYSIEHMY 80
           +  +PLG  E HGPHLP+ TD      L ER    L       +   PV      + +++
Sbjct: 23  LAFIPLGPTEVHGPHLPLMTDFRSGLELCERAARKLQEEGIESIIATPVTYCAADVTNVF 82

Query: 81  VDGTKTLTYAEAIEHWLA-IIDAIRKMGIRKIVILNAH---GGNSPLVSIVSTEARMRFS 136
              T      E +E  L  I  ++ + G   I++++ H   G  + +V  +    +    
Sbjct: 83  PGNTSLRV--ETVEMLLEDICLSLARSGFYNIMVVSGHADPGNAAAVVRGIENAKKKNNK 140

Query: 137 MLVVSTSWSRFTIPQGIISFPETEI----GIHGGEIETSMMLALAPHLV-KMDLAENFSS 191
           +    ++W    I +G  +     I     +H GE ET   L   P L+ K  +A    +
Sbjct: 141 VNGTYSAWFDKGIVEGGAAAYFNGIHPTYDLHAGESETGFGLMRYPELLDKAQIASLKPN 200

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
            + EFL  F+ + A G+  F   ++   P    G+   AT +  +     F++
Sbjct: 201 YEGEFL--FERIGA-GAKDF---IECGAPDAYFGDPAAATAENADKQYDVFSD 247


>gi|89069379|ref|ZP_01156734.1| Uncharacterized protein, putative amidase [Oceanicola granulosus
           HTCC2516]
 gi|89045009|gb|EAR51087.1| Uncharacterized protein, putative amidase [Oceanicola granulosus
           HTCC2516]
          Length = 237

 Score = 38.1 bits (87), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 44/101 (43%), Gaps = 12/101 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAA----GLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           V++P+G  E HGPHL ++ D   A      +AER  +IL P L        P G++ E  
Sbjct: 21  VLIPVGLIEAHGPHLSLSVDIDTAEYFSRAIAERTGAILAPGL--------PYGFADEMR 72

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              GT  LT          +  +    G   ++ ++ HG N
Sbjct: 73  DYPGTIGLTTGTFTTVVKELALSFCHHGFTNLIFVSGHGAN 113


>gi|154505621|ref|ZP_02042359.1| hypothetical protein RUMGNA_03160 [Ruminococcus gnavus ATCC 29149]
 gi|153794060|gb|EDN76480.1| hypothetical protein RUMGNA_03160 [Ruminococcus gnavus ATCC 29149]
          Length = 274

 Score = 38.1 bits (87), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 52/99 (52%), Gaps = 5/99 (5%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           ++ IV++P+G  E HG   P++++T+++   A ++       L +T +P    G +    
Sbjct: 20  RNDIVIVPVGTVEMHG-GFPLDSETVVSEAFALKMAEACDG-LVLTGLPYFYAGATASGR 77

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              GT  ++  E I +   I +++ + G ++ + ++AHG
Sbjct: 78  ---GTVQVSIQEGIRYLTGIAESLLRQGFKRQIYISAHG 113


>gi|182679685|ref|YP_001833831.1| hypothetical protein Bind_2770 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635568|gb|ACB96342.1| conserved hypothetical protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 273

 Score = 37.4 bits (85), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 73/183 (39%), Gaps = 31/183 (16%)

Query: 18  ARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGL----AERIKSILPPRLPVTCMPVEP 71
           AR+D   IV LP+G  E HG   P   DTI A  L    A R   ++    P     +  
Sbjct: 19  ARRDACPIVYLPMGLCEPHGHVAPFGLDTIKAEWLCLEAARRFGGVV---APTQSWHIHE 75

Query: 72  IGYSIEHM--YVDGTKTLTYA----EAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
            GY    +   +DG   L  A      +E  L  + A R  G +  V+++ H G    + 
Sbjct: 76  CGYHAPWLREVMDGINPLLAALPAHLVLETLLYQLRAFRNGGFKAAVVISGHNGAQDDLR 135

Query: 126 IVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI----HGGEIETSMMLALAPHLV 181
           +V+      FS        + F     + S PE   G+    H G  E S +L ++  L+
Sbjct: 136 MVARH----FS--------AAFPFEHFVASDPELVKGLFHGDHAGRYEISQLLVVSGDLI 183

Query: 182 KMD 184
            ++
Sbjct: 184 ALE 186


>gi|85813544|emb|CAF33050.1| putative amidohydrolase [Streptoalloteichus tenebrarius]
          Length = 249

 Score = 37.4 bits (85), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 77/190 (40%), Gaps = 30/190 (15%)

Query: 9   DNSLPLCADAR--KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
           D  LP   DAR     +  +P+G+ E H  H+P   DT  A  + ER       R     
Sbjct: 12  DRLLPREFDARLAATPLAYVPVGSLEWHSAHMPYGVDTDKATAICERAAR----RHGGIV 67

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAI-EHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
           +P  P G+ ++  +   T      E I + +  I+  +  +G R  ++++ H      + 
Sbjct: 68  LPGNPWGF-MQGNWRGATHPGLRVETIYQLYSDILRGLATVGFRAAIVVSGHWTTKQTIP 126

Query: 126 IVSTEARMRFSMLVVSTSWSRFTIPQGIISF--PETEIGI---------HGGEIETSMML 174
           I     ++R           + T  +G+++F   + + G          H G +ETS+  
Sbjct: 127 IACALEQVR-----------QETGLRGMVTFDGSDEDCGFDPALHLDMDHAGALETSVYG 175

Query: 175 ALAPHLVKMD 184
           AL P  V +D
Sbjct: 176 ALFPENVHLD 185


>gi|33593038|ref|NP_880682.1| hypothetical protein BP2012 [Bordetella pertussis Tohama I]
 gi|33563413|emb|CAE42292.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|332382451|gb|AEE67298.1| hypothetical protein BPTD_1982 [Bordetella pertussis CS]
          Length = 400

 Score = 37.4 bits (85), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 9/72 (12%)

Query: 144 WSRFTIPQGIISFPETEI---GIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           W+R+TIP G I  P  +     +HG  +   + +AL PHLV +D           F   +
Sbjct: 108 WTRYTIPTGPIPAPAQQALLAQLHGHILADGVRVALMPHLVSID------QMPRTFAETW 161

Query: 201 KYLRAHGSHSFG 212
           ++L   G+ + G
Sbjct: 162 QWLHRLGTQALG 173


>gi|33596985|ref|NP_884628.1| hypothetical protein BPP2392 [Bordetella parapertussis 12822]
 gi|33600827|ref|NP_888387.1| hypothetical protein BB1842 [Bordetella bronchiseptica RB50]
 gi|33566436|emb|CAE37689.1| conserved hypothetical protein [Bordetella parapertussis]
 gi|33568427|emb|CAE32339.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 400

 Score = 37.4 bits (85), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 9/72 (12%)

Query: 144 WSRFTIPQGIISFPETEI---GIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           W+R+TIP G I  P  +     +HG  +   + +AL PHLV +D           F   +
Sbjct: 108 WTRYTIPTGPIPAPAQQALLAQLHGHILADGVRVALMPHLVSID------QMPRTFAETW 161

Query: 201 KYLRAHGSHSFG 212
           ++L   G+ + G
Sbjct: 162 QWLHRLGTQALG 173


>gi|218514493|ref|ZP_03511333.1| hypothetical protein Retl8_12707 [Rhizobium etli 8C-3]
          Length = 48

 Score = 37.0 bits (84), Expect = 3.0,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 31/44 (70%)

Query: 215 MKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           M DLNP+G  GNA  AT +KGE L+++     ++LL D+++FDV
Sbjct: 1   MSDLNPQGAAGNAAAATAEKGEALIAHAVKGLVELLEDVDAFDV 44


>gi|291540610|emb|CBL13721.1| Uncharacterized protein, putative amidase [Roseburia intestinalis
           XB6B4]
          Length = 270

 Score = 36.6 bits (83), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 53/101 (52%), Gaps = 6/101 (5%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           +R D I+++P+G  E HG   P++++T I+   A  +       L +T +P    G +  
Sbjct: 11  SRND-IIIVPVGTVEMHGG-FPLDSETTISEAFALEMAEACDG-LVLTGLPYFYAGATAS 67

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
                GT  ++  E I++ +A+ +++ + G ++ + ++ HG
Sbjct: 68  GR---GTVQVSVREGIDYLMAVANSLLRQGFKRQIYISFHG 105


>gi|257413540|ref|ZP_04743381.2| putative creatinine amidohydrolase [Roseburia intestinalis L1-82]
 gi|257203168|gb|EEV01453.1| putative creatinine amidohydrolase [Roseburia intestinalis L1-82]
          Length = 270

 Score = 36.6 bits (83), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 53/101 (52%), Gaps = 6/101 (5%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           +R D I+++P+G  E HG   P++++T I+   A  +       L +T +P    G +  
Sbjct: 11  SRND-IIIVPVGTVEMHGG-FPLDSETTISEAFALEMAEACDG-LVLTGLPYFYAGATAS 67

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
                GT  ++  E I++ +A+ +++ + G ++ + ++ HG
Sbjct: 68  GR---GTVQVSVREGIDYLMAVANSLLRQGFKRQIYISFHG 105


>gi|291534592|emb|CBL07704.1| Uncharacterized protein, putative amidase [Roseburia intestinalis
           M50/1]
          Length = 278

 Score = 36.2 bits (82), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 53/101 (52%), Gaps = 6/101 (5%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           +R D I+++P+G  E HG   P++++T I+   A  +       L +T +P    G +  
Sbjct: 19  SRND-IIIVPVGTVEMHGG-FPLDSETTISEAFALEMAEACDG-LVLTGLPYFYAGATAS 75

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
                GT  ++  E I++ +A+ +++ + G ++ + ++ HG
Sbjct: 76  GR---GTVQVSVREGIDYLMAVANSLLRQGFKRQIYISFHG 113


>gi|88704992|ref|ZP_01102704.1| conserved hypothetical protein [Congregibacter litoralis KT71]
 gi|88700687|gb|EAQ97794.1| conserved hypothetical protein [Congregibacter litoralis KT71]
          Length = 340

 Score = 36.2 bits (82), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 70/175 (40%), Gaps = 14/175 (8%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP---VTCMPVEPIGYSIEHMY 80
           V++P G  E++GP L      +I  G    I S L   L    V  +P   I      M 
Sbjct: 118 VIIPTGGIEENGPFLATGKHNVILEGSCPAIASQLRNALCAPIVKFVPEGRIDPPTGAMR 177

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS---------TEA 131
             GT +L+ +        I  ++R+ G   IV++   GGN   +  V+         T +
Sbjct: 178 FPGTISLSASTYEALLTDIASSLRQSGFTDIVMIGDSGGNQRGMKNVAATLNARFADTPS 237

Query: 132 RMRFSMLVVSTSW-SRFTIPQGIISFPETEIGIHGGEI-ETSMMLALAPHLVKMD 184
           R  F     +  W +     + ++   ET+   H  +I  T+MM+   P  V+ D
Sbjct: 238 RFHFIEAFYNPGWEATENYTRDVLGVDETQKDGHHDDIWVTAMMMVTDPTQVRFD 292


>gi|254445725|ref|ZP_05059201.1| hypothetical protein VDG1235_3972 [Verrucomicrobiae bacterium
           DG1235]
 gi|198260033|gb|EDY84341.1| hypothetical protein VDG1235_3972 [Verrucomicrobiae bacterium
           DG1235]
          Length = 244

 Score = 36.2 bits (82), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 41/99 (41%), Gaps = 10/99 (10%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAG----LAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           I  +P GA E H  H P+  D+  A G    LAE+   ++ P +P+    ++P       
Sbjct: 36  IAYVPWGALEWHSAHAPIGLDSTKAEGICLALAEKTGGVVLPAIPLATNTIKPFKGFPHS 95

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
           + + G      AE I   LA        G R I++   H
Sbjct: 96  IDISGGLITNLAEEICLQLA------DEGFRVIILFTGH 128


>gi|170739917|ref|YP_001768572.1| creatininase [Methylobacterium sp. 4-46]
 gi|168194191|gb|ACA16138.1| Creatininase [Methylobacterium sp. 4-46]
          Length = 287

 Score = 36.2 bits (82), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 70/175 (40%), Gaps = 12/175 (6%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY---SIEHMY 80
           V++P G  EQ+GP LP++    I A  A RI   L   L    +   P G      +++ 
Sbjct: 61  VLVPSGGLEQNGPFLPIDKHDSIVAFTARRIAEALGHTLVAPVISYVPQGRFDPPSDNLL 120

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE-----ARMRF 135
             GT  ++          I  +++  G R I+ L  HGG+  +   V+       A    
Sbjct: 121 FPGTLGVSEEAFAGTLEGIARSLKAHGFRLILFLCDHGGSLKVQQEVAARLDRAWAPQGV 180

Query: 136 SMLVVSTSWSRFTIPQGIISFPETE----IGIHGGEIETSMMLALAPHLVKMDLA 186
            ++ V   +      Q +    + E    IG H G  + ++ML  AP  V +  A
Sbjct: 181 RVVSVDAYYVEGNRAQQVWLESQGETPATIGFHAGLADHALMLVTAPERVDLTRA 235


>gi|289208435|ref|YP_003460501.1| anthranilate synthase [Thioalkalivibrio sp. K90mix]
 gi|288944066|gb|ADC71765.1| Anthranilate synthase [Thioalkalivibrio sp. K90mix]
          Length = 443

 Score = 35.8 bits (81), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 58/134 (43%), Gaps = 9/134 (6%)

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI--VSTEAR 132
           ++  + +D  K   Y EA++  L  I    + G    V L+     S L ++   S  AR
Sbjct: 164 ALPELVIDEEKPERYREAVKQGLEYI----RAGDTFQVNLSREWKASSLEALDGASLYAR 219

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
           +R +      +W +F   Q I S PE  + ++GGE+ET     +A    + D A+  S  
Sbjct: 220 LRRANAAPFAAWLQFPEGQVISSSPERLVSVNGGEVETR---PIAGTRRRDDNADKDSRL 276

Query: 193 QSEFLRNFKYLRAH 206
            SE   N K    H
Sbjct: 277 FSELRGNIKERSEH 290


>gi|254514560|ref|ZP_05126621.1| creatininase [gamma proteobacterium NOR5-3]
 gi|219676803|gb|EED33168.1| creatininase [gamma proteobacterium NOR5-3]
          Length = 292

 Score = 35.4 bits (80), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 71/175 (40%), Gaps = 14/175 (8%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP---VTCMPVEPIGYSIEHMY 80
           V++P G  E++GP+L      +I       I  +L   L    V  +P   I      M 
Sbjct: 71  VIVPTGGVEENGPYLATGKHNVILEATCPAIAKLLENALCAPIVKFVPEGDIDPPTGAMR 130

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
             G+ +L+ +        I+ ++R+ G   IV++   GGN   +  V+     ++  L  
Sbjct: 131 FPGSISLSASTYEALLTDIVSSLRQSGFSDIVMIGDSGGNQRGMDAVAARLNKQWEELPT 190

Query: 141 STSWSR-FTIP--QGIISFPETEIGI--------HGGEIETSMMLALAPHLVKMD 184
              + + F  P  +   +F  TE+G+        H     T+MM+   P  V+ +
Sbjct: 191 RVHFVKEFYSPGWEATENFTRTELGVDETRKDGYHDDIWVTAMMMVTDPAQVRFE 245


>gi|299470174|emb|CBN78202.1| creatininase subfamily [Ectocarpus siliculosus]
          Length = 415

 Score = 35.4 bits (80), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 12/103 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTI----IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
           V++P+GA EQHGP+  + TD +    +A G+ E   +IL P +          G S  H 
Sbjct: 25  VIVPVGATEQHGPNGLIGTDHMTAEAVARGVCEMTGAILAPTI--------NYGMSHHHE 76

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
              GT TL  A  +     +  ++   G   ++ +N    + P
Sbjct: 77  SFPGTVTLRPATFVAVVRDVAASLSGAGFTHVLFVNGTSRSQP 119


Searching..................................................done


Results from round 2




>gi|254780633|ref|YP_003065046.1| creatinine amidohydrolase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040310|gb|ACT57106.1| creatinine amidohydrolase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 267

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 267/267 (100%), Positives = 267/267 (100%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP
Sbjct: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN
Sbjct: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL
Sbjct: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS
Sbjct: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240

Query: 241 YFANCFIQLLNDINSFDVSIFDKDVQK 267
           YFANCFIQLLNDINSFDVSIFDKDVQK
Sbjct: 241 YFANCFIQLLNDINSFDVSIFDKDVQK 267


>gi|315121832|ref|YP_004062321.1| creatinine amidohydrolase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495234|gb|ADR51833.1| creatinine amidohydrolase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 268

 Score =  331 bits (848), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 197/264 (74%), Positives = 223/264 (84%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           +NPL+ F DN   L     KDWIVVLPLGAYEQHGPHLPM+TDTIIA GL ER+  ILP 
Sbjct: 2   VNPLVRFADNFPSLDVGDHKDWIVVLPLGAYEQHGPHLPMDTDTIIAKGLVERVIGILPS 61

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPVT MPVE IGYSIEHMY  GTKTL+YAEAIE WL+II+ I+K+GIRK+VILNAHGGN
Sbjct: 62  TLPVTFMPVESIGYSIEHMYAHGTKTLSYAEAIERWLSIINEIQKLGIRKVVILNAHGGN 121

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPLVSIVSTEAR+RFS+L VSTSWSRF  P  I+   E  I IHGGEIETSMML LAPHL
Sbjct: 122 SPLVSIVSTEARVRFSVLAVSTSWSRFGFPHDIVLSSERGIDIHGGEIETSMMLVLAPHL 181

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           VKMDL++NFSSRQSEFL+NF YLRA+G HSFGW+M+DLNP+GVVGNAM AT +KGE LLS
Sbjct: 182 VKMDLSKNFSSRQSEFLQNFTYLRAYGPHSFGWTMEDLNPEGVVGNAMIATFEKGESLLS 241

Query: 241 YFANCFIQLLNDINSFDVSIFDKD 264
           ++ANCF+QLL DIN FDVS+FDK+
Sbjct: 242 HYANCFVQLLEDINVFDVSLFDKN 265


>gi|254501782|ref|ZP_05113933.1| creatininase subfamily [Labrenzia alexandrii DFL-11]
 gi|222437853|gb|EEE44532.1| creatininase subfamily [Labrenzia alexandrii DFL-11]
          Length = 266

 Score =  321 bits (824), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 122/262 (46%), Positives = 175/262 (66%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLP-LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   + D +     +  R+DWI VLP+ A EQHGPHLP++TDT +A G  +R+  ++P
Sbjct: 1   MLPKPFWQDMTTEDFKSAGREDWIAVLPVAAVEQHGPHLPLSTDTTLAEGQIQRVIELIP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             LPVT +PV+ IG S EH+   GT TL++    + W+ I +++ + GIRK+VI+N+HGG
Sbjct: 61  KHLPVTFLPVQTIGKSDEHIDYPGTLTLSWDTITKCWIEIGESVARAGIRKLVIINSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N P++ IVS E R++  M V+ T+W RF  P+G+    E   GIHGG+IETS+MLAL P 
Sbjct: 121 NVPVIDIVSRELRIKHDMFVLGTNWLRFGQPEGLFPDDEFTYGIHGGDIETSLMLALRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+++L+++FSS Q  FL+ F+YLR HG   FGW  +DLNP G  GNA  ATV+KG   L
Sbjct: 181 LVRVELSQDFSSEQQSFLKEFRYLRGHGKAQFGWKAQDLNPHGTQGNASAATVEKGRQSL 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
           ++ A  FI+LL D+ S+++   
Sbjct: 241 NHAAQAFIELLEDVQSYNLHRL 262


>gi|118588462|ref|ZP_01545871.1| Creatininase [Stappia aggregata IAM 12614]
 gi|118439168|gb|EAV45800.1| Creatininase [Stappia aggregata IAM 12614]
          Length = 267

 Score =  318 bits (815), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 118/262 (45%), Positives = 169/262 (64%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   + D  +L   +   +DWI VLP+ A EQHGPHLP++TDT IA G  +R+  +LP
Sbjct: 1   MLPKPYWQDMTTLDFQSPGVEDWIAVLPVAAIEQHGPHLPLSTDTTIAEGQIQRVLELLP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             LPVT +PV+ +G S EH+   GT TL +      WL + +++ + GIRK+V++N+HGG
Sbjct: 61  DGLPVTFLPVQAVGKSDEHISSPGTLTLAWDTVTRCWLELGESVARAGIRKLVLINSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N P++ IV+ E R++  M V +T+W RF  P G+ +  E   GIHGG+IETS+ML L P 
Sbjct: 121 NVPVLDIVARELRVKHGMFVTATNWLRFGQPDGLYADEEFTYGIHGGDIETSLMLHLRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+M+LA +F S+Q  +L+ FK+LR HG   +GW  +DLN  G +GNA  A+ +KG   L
Sbjct: 181 LVRMELAADFPSQQQSYLKEFKHLRGHGKAQYGWKAQDLNETGALGNAALASAEKGRQSL 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
            + A  FI+LL D+ SFD+   
Sbjct: 241 DHAARGFIELLEDVRSFDLERL 262


>gi|254472937|ref|ZP_05086335.1| creatinine amidohydrolase, putative [Pseudovibrio sp. JE062]
 gi|211957658|gb|EEA92860.1| creatinine amidohydrolase, putative [Pseudovibrio sp. JE062]
          Length = 287

 Score =  313 bits (803), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 122/263 (46%), Positives = 172/263 (65%), Gaps = 1/263 (0%)

Query: 3   PLIIF-TDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   +    +     +   +WI VLP+ A EQHGPHLP+ TDT IA G   R   +LP  
Sbjct: 25  PRRFWHEMTTTDFSENDTSEWIAVLPIAAIEQHGPHLPVYTDTCIAEGQVARTVELLPDD 84

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LPVT +PV+ +G S EH    GT +LT+  A++ W+ I + + + GIRK+V+ N+HGGNS
Sbjct: 85  LPVTFLPVQAVGKSDEHHSFPGTLSLTWETAVKAWIEIGECVARAGIRKLVLANSHGGNS 144

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           PL+ I++ + R++ +ML V +SW RF  P+G+ S  E   GIHGG+IETS+MLAL P LV
Sbjct: 145 PLMDIITRDLRLKHNMLAVESSWLRFGQPEGLFSEEEFTYGIHGGDIETSIMLALRPDLV 204

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           +MD A +F+S Q++ + N  YLRAHG H +GW  +DLN  G +GNA  AT +KG+  L++
Sbjct: 205 RMDQATDFTSTQTDHINNDAYLRAHGRHQYGWMSEDLNKTGALGNASLATAEKGQASLTH 264

Query: 242 FANCFIQLLNDINSFDVSIFDKD 264
            +  FI+LL D+  FDVS F K+
Sbjct: 265 ASQEFIKLLRDVQRFDVSSFGKN 287


>gi|307944411|ref|ZP_07659751.1| creatininase [Roseibium sp. TrichSKD4]
 gi|307772160|gb|EFO31381.1| creatininase [Roseibium sp. TrichSKD4]
          Length = 266

 Score =  311 bits (797), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 120/264 (45%), Positives = 170/264 (64%), Gaps = 1/264 (0%)

Query: 1   MNPLIIFTDNSL-PLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   + + +     AD   +WI VLP+ A EQHGPHLP++TDT IA G  +++  ILP
Sbjct: 1   MLPKRHWHEMTTCDFEADTVSEWIAVLPVAAIEQHGPHLPVSTDTAIAEGQIKKVLEILP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             LPVT +P++ IG S EH+   GT TL++     +W+ I + + + G+RK+VI+NAHGG
Sbjct: 61  DHLPVTFLPLQAIGKSNEHITSPGTLTLSWETLTRNWIEIGECVARAGLRKLVIINAHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N P++  V+ E R+   MLV +T+W RF  P G+    E   GIHGG+IETS+M+ L P 
Sbjct: 121 NVPVMDTVALELRINCGMLVTATNWLRFGQPDGLYPEEEFSYGIHGGDIETSIMMHLHPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+ D   +F S Q +FLR+FK+LR HG   FGW  KDLNP+G +GNA +A+  KG   L
Sbjct: 181 LVRTDQLRDFPSAQQDFLRDFKHLRGHGKAQFGWMAKDLNPEGALGNAANASADKGRQSL 240

Query: 240 SYFANCFIQLLNDINSFDVSIFDK 263
            + A  FI+LL D+++FD+   D+
Sbjct: 241 EHAAKGFIELLEDVHAFDMGRLDQ 264


>gi|86359214|ref|YP_471106.1| creatinine amidohydrolase (creatininase) protein [Rhizobium etli
           CFN 42]
 gi|86283316|gb|ABC92379.1| probable creatinine amidohydrolase (creatininase) protein
           [Rhizobium etli CFN 42]
          Length = 262

 Score =  310 bits (796), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 148/261 (56%), Positives = 190/261 (72%), Gaps = 1/261 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P   F D+S  +CA   +  I VLPLGA+EQHGPHLP  TDT+IA G+A R+K  LP 
Sbjct: 2   MTPSPRF-DDSGSVCAPGARRPIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKMALPA 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPV  +P E +GYSIEHM V+GTKTL + EA+  WL I + + K  IRK V+LNAHGGN
Sbjct: 61  GLPVIFLPAESVGYSIEHMDVEGTKTLAFDEAVNRWLGIAEGLAKRDIRKFVMLNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPL+S+V+TEAR+RF+ML V+TSW+RF +P G+I   E  IGIHGG+IETS+MLAL P  
Sbjct: 121 SPLISVVATEARVRFAMLAVATSWTRFGLPDGVIPPEEKAIGIHGGDIETSVMLALHPDK 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M  AE+FSSRQ+EF   FK+LRA+G H+FGW M D+N +GV GNA  AT +KGE L++
Sbjct: 181 VDMAKAEDFSSRQAEFATCFKHLRAYGPHAFGWKMSDINEQGVAGNASAATAEKGEALIA 240

Query: 241 YFANCFIQLLNDINSFDVSIF 261
           +     ++LL D+++FDVS  
Sbjct: 241 HAVKGLVELLEDVDAFDVSEL 261


>gi|222149787|ref|YP_002550744.1| creatinine amidohydrolase [Agrobacterium vitis S4]
 gi|221736769|gb|ACM37732.1| creatinine amidohydrolase [Agrobacterium vitis S4]
          Length = 273

 Score =  310 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 151/258 (58%), Positives = 190/258 (73%)

Query: 2   NPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           +P   F  N   L    R +WI VLPLGA+EQHGPHLP  TDTIIA G+ +R+   LP  
Sbjct: 3   HPEPYFQCNDPALSPAERANWIAVLPLGAHEQHGPHLPFETDTIIAQGVVDRLILALPDT 62

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LPVT +PVEP+GYS+EHM V GT+TLT+ EA+E WL I + +   GIRK+++LNAHGGNS
Sbjct: 63  LPVTFLPVEPVGYSVEHMDVFGTRTLTFNEAVERWLGIAETLSGQGIRKLMMLNAHGGNS 122

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           PL+++V+TEAR+RFSML V+TSW+RF  P G+I   +  I IHGG+IETS+MLAL P LV
Sbjct: 123 PLMTVVATEARIRFSMLAVATSWTRFGQPDGLIRPEDKAIDIHGGDIETSVMLALRPDLV 182

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
            MD A+NFSSRQSEF   F +LRA+G H+FGW M DLNP GV GNA  AT +KGE LLS+
Sbjct: 183 AMDKAQNFSSRQSEFAARFTHLRAYGPHAFGWKMADLNPLGVAGNASVATAEKGENLLSH 242

Query: 242 FANCFIQLLNDINSFDVS 259
             +  ++LL DI+ FD+ 
Sbjct: 243 AVHGLVELLWDIHDFDIE 260


>gi|254501396|ref|ZP_05113547.1| creatininase subfamily [Labrenzia alexandrii DFL-11]
 gi|222437467|gb|EEE44146.1| creatininase subfamily [Labrenzia alexandrii DFL-11]
          Length = 263

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 124/263 (47%), Positives = 175/263 (66%), Gaps = 1/263 (0%)

Query: 1   MNPLIIFTD-NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   + D  +        KDWI VLP+ A EQHGPHLP+ TDT IA G  +R+  +LP
Sbjct: 1   MLPKPYWQDMTTTDFDHPEVKDWIAVLPVAAIEQHGPHLPVYTDTAIAEGQIQRVIELLP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             +P + +PV+ IG S EH+   GT T+T+  A++ WL + D+I + G+RK+V++N+HGG
Sbjct: 61  DDVPASFLPVQAIGKSNEHISSAGTLTMTWETALQAWLELGDSILRAGVRKVVVVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N PL+ I++ E R+R +ML V T+W+ F  P+G+ S  E   GIHGG++ETS+ML L P 
Sbjct: 121 NVPLIGILTRELRVRHNMLAVGTAWASFGQPEGVFSDHELTFGIHGGDVETSIMLHLRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV MD A NF S Q +    FK+LRAHG H+FGW  +DLNP G VG+A  AT +KG+  L
Sbjct: 181 LVNMDKARNFRSSQEDLASKFKHLRAHGPHAFGWKAQDLNPAGTVGDASIATAEKGKASL 240

Query: 240 SYFANCFIQLLNDINSFDVSIFD 262
            + A  F++LL D+++FD++ FD
Sbjct: 241 DHAARGFVELLQDVHAFDLAHFD 263


>gi|241206367|ref|YP_002977463.1| creatininase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860257|gb|ACS57924.1| Creatininase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 262

 Score =  309 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 149/261 (57%), Positives = 193/261 (73%), Gaps = 1/261 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P   F D++     D R   I VLPLGA+EQHGPHLP  TDT+IA G+A R+K  LP 
Sbjct: 2   MTPSPRFEDSNPASTPDGR-HLIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKIALPA 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPVT +P E +GYSIEHM V+GTKTL + EA+  WL I + + K GIRK+V+LNAHGGN
Sbjct: 61  GLPVTFLPAESVGYSIEHMDVEGTKTLAFDEAVNRWLGIAEGLAKQGIRKLVMLNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SP+V+IV+TEAR+RF+ML V+TSW+RF +P G+++  E  IGIHGG+IETS+MLAL P  
Sbjct: 121 SPIVTIVATEARLRFAMLAVATSWTRFGLPDGVVTPEEKAIGIHGGDIETSVMLALHPDK 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M  A NFSSRQ+EF   FK+LRA+G H+FGW M DLN +GV GNA  ATV+KGE L++
Sbjct: 181 VDMAKAANFSSRQTEFAERFKHLRAYGPHAFGWKMSDLNAEGVAGNAAAATVEKGEALIA 240

Query: 241 YFANCFIQLLNDINSFDVSIF 261
           +     ++LL+D+++FDV+  
Sbjct: 241 HAVKGLVELLSDVDAFDVAQL 261


>gi|17988654|ref|NP_541287.1| creatininase [Brucella melitensis bv. 1 str. 16M]
 gi|225629438|ref|ZP_03787471.1| creatininase [Brucella ceti str. Cudo]
 gi|294853940|ref|ZP_06794612.1| creatinine amidohydrolase [Brucella sp. NVSL 07-0026]
 gi|17984460|gb|AAL53551.1| creatininase [Brucella melitensis bv. 1 str. 16M]
 gi|225615934|gb|EEH12983.1| creatininase [Brucella ceti str. Cudo]
 gi|294819595|gb|EFG36595.1| creatinine amidohydrolase [Brucella sp. NVSL 07-0026]
          Length = 277

 Score =  308 bits (790), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 136/251 (54%), Positives = 178/251 (70%)

Query: 15  CADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY 74
             D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+GY
Sbjct: 25  LRDQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPVGY 84

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           SIEHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R R
Sbjct: 85  SIEHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELRTR 144

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
             ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + QS
Sbjct: 145 LDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNAQS 204

Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
           +F   FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE LL++  + FI LL D++
Sbjct: 205 QFAEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASAQAGEKLLAHAVSGFIDLLRDVD 264

Query: 255 SFDVSIFDKDV 265
            F+++ F+  V
Sbjct: 265 RFELARFNPKV 275


>gi|222087138|ref|YP_002545673.1| creatinine amidohydrolase (creatininase) protein [Agrobacterium
           radiobacter K84]
 gi|221724586|gb|ACM27742.1| creatinine amidohydrolase (creatininase) protein [Agrobacterium
           radiobacter K84]
          Length = 263

 Score =  308 bits (789), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 141/260 (54%), Positives = 190/260 (73%)

Query: 2   NPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
            PL  F DN   L    R +WI VLPLGA+EQHGPHLP +TDT+IA G+   +K+ LP  
Sbjct: 3   QPLPRFDDNDRTLAPADRANWIAVLPLGAHEQHGPHLPFDTDTLIAEGIVSHLKAALPAD 62

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LPVT +PVEP+GYSIEHM V GTKTL + EA+  WL I +A+  +GIRK V+LNAHGGNS
Sbjct: 63  LPVTFLPVEPVGYSIEHMDVVGTKTLDFDEAVNRWLGIAEAMHHLGIRKFVMLNAHGGNS 122

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           PL++IV+TEAR+RF ML V+TSW+RF +P+ +I+  +  I IHGG+IETS+MLAL P +V
Sbjct: 123 P