PSIBLAST alignment of GI: 254780633 and protein with PDB id: 3no4

>gi|304445988|pdb|3NO4|A Chain A, Crystal Structure Of A Creatinine Amidohydrolase (Npun_f1913) From Nostoc Punctiforme Pcc 73102 At 2.00 A Resolution Length = 267
>gi|304445989|pdb|3NO4|B Chain B, Crystal Structure Of A Creatinine Amidohydrolase (Npun_f1913) From Nostoc Punctiforme Pcc 73102 At 2.00 A Resolution Length = 267
 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 45/259 (17%), Positives = 83/259 (32%), Gaps = 29/259 (11%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        ++   ++ P+G+ EQHGP   + TD I A  +A    + +         P 
Sbjct: 26  TWQEVEAYLQQSKGIIFPIGSTEQHGPTGLIGTDAICAEAIA----AGVGDATGAIVGPT 81

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  I+     +  + K G  K   +N HGGN   +    +
Sbjct: 82  INVGXALHHTAFPGTISLRPSTLIQVVRDYVTCLAKAGFSKFYFINGHGGNIATLKAAFS 141

Query: 130 EARMRFSMLVVST---------SWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E       L ++          +W        +       + G H    E ++   + P 
Sbjct: 142 ETYAHLEDLQIANAQQVQCQVANWFXCGSVYKLAKELYGDQEGSHATPSEVALTQYVYPE 201

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K       +    E     +   A          +   P G  G N   AT + G+  
Sbjct: 202 AIKQ------APLSPEVASGHRIYSAA-------DFRVRYPDGRXGSNPGLATPEHGKQF 248

Query: 239 LSYFANCFIQLLNDINSFD 257
                        +  + D
Sbjct: 249 YDLAVKELSNGYLEFVNAD 267