BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780633|ref|YP_003065046.1| creatinine amidohydrolase
[Candidatus Liberibacter asiaticus str. psy62]
         (267 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780633|ref|YP_003065046.1| creatinine amidohydrolase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040310|gb|ACT57106.1| creatinine amidohydrolase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 267

 Score =  299 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 267/267 (100%), Positives = 267/267 (100%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP
Sbjct: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN
Sbjct: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL
Sbjct: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS
Sbjct: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240

Query: 241 YFANCFIQLLNDINSFDVSIFDKDVQK 267
           YFANCFIQLLNDINSFDVSIFDKDVQK
Sbjct: 241 YFANCFIQLLNDINSFDVSIFDKDVQK 267


>gi|118588462|ref|ZP_01545871.1| Creatininase [Stappia aggregata IAM 12614]
 gi|118439168|gb|EAV45800.1| Creatininase [Stappia aggregata IAM 12614]
          Length = 267

 Score =  282 bits (721), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 117/267 (43%), Positives = 168/267 (62%), Gaps = 1/267 (0%)

Query: 1   MNPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   + D +         +DWI VLP+ A EQHGPHLP++TDT IA G  +R+  +LP
Sbjct: 1   MLPKPYWQDMTTLDFQSPGVEDWIAVLPVAAIEQHGPHLPLSTDTTIAEGQIQRVLELLP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             LPVT +PV+ +G S EH+   GT TL +      WL + +++ + GIRK+V++N+HGG
Sbjct: 61  DGLPVTFLPVQAVGKSDEHISSPGTLTLAWDTVTRCWLELGESVARAGIRKLVLINSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N P++ IV+ E R++  M V +T+W RF  P G+ +  E   GIHGG+IETS+ML L P 
Sbjct: 121 NVPVLDIVARELRVKHGMFVTATNWLRFGQPDGLYADEEFTYGIHGGDIETSLMLHLRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+M+LA +F S+Q  +L+ FK+LR HG   +GW  +DLN  G +GNA  A+ +KG   L
Sbjct: 181 LVRMELAADFPSQQQSYLKEFKHLRGHGKAQYGWKAQDLNETGALGNAALASAEKGRQSL 240

Query: 240 SYFANCFIQLLNDINSFDVSIFDKDVQ 266
            + A  FI+LL D+ SFD+       +
Sbjct: 241 DHAARGFIELLEDVRSFDLERLWSPPR 267


>gi|254501782|ref|ZP_05113933.1| creatininase subfamily [Labrenzia alexandrii DFL-11]
 gi|222437853|gb|EEE44532.1| creatininase subfamily [Labrenzia alexandrii DFL-11]
          Length = 266

 Score =  278 bits (712), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 123/264 (46%), Positives = 176/264 (66%), Gaps = 1/264 (0%)

Query: 1   MNPLIIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   + D +      A R+DWI VLP+ A EQHGPHLP++TDT +A G  +R+  ++P
Sbjct: 1   MLPKPFWQDMTTEDFKSAGREDWIAVLPVAAVEQHGPHLPLSTDTTLAEGQIQRVIELIP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             LPVT +PV+ IG S EH+   GT TL++    + W+ I +++ + GIRK+VI+N+HGG
Sbjct: 61  KHLPVTFLPVQTIGKSDEHIDYPGTLTLSWDTITKCWIEIGESVARAGIRKLVIINSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N P++ IVS E R++  M V+ T+W RF  P+G+    E   GIHGG+IETS+MLAL P 
Sbjct: 121 NVPVIDIVSRELRIKHDMFVLGTNWLRFGQPEGLFPDDEFTYGIHGGDIETSLMLALRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+++L+++FSS Q  FL+ F+YLR HG   FGW  +DLNP G  GNA  ATV+KG   L
Sbjct: 181 LVRVELSQDFSSEQQSFLKEFRYLRGHGKAQFGWKAQDLNPHGTQGNASAATVEKGRQSL 240

Query: 240 SYFANCFIQLLNDINSFDVSIFDK 263
           ++ A  FI+LL D+ S+++    +
Sbjct: 241 NHAAQAFIELLEDVQSYNLHRLMR 264


>gi|298292804|ref|YP_003694743.1| creatininase [Starkeya novella DSM 506]
 gi|296929315|gb|ADH90124.1| Creatininase [Starkeya novella DSM 506]
          Length = 272

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 104/266 (39%), Positives = 151/266 (56%), Gaps = 1/266 (0%)

Query: 1   MNPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   +T+ + P  A+   ++WI VLP+ A EQHGPHLP+  DT I  G  + +   LP
Sbjct: 1   MPPKRFWTELTWPDFANGDPENWIAVLPVAAVEQHGPHLPVGVDTFIGEGYLKEVMQRLP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             +P   +P++ IG S EH++  GT TL+    I  W  I +++ + G+RK+VI+N+HGG
Sbjct: 61  NDIPAVFLPLQAIGKSNEHIHFPGTLTLSAETVIRAWTEIGESVHRAGVRKLVIVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N P++ IV+ + R R  ML V+ SW RF  P+G+ S  E + GIH G +ETS+M A  P 
Sbjct: 121 NVPILDIVTRDLRARLGMLAVTISWHRFGYPEGLFSAQERQHGIHAGGVETSLMQAFRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            VK     +F        + F YLRA     FGW  +D+ P G +G+A +A+ +KGE   
Sbjct: 181 TVKQGEIRDFPPVTLAMEQEFDYLRAGSPAGFGWMAQDIQPAGAMGDATEASKEKGEACA 240

Query: 240 SYFANCFIQLLNDINSFDVSIFDKDV 265
            Y A  FI LL D++ F +S      
Sbjct: 241 LYGARAFIALLADVHRFGLSRLPDGP 266


>gi|307944411|ref|ZP_07659751.1| creatininase [Roseibium sp. TrichSKD4]
 gi|307772160|gb|EFO31381.1| creatininase [Roseibium sp. TrichSKD4]
          Length = 266

 Score =  275 bits (703), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 120/264 (45%), Positives = 170/264 (64%), Gaps = 1/264 (0%)

Query: 1   MNPLIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   + + +     AD   +WI VLP+ A EQHGPHLP++TDT IA G  +++  ILP
Sbjct: 1   MLPKRHWHEMTTCDFEADTVSEWIAVLPVAAIEQHGPHLPVSTDTAIAEGQIKKVLEILP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             LPVT +P++ IG S EH+   GT TL++     +W+ I + + + G+RK+VI+NAHGG
Sbjct: 61  DHLPVTFLPLQAIGKSNEHITSPGTLTLSWETLTRNWIEIGECVARAGLRKLVIINAHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N P++  V+ E R+   MLV +T+W RF  P G+    E   GIHGG+IETS+M+ L P 
Sbjct: 121 NVPVMDTVALELRINCGMLVTATNWLRFGQPDGLYPEEEFSYGIHGGDIETSIMMHLHPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+ D   +F S Q +FLR+FK+LR HG   FGW  KDLNP+G +GNA +A+  KG   L
Sbjct: 181 LVRTDQLRDFPSAQQDFLRDFKHLRGHGKAQFGWMAKDLNPEGALGNAANASADKGRQSL 240

Query: 240 SYFANCFIQLLNDINSFDVSIFDK 263
            + A  FI+LL D+++FD+   D+
Sbjct: 241 EHAAKGFIELLEDVHAFDMGRLDQ 264


>gi|254501396|ref|ZP_05113547.1| creatininase subfamily [Labrenzia alexandrii DFL-11]
 gi|222437467|gb|EEE44146.1| creatininase subfamily [Labrenzia alexandrii DFL-11]
          Length = 263

 Score =  274 bits (701), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 124/263 (47%), Positives = 175/263 (66%), Gaps = 1/263 (0%)

Query: 1   MNPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   + D +         KDWI VLP+ A EQHGPHLP+ TDT IA G  +R+  +LP
Sbjct: 1   MLPKPYWQDMTTTDFDHPEVKDWIAVLPVAAIEQHGPHLPVYTDTAIAEGQIQRVIELLP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             +P + +PV+ IG S EH+   GT T+T+  A++ WL + D+I + G+RK+V++N+HGG
Sbjct: 61  DDVPASFLPVQAIGKSNEHISSAGTLTMTWETALQAWLELGDSILRAGVRKVVVVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N PL+ I++ E R+R +ML V T+W+ F  P+G+ S  E   GIHGG++ETS+ML L P 
Sbjct: 121 NVPLIGILTRELRVRHNMLAVGTAWASFGQPEGVFSDHELTFGIHGGDVETSIMLHLRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV MD A NF S Q +    FK+LRAHG H+FGW  +DLNP G VG+A  AT +KG+  L
Sbjct: 181 LVNMDKARNFRSSQEDLASKFKHLRAHGPHAFGWKAQDLNPAGTVGDASIATAEKGKASL 240

Query: 240 SYFANCFIQLLNDINSFDVSIFD 262
            + A  F++LL D+++FD++ FD
Sbjct: 241 DHAARGFVELLQDVHAFDLAHFD 263


>gi|254472937|ref|ZP_05086335.1| creatinine amidohydrolase, putative [Pseudovibrio sp. JE062]
 gi|211957658|gb|EEA92860.1| creatinine amidohydrolase, putative [Pseudovibrio sp. JE062]
          Length = 287

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 122/263 (46%), Positives = 173/263 (65%), Gaps = 1/263 (0%)

Query: 3   PLIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   + + +      +   +WI VLP+ A EQHGPHLP+ TDT IA G   R   +LP  
Sbjct: 25  PRRFWHEMTTTDFSENDTSEWIAVLPIAAIEQHGPHLPVYTDTCIAEGQVARTVELLPDD 84

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LPVT +PV+ +G S EH    GT +LT+  A++ W+ I + + + GIRK+V+ N+HGGNS
Sbjct: 85  LPVTFLPVQAVGKSDEHHSFPGTLSLTWETAVKAWIEIGECVARAGIRKLVLANSHGGNS 144

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           PL+ I++ + R++ +ML V +SW RF  P+G+ S  E   GIHGG+IETS+MLAL P LV
Sbjct: 145 PLMDIITRDLRLKHNMLAVESSWLRFGQPEGLFSEEEFTYGIHGGDIETSIMLALRPDLV 204

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           +MD A +F+S Q++ + N  YLRAHG H +GW  +DLN  G +GNA  AT +KG+  L++
Sbjct: 205 RMDQATDFTSTQTDHINNDAYLRAHGRHQYGWMSEDLNKTGALGNASLATAEKGQASLTH 264

Query: 242 FANCFIQLLNDINSFDVSIFDKD 264
            +  FI+LL D+  FDVS F K+
Sbjct: 265 ASQEFIKLLRDVQRFDVSSFGKN 287


>gi|319796474|ref|YP_004158114.1| creatininase [Variovorax paradoxus EPS]
 gi|315598937|gb|ADU40003.1| Creatininase [Variovorax paradoxus EPS]
          Length = 273

 Score =  271 bits (693), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 98/270 (36%), Positives = 146/270 (54%), Gaps = 5/270 (1%)

Query: 1   MNP----LIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIK 55
           MNP       ++D +        R+  I VLP+GA EQHGPHLPM+TDT    G+     
Sbjct: 1   MNPPTLRSRFWSDLTSEEFSRLDRERLIAVLPVGATEQHGPHLPMSTDTATIDGMVRATL 60

Query: 56  SILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
             LP  LPV  +P  P G S EH    GT T++    I  W  I   + K G+RK+V+ N
Sbjct: 61  PHLPDDLPVLFLPTVPYGKSNEHSRYPGTLTVSANTLISLWKDIGACVAKAGVRKLVLYN 120

Query: 116 AHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
           +HGG   ++ IV+ + R    M+VV+ +W    +P+G+ +  E + GIH G++E+S+ML 
Sbjct: 121 SHGGQMSVMDIVARDLREEHDMMVVAANWYTLGLPEGLFTAHEGKHGIHAGDLESSVMLH 180

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           L P  V+ D  +NFSS   +     K+L    S   GW M D+NP G  G+A  AT +KG
Sbjct: 181 LTPDYVRKDQFQNFSSMTEQLAAENKFLSITPSGKLGWQMHDINPSGAAGDATRATAEKG 240

Query: 236 EGLLSYFANCFIQLLNDINSFDVSIFDKDV 265
             +L +    F++LL++++ F +S    + 
Sbjct: 241 AAVLDHVGRRFVELLHEVDRFPLSRLANEP 270


>gi|255076517|ref|XP_002501933.1| predicted protein [Micromonas sp. RCC299]
 gi|226517197|gb|ACO63191.1| predicted protein [Micromonas sp. RCC299]
          Length = 352

 Score =  269 bits (687), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 99/260 (38%), Positives = 147/260 (56%), Gaps = 3/260 (1%)

Query: 3   PLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   +++ +        KD +  +LP+GA EQHGPHLP+  D  I AG+  R   +LPP 
Sbjct: 48  PRRNWSEMTTNEFERLDKDRVIALLPVGATEQHGPHLPVCVDAAINAGVLNRAMELLPPE 107

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P+T +P  P G S+EH    GT +L     +  W  I +++R+ G++K+V+ N+HGG  
Sbjct: 108 IPLTRLPPLPFGKSVEHDDFAGTISLGTNTLMAAWTDIGESVRRAGVKKLVLFNSHGGQP 167

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            +  IV+ + R R  MLVV+  W  F +P+G+    E   G+HGG++ETS+ML L P LV
Sbjct: 168 QVAEIVARDLRKRLGMLVVTVDWFSFGLPEGMFDDDELRHGLHGGDVETSVMLHLHPDLV 227

Query: 182 KMDLAENFSSRQSEFLR--NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            M  A +F S   +     +FK L   G   FGW  +DLNP G  GNA  AT +KG   +
Sbjct: 228 DMSKAGDFRSAGRDMEESGDFKLLTPEGGIGFGWLAQDLNPSGATGNASKATAEKGRACV 287

Query: 240 SYFANCFIQLLNDINSFDVS 259
            + A+  + LL +++ FDV 
Sbjct: 288 EHAASRLVDLLKEVDDFDVD 307


>gi|114327494|ref|YP_744651.1| creatinine amidohydrolase family protein [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315668|gb|ABI61728.1| creatinine amidohydrolase family protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 275

 Score =  268 bits (685), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 89/262 (33%), Positives = 145/262 (55%), Gaps = 3/262 (1%)

Query: 3   PLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           PL  + D S P  A   K   I VLP+ A EQHGPHLP+  D  I  GL +     +P  
Sbjct: 6   PLRYWQDMSWPEIAALDKQAAIAVLPVAAVEQHGPHLPLWVDAAINEGLLKLALDRVPDD 65

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           + V  +P++ +G+S EH+   GT TL+    +     +  ++ + G R++V LN+HGG  
Sbjct: 66  MQVLALPMQAVGWSEEHIAFPGTLTLSADTLLAVLRDLGASVARAGFRRLVFLNSHGGQP 125

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            ++ IV+ E R+RF M V    W++  +P G+ S  E   GIHGG +ETS+M+ L P  +
Sbjct: 126 QILDIVARELRIRFGMFVTVCGWTKLGVPDGLFSPLERSTGIHGGALETSLMMHLRPDQL 185

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           ++   ++F     +   + ++L A G   + W+ +DLNP G  G+A  A+ +KG  L  +
Sbjct: 186 RLSRIDDFVPAHRD--DSHRHLSATGRIPYAWTAQDLNPGGACGDARAASAEKGRILAEH 243

Query: 242 FANCFIQLLNDINSFDVSIFDK 263
            A+ F+ LL+++  FD++   +
Sbjct: 244 LASQFVSLLHEVEKFDLARLQE 265


>gi|241113022|ref|YP_002972857.1| Creatininase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240861230|gb|ACS58896.1| Creatininase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 288

 Score =  268 bits (685), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 105/262 (40%), Positives = 156/262 (59%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + + +    A    +  I VLP+ + EQHGPHLP+ TD  IA G+   +K    
Sbjct: 24  MPTPFYWNELNTYDFAGLSPETTIAVLPIASTEQHGPHLPIATDVAIATGMLAELKRQRS 83

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L +  +P + IG + EH+Y  GT +L+    I  W AI   + + G+RK+VI+N+HGG
Sbjct: 84  EDLDILVLPTQEIGKANEHIYGPGTLSLSAELLIPVWTAIGAKVAEAGLRKMVIVNSHGG 143

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  ++SIV+ E R+R  M VVST W RF  P+G++S  E++ GIHGG++ETS+ML   P 
Sbjct: 144 NVDIMSIVARELRVRQQMAVVSTQWGRFGHPEGMVSDHESKYGIHGGDVETSLMLHFRPE 203

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+MD A+NF+S+     +  K+L+    HS  W   DLNP GVVG+A  AT +KGE + 
Sbjct: 204 LVRMDKAQNFASKAEGMRQQSKFLQPLPPHSLAWIAHDLNPLGVVGDASIATAEKGEAIC 263

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
            +    F++LL D+ ++ +S  
Sbjct: 264 RHQVKGFVELLRDLKAYPLSNL 285


>gi|330992831|ref|ZP_08316774.1| creatinine amidohydrolase family protein [Gluconacetobacter sp.
           SXCC-1]
 gi|329759985|gb|EGG76486.1| creatinine amidohydrolase family protein [Gluconacetobacter sp.
           SXCC-1]
          Length = 273

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 98/258 (37%), Positives = 150/258 (58%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           P   + D       +   + + VLP+GA EQHGPHLP+  D+ I AGL ER     P  L
Sbjct: 6   PRRYWQDMISREFRELPDNTVAVLPVGAIEQHGPHLPVCVDSCINAGLLERALERAPADL 65

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P+T +P++ +G S EH+   GT TL+    +   L +  ++ + G+R++V+LN+HGG   
Sbjct: 66  PITALPIQSVGKSDEHIAYPGTLTLSANTLLNVLLDLGASVARAGVRRLVLLNSHGGQPQ 125

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           ++ IV+ E R   ++ VV  +W RF  P+G+ S  E + GIHGG++ETS+M  L P LV+
Sbjct: 126 ILDIVARELRRTHNLFVVCVAWGRFGCPEGLFSTTELKYGIHGGDVETSLMCYLRPDLVQ 185

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           MD AENF S   E  R +K+L+A G   FGW   DL+P G  G+A  AT +KG  +   +
Sbjct: 186 MDRAENFVSWPEEMAREYKWLQAEGRVGFGWHAHDLHPAGACGDASGATAEKGRLVADQY 245

Query: 243 ANCFIQLLNDINSFDVSI 260
              F++L+ ++  + +  
Sbjct: 246 IAGFLELMAEVARYPLER 263


>gi|217977345|ref|YP_002361492.1| Creatininase [Methylocella silvestris BL2]
 gi|217502721|gb|ACK50130.1| Creatininase [Methylocella silvestris BL2]
          Length = 268

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 107/266 (40%), Positives = 153/266 (57%), Gaps = 1/266 (0%)

Query: 1   MNPLIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     +++ S     DA   + I VLP+ A EQHGPHLP+  D  I  G  E++ + LP
Sbjct: 1   MLQTRFWSEMSWTDFRDADMAEVIAVLPVAAIEQHGPHLPVGVDHFIMDGYIEQVAARLP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
           P LPV  +PV+ +G SIEH    G  +L+ A AI  W  I +++R+ G RK+V+LN+HGG
Sbjct: 61  PELPVLFLPVQSVGCSIEHADFPGALSLSAATAIRAWTEIAESVRRAGCRKLVLLNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           NS ++++++ + R R  ML V  SWSRF  P G+ S  E   G+H G+IETS+ML+  P 
Sbjct: 121 NSAILNVIAHDLRARLGMLAVMASWSRFGAPDGLFSENEKIHGVHAGDIETSLMLSFRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+M+ A +F          F +LR      FGW  +DL+  G +G+A  AT +KGE   
Sbjct: 181 LVRMEEAGDFVPESVAIENEFNWLRVGRPTGFGWMSQDLSETGAMGDAGGATARKGEACA 240

Query: 240 SYFANCFIQLLNDINSFDVSIFDKDV 265
            Y A  F++LL DI  FD+    +  
Sbjct: 241 DYGATAFVELLQDIEGFDLDRLKQGP 266


>gi|90422093|ref|YP_530463.1| creatininase [Rhodopseudomonas palustris BisB18]
 gi|90104107|gb|ABD86144.1| Creatininase [Rhodopseudomonas palustris BisB18]
          Length = 271

 Score =  264 bits (676), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 106/265 (40%), Positives = 151/265 (56%), Gaps = 1/265 (0%)

Query: 3   PLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   +T    P  AD     WI VLPL A EQHGPHLP+ TD  IA     R++++LP  
Sbjct: 6   PSRDWTAIRWPDFADTDVARWIAVLPLAATEQHGPHLPLGTDVFIAEAYLSRVRALLPAA 65

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P + +P++PIG S EH+   GT TL    AI  W AI  ++ + G+RK+VI+ +HGGNS
Sbjct: 66  VPASFLPLQPIGISTEHIGFPGTLTLPAELAIATWTAIGASVARAGLRKLVIVTSHGGNS 125

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +++V+ + R    ML V+TSWSRF  P G+    E   GIHGG +ETS+MLA  P  V
Sbjct: 126 AAMNLVAQQLRADHGMLAVTTSWSRFGGPAGLFDDEELRHGIHGGAVETSIMLAHDPQQV 185

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D   +F     E  R F+ L         W  +DLN  G +G+A  A+ + G  L+++
Sbjct: 186 RSDKIADFHPASLEIARRFQRLSTQRPAPLAWQAEDLNRSGAIGDATKASAEAGRQLIAH 245

Query: 242 FANCFIQLLNDINSFDVSIFDKDVQ 266
            A  F +LL D++ FD++ F +  Q
Sbjct: 246 GARAFCELLEDVDRFDLTTFGQTPQ 270


>gi|86359214|ref|YP_471106.1| creatinine amidohydrolase (creatininase) protein [Rhizobium etli
           CFN 42]
 gi|86283316|gb|ABC92379.1| probable creatinine amidohydrolase (creatininase) protein
           [Rhizobium etli CFN 42]
          Length = 262

 Score =  264 bits (675), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 148/261 (56%), Positives = 189/261 (72%), Gaps = 1/261 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P   F D S  +CA   +  I VLPLGA+EQHGPHLP  TDT+IA G+A R+K  LP 
Sbjct: 2   MTPSPRFDD-SGSVCAPGARRPIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKMALPA 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPV  +P E +GYSIEHM V+GTKTL + EA+  WL I + + K  IRK V+LNAHGGN
Sbjct: 61  GLPVIFLPAESVGYSIEHMDVEGTKTLAFDEAVNRWLGIAEGLAKRDIRKFVMLNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPL+S+V+TEAR+RF+ML V+TSW+RF +P G+I   E  IGIHGG+IETS+MLAL P  
Sbjct: 121 SPLISVVATEARVRFAMLAVATSWTRFGLPDGVIPPEEKAIGIHGGDIETSVMLALHPDK 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M  AE+FSSRQ+EF   FK+LRA+G H+FGW M D+N +GV GNA  AT +KGE L++
Sbjct: 181 VDMAKAEDFSSRQAEFATCFKHLRAYGPHAFGWKMSDINEQGVAGNASAATAEKGEALIA 240

Query: 241 YFANCFIQLLNDINSFDVSIF 261
           +     ++LL D+++FDVS  
Sbjct: 241 HAVKGLVELLEDVDAFDVSEL 261


>gi|222149606|ref|YP_002550563.1| creatinine amidohydrolase [Agrobacterium vitis S4]
 gi|221736588|gb|ACM37551.1| creatinine amidohydrolase [Agrobacterium vitis S4]
          Length = 266

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 111/262 (42%), Positives = 150/262 (57%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + + +    A    D  I VLP+ + EQHGPHLP+ TD  IA G+   +K   P
Sbjct: 1   MTKPFYWNELNTYDFASLSPDSTIAVLPIASTEQHGPHLPIATDVAIANGMLAELKRQRP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L    +P + IG + EH+Y  GT +L+    I  W AI   + + G+RK+VI+N+HGG
Sbjct: 61  DDLNFLVLPTQEIGKANEHVYGPGTLSLSADLLIAAWTAIGAKVAEAGLRKLVIVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  ++SIV  E R+R  M VVST WSRF  P+G+IS  E   GIHGGE+ETS+ML   P 
Sbjct: 121 NVDIMSIVGRELRVRHKMAVVSTQWSRFGNPEGMISEHENRYGIHGGEVETSLMLHFRPE 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+MD AENF S+         +L+    HS  W   DLNP GVVG+A   T +KGE + 
Sbjct: 181 LVRMDKAENFVSKAEWMKERSDFLQPLPPHSLAWIAHDLNPAGVVGDASKGTAEKGEAIC 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
            +  + FIQLL D+  + +S  
Sbjct: 241 RHQVSGFIQLLRDVRDYPLSAL 262


>gi|116248972|ref|YP_764813.1| putative creatinine amidohydrolase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115253622|emb|CAK12015.1| putative creatinine amidohydrolase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 272

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 103/262 (39%), Positives = 155/262 (59%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + + +    A    +  I +LP+ + EQHGPHLP+ TD  IA G+   +K   P
Sbjct: 8   MPTPFYWNELNTYDFAGLSPETTIAILPIASTEQHGPHLPIATDVAIATGMLAELKRQRP 67

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L +  +P + IG + EH+Y  GT +L     I  W AI   + + G+RK+VI+N+HGG
Sbjct: 68  EDLDMLVLPTQEIGKANEHIYGPGTLSLGAELLIPVWTAIGAKVAEAGLRKMVIVNSHGG 127

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  ++SIV+ E R+ + M VVST W RF  P+G++S  E++ GIHGG++ETS+ML   P 
Sbjct: 128 NVDIMSIVARELRVHYQMAVVSTQWGRFGHPEGMVSDHESKYGIHGGDVETSLMLHFRPE 187

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+MD A+NF+S+        ++L+    HS  W   DLNP GVVG+A  AT +KGE + 
Sbjct: 188 LVRMDKAQNFASKAERMREQSRFLQPLPPHSLAWIAHDLNPFGVVGDASIATAEKGEAIC 247

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
            +    F++LL D+ ++ +S  
Sbjct: 248 RHQVKGFVELLRDLKAYPLSNL 269


>gi|239818090|ref|YP_002947000.1| Creatininase [Variovorax paradoxus S110]
 gi|239804667|gb|ACS21734.1| Creatininase [Variovorax paradoxus S110]
          Length = 273

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 95/270 (35%), Positives = 143/270 (52%), Gaps = 5/270 (1%)

Query: 1   MNP----LIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIK 55
           MNP       ++  +        R+  I VLP+GA EQHGPHLPM+TDT    G+     
Sbjct: 1   MNPHPLRSRFWSALTSEEFSRLDRERLIAVLPVGATEQHGPHLPMSTDTATIDGMVRATL 60

Query: 56  SILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
             LP  LPV  +P    G S EH    GT T++    I  W  I   + K G+RK+V+ N
Sbjct: 61  PHLPGDLPVLFLPTVAYGKSNEHSRYPGTLTVSATTLIALWKDIGACVAKAGVRKLVLYN 120

Query: 116 AHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
           +HGG   ++ IV+ + R    M+VV+ +W    +P+G+ +  E + GIH G++E+S+ML 
Sbjct: 121 SHGGQMSVMDIVARDLREEHGMMVVAANWYTLGLPEGLFTAHEGKHGIHAGDLESSVMLH 180

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           LAP+ V+ D   NF S   +     ++L    S   GW M D+NP G  G+A  AT +KG
Sbjct: 181 LAPNDVRPDQFRNFRSMTEDLAAENQFLSITPSGKLGWQMHDINPAGAAGDATRATAEKG 240

Query: 236 EGLLSYFANCFIQLLNDINSFDVSIFDKDV 265
             +L +    F++LL +++ F +S    + 
Sbjct: 241 AAVLDHVGRRFVELLQEVDRFPLSRLANEP 270


>gi|146337820|ref|YP_001202868.1| putative creatinine amidohydrolase [Bradyrhizobium sp. ORS278]
 gi|146190626|emb|CAL74628.1| Conserved hypothetical protein; putative creatinine amidohydrolase
           (=creatininase) [Bradyrhizobium sp. ORS278]
          Length = 275

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 112/264 (42%), Positives = 156/264 (59%), Gaps = 1/264 (0%)

Query: 3   PLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   +T+ S P         WI VLPL A EQHGPHLP+ TD  IA     R++++LPP 
Sbjct: 8   PPRDWTEISWPDLETPDASSWIAVLPLAATEQHGPHLPLGTDVYIAEAYLARVRALLPPA 67

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LPVT +PV+P+G S EH+   GT T+    A++ W A+ D++ + G+RK+VI+ +HGGNS
Sbjct: 68  LPVTVLPVQPVGISTEHIDFPGTLTVPTETALQSWRALGDSVARAGLRKLVIVTSHGGNS 127

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +++V+ + R    MLVV+TSWSRF  P+G+ S  E   GIHGG +ETS+MLA  P LV
Sbjct: 128 AAMTLVAQDLRAAHRMLVVTTSWSRFGAPEGLFSADELRHGIHGGAVETSIMLARHPQLV 187

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + +   +F S      R  + L       F W  +DLN  G VG+A  A+ +KGE +L +
Sbjct: 188 RGNAIADFVSSAVATERANRVLSTQRPAPFAWQTQDLNASGAVGDATQASAEKGERVLDH 247

Query: 242 FANCFIQLLNDINSFDVSIFDKDV 265
            A  F  LL DI+ FDV+      
Sbjct: 248 GAAAFCALLEDIDKFDVNTLATGP 271


>gi|328542404|ref|YP_004302513.1| Creatininase subfamily [polymorphum gilvum SL003B-26A1]
 gi|326412151|gb|ADZ69214.1| Creatininase subfamily [Polymorphum gilvum SL003B-26A1]
          Length = 269

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 122/260 (46%), Positives = 170/260 (65%), Gaps = 1/260 (0%)

Query: 3   PLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           PL  + + +    AD + KDWI VLP+ A EQHGPHLP+ TDT IA G   R   +LP  
Sbjct: 5   PLRYWHEMTTLDFADPSVKDWIAVLPVAAIEQHGPHLPVFTDTAIAIGQVRRTLDMLPAD 64

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P T +PV+ IG S EH+   GT TL++      WL I  ++ + GIRK+VI+N+HGGN 
Sbjct: 65  IPATFLPVQAIGKSNEHISSPGTLTLSWDTVTRAWLEIGHSVARAGIRKLVIINSHGGNV 124

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           P++ IV+ E R+   MLV +T+WSRF  P+G+    E   GIHGG++ETS+ML L P LV
Sbjct: 125 PIIDIVARELRVTHEMLVTATAWSRFGQPEGLFPSEEFTYGIHGGDVETSLMLHLHPELV 184

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           +M+LAE+F+S Q +F++ FKYLR HG   FGW  +DL  KG +GNA +A+  KG   L +
Sbjct: 185 RMELAEDFTSAQQDFIKEFKYLRGHGQQQFGWKAQDLGAKGALGNAANASADKGRASLDH 244

Query: 242 FANCFIQLLNDINSFDVSIF 261
            A  F++LL D+++FD+   
Sbjct: 245 AAREFVELLKDVHAFDIKRL 264


>gi|323136933|ref|ZP_08072013.1| Creatininase [Methylocystis sp. ATCC 49242]
 gi|322397694|gb|EFY00216.1| Creatininase [Methylocystis sp. ATCC 49242]
          Length = 263

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 154/262 (58%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     +++ SL         + I VLP+ A EQHGPHLP+  D +I  G  ER+   LP
Sbjct: 1   MLASPYWSELSLRDMRAHDMANVIAVLPIAAVEQHGPHLPLGVDAMIMEGCIERVSMRLP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L    +PV+ +G SIEH    GT +L+   A      I + + + G++K+V++N+HGG
Sbjct: 61  EDLEAVFLPVQSVGVSIEHRDFPGTLSLSQETAARMLGEIAEGVVRAGVKKLVLMNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           NS L+S V+ + R RF +L V+ SW+RF  P G+    E   GIHGGEIETS+MLA  P 
Sbjct: 121 NSALISQVALDLRARFGVLAVTCSWARFGYPDGLFPAQEQRHGIHGGEIETSLMLAFRPE 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV M  A+NF     +F R+F +LRA     FGW  +DL+P G +G+A  AT  KGE + 
Sbjct: 181 LVDMARAKNFPPATLDFERDFAWLRADRPAGFGWMAQDLSPAGAMGDATKATAGKGEAVA 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
            Y+A  FI+LL DI SFD+  F
Sbjct: 241 DYWATAFIELLRDIESFDLERF 262


>gi|17988654|ref|NP_541287.1| creatininase [Brucella melitensis bv. 1 str. 16M]
 gi|225629438|ref|ZP_03787471.1| creatininase [Brucella ceti str. Cudo]
 gi|294853940|ref|ZP_06794612.1| creatinine amidohydrolase [Brucella sp. NVSL 07-0026]
 gi|17984460|gb|AAL53551.1| creatininase [Brucella melitensis bv. 1 str. 16M]
 gi|225615934|gb|EEH12983.1| creatininase [Brucella ceti str. Cudo]
 gi|294819595|gb|EFG36595.1| creatinine amidohydrolase [Brucella sp. NVSL 07-0026]
          Length = 277

 Score =  262 bits (670), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 135/255 (52%), Positives = 181/255 (70%)

Query: 8   TDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           ++ ++    D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +
Sbjct: 18  SEKNMTDLRDQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFL 77

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P +P+GYSIEHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV
Sbjct: 78  PAQPVGYSIEHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIV 137

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
           +TE R R  ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A 
Sbjct: 138 ATELRTRLDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKAR 197

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
           NF + QS+F   FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE LL++  + FI
Sbjct: 198 NFPNAQSQFAEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASAQAGEKLLAHAVSGFI 257

Query: 248 QLLNDINSFDVSIFD 262
            LL D++ F+++ F+
Sbjct: 258 DLLRDVDRFELARFN 272


>gi|153011189|ref|YP_001372403.1| creatininase [Ochrobactrum anthropi ATCC 49188]
 gi|151563077|gb|ABS16574.1| Creatininase [Ochrobactrum anthropi ATCC 49188]
          Length = 266

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 88/263 (33%), Positives = 139/263 (52%), Gaps = 1/263 (0%)

Query: 4   LIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
              ++D +        R+  + VLP+GA EQHGPHLP+  D  I  G+ +   + LP   
Sbjct: 2   KRYWSDYTSEAFSRLDREKLVAVLPVGAIEQHGPHLPLAVDAAIVDGMVKETIARLPETS 61

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
               +P + IG S EH    GT T +    I  W  I   +   G+RK+ +LN+HGG   
Sbjct: 62  HALFLPTQAIGKSNEHSRYPGTLTFSAETIIRMWCEIGACVAASGVRKMALLNSHGGQIS 121

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           ++ IV+ E R+R +MLVVS +W    +P+G+ S  + + GIH G++ETS+ML + P LV 
Sbjct: 122 VMDIVARELRIRHNMLVVSINWFGLGMPEGVYSDHDLKHGIHAGDMETSVMLEMHPDLVD 181

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           M   ++F +    F  +F++L   G     W ++D+NP G  G+A  AT +KG   + + 
Sbjct: 182 MSKVQDFRTLTETFASDFQHLSLSGGAKPAWQIQDINPYGAAGDATLATAEKGRATIDFA 241

Query: 243 ANCFIQLLNDINSFDVSIFDKDV 265
           A   +++L +I    +S  D   
Sbjct: 242 AERLVEVLAEIERAPLSWLDNKP 264


>gi|316931547|ref|YP_004106529.1| creatininase [Rhodopseudomonas palustris DX-1]
 gi|315599261|gb|ADU41796.1| Creatininase [Rhodopseudomonas palustris DX-1]
          Length = 270

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 108/265 (40%), Positives = 158/265 (59%), Gaps = 1/265 (0%)

Query: 3   PLIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   +     P  AD++ + WI VLPL A EQHGPHLP++TD  IA     R+  +LP  
Sbjct: 5   PPRDWCAIRWPEIADSQPERWIAVLPLAATEQHGPHLPLSTDVDIAEAYLARVHDLLPAE 64

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LP + +P++ IG S EH+   GT TL+   A+  W  I D+I + G+RK+V++ +HGGNS
Sbjct: 65  LPASFLPLQAIGLSTEHLAFPGTLTLSAETALRVWTEIGDSIARAGVRKLVMVTSHGGNS 124

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             + +V+ E R R  MLVV+T W+RF +P G+ +  E   GIHGG +ETS+MLA AP LV
Sbjct: 125 AAMGLVAQELRARHRMLVVTTGWARFGVPDGLFAADELRHGIHGGAVETSIMLAHAPALV 184

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D    F        + +++L A     F W+ +DL+P G +G+A  AT +KG  LL +
Sbjct: 185 RTDRLAEFRPASVAMEQQYRWLSAQRPAPFAWAAEDLHPGGAIGDATAATAEKGRQLLDH 244

Query: 242 FANCFIQLLNDINSFDVSIFDKDVQ 266
            A  F +LL+DI+ FD++      +
Sbjct: 245 GARAFCELLDDIHRFDLAALSNTPR 269


>gi|91974743|ref|YP_567402.1| creatininase [Rhodopseudomonas palustris BisB5]
 gi|91681199|gb|ABE37501.1| Creatininase [Rhodopseudomonas palustris BisB5]
          Length = 270

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 107/265 (40%), Positives = 156/265 (58%), Gaps = 1/265 (0%)

Query: 3   PLIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   +T+   P   DA    WI VLPL A EQHGPHLP+ TD +IA     R+  +LP  
Sbjct: 5   PPRDWTEIRWPEIGDADPARWIAVLPLAATEQHGPHLPLGTDVMIARAYLARVHELLPAE 64

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LPV+ +P++PIG S EH+   GT TL    A+  W  I D++ + G+RK+V++ +HGGNS
Sbjct: 65  LPVSFLPLQPIGLSTEHLAFPGTLTLGTETALRLWTEIGDSVARAGVRKLVMVTSHGGNS 124

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +S+V+ E R R +ML V+T W+RF +P G+ +  E   GIHGG +ETS+MLA AP  V
Sbjct: 125 AAMSLVAQELRARHAMLAVTTGWARFGLPDGLFADDELRHGIHGGAVETSIMLAHAPQQV 184

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D   +F    +     F++L A     F W+ +DL+P G +G+A  A+  KG   L +
Sbjct: 185 RTDRIADFRPATAAMEHEFRWLSAQRPAPFAWAAQDLHPSGAIGDATAASADKGRKALDH 244

Query: 242 FANCFIQLLNDINSFDVSIFDKDVQ 266
            A  F +LL D++ FD++      +
Sbjct: 245 GARAFCELLADVDRFDLATLRPAPR 269


>gi|306846191|ref|ZP_07478753.1| creatininase [Brucella sp. BO1]
 gi|306273442|gb|EFM55303.1| creatininase [Brucella sp. BO1]
          Length = 256

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 134/251 (53%), Positives = 178/251 (70%)

Query: 13  PLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI 72
               D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+
Sbjct: 2   TDLRDQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPGDLNVNFLPAQPV 61

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           GYSIEHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R
Sbjct: 62  GYSIEHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELR 121

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            R  ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + 
Sbjct: 122 TRLDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMTKARNFPNA 181

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           QS+F   FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE L+++  + FI LL D
Sbjct: 182 QSQFAEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASAQAGEKLIAHAVSGFIDLLRD 241

Query: 253 INSFDVSIFDK 263
           ++ F+++ F++
Sbjct: 242 VDRFELARFNR 252


>gi|218516320|ref|ZP_03513160.1| probable creatininase protein [Rhizobium etli 8C-3]
          Length = 265

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 107/262 (40%), Positives = 151/262 (57%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + + +    A    D  I +LP+ + EQHGPHLP+ TD  IA G+   ++   P
Sbjct: 1   MAMPFYWNELNTDDFAGLSPDTTIAILPIASTEQHGPHLPIATDVAIANGMLAELRKQKP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L    +P + IG + EH+Y  GT +L+    I  W AI   + + GIRK+VI+N+HGG
Sbjct: 61  ADLDFLVLPTQEIGKANEHVYGPGTLSLSAELLIPVWTAIGAKVAEAGIRKMVIVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  ++SIV+ E R+   M VVST W RF  P+G+I   E + GIHGGE+ETS+ML   P 
Sbjct: 121 NVDIMSIVARELRVLHQMAVVSTQWGRFGHPEGMIGEHELKYGIHGGEVETSLMLHFRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+MD AENF+S+        KY++    HS  W   DLNP GVVG+A   T +KGE + 
Sbjct: 181 LVRMDKAENFTSKAEWMRGQSKYIQPLPPHSLAWIAHDLNPNGVVGDASLGTAEKGEAIC 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
            +    FI+LL+D+  + +S  
Sbjct: 241 RHQVTGFIELLHDLKRYPLSNL 262


>gi|39933548|ref|NP_945824.1| creatininase [Rhodopseudomonas palustris CGA009]
 gi|39647394|emb|CAE25915.1| putative creatine amidohydrolase [Rhodopseudomonas palustris
           CGA009]
          Length = 270

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 107/264 (40%), Positives = 154/264 (58%), Gaps = 1/264 (0%)

Query: 3   PLIIFTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   ++    P  A A    WI VLPL A EQHGPHLP++TD  IA     R++  L   
Sbjct: 5   PPRDWSAIYWPEIAGADPSRWIAVLPLAAIEQHGPHLPLSTDVTIAEAYLARVRERLRDD 64

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P T +PV+ IG S EH+   GT TL+   A++ W  I D+I + G+RK+V++ +HGGNS
Sbjct: 65  IPATFLPVQAIGLSTEHLSFPGTLTLSTETALKLWTEIGDSIARAGVRKLVMVTSHGGNS 124

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             + +V+ E R R  MLVV+T W+RF +P G+ +  E   GIHGG  ETS+MLA AP LV
Sbjct: 125 AAMGLVAQELRARHQMLVVTTGWARFGMPDGLFAADELRHGIHGGATETSIMLAHAPELV 184

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D   +F        + +++L A     F W+ +DL+P G +G+A  AT +KG  LL +
Sbjct: 185 RADRIADFRPTSVAMEQTYRWLSAQRPAPFAWAAEDLHPSGAIGDASAATAEKGRRLLDH 244

Query: 242 FANCFIQLLNDINSFDVSIFDKDV 265
            A  F +LL D++ FD++      
Sbjct: 245 GAGAFCELLADMHRFDLAALSIQP 268


>gi|241206367|ref|YP_002977463.1| creatininase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860257|gb|ACS57924.1| Creatininase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 262

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 149/261 (57%), Positives = 192/261 (73%), Gaps = 1/261 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P   F D S P      +  I VLPLGA+EQHGPHLP  TDT+IA G+A R+K  LP 
Sbjct: 2   MTPSPRFED-SNPASTPDGRHLIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKIALPA 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPVT +P E +GYSIEHM V+GTKTL + EA+  WL I + + K GIRK+V+LNAHGGN
Sbjct: 61  GLPVTFLPAESVGYSIEHMDVEGTKTLAFDEAVNRWLGIAEGLAKQGIRKLVMLNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SP+V+IV+TEAR+RF+ML V+TSW+RF +P G+++  E  IGIHGG+IETS+MLAL P  
Sbjct: 121 SPIVTIVATEARLRFAMLAVATSWTRFGLPDGVVTPEEKAIGIHGGDIETSVMLALHPDK 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M  A NFSSRQ+EF   FK+LRA+G H+FGW M DLN +GV GNA  ATV+KGE L++
Sbjct: 181 VDMAKAANFSSRQTEFAERFKHLRAYGPHAFGWKMSDLNAEGVAGNAAAATVEKGEALIA 240

Query: 241 YFANCFIQLLNDINSFDVSIF 261
           +     ++LL+D+++FDV+  
Sbjct: 241 HAVKGLVELLSDVDAFDVAQL 261


>gi|86357667|ref|YP_469559.1| creatininase (creatinine amidohydrolase) protein [Rhizobium etli
           CFN 42]
 gi|86281769|gb|ABC90832.1| probable creatininase (creatinine amidohydrolase) protein
           [Rhizobium etli CFN 42]
          Length = 265

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 104/262 (39%), Positives = 149/262 (56%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + +           D  I +LP+ + EQHGPHLP+ TD  IA G+   ++   P
Sbjct: 1   MTVPFYWNELVSDDFTGLSPDTTIAILPIASTEQHGPHLPIATDVAIAEGMLAELRKQKP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L    +P + IG + EH+Y  GT +L     I  W AI   + + GIRK+VI+N+HGG
Sbjct: 61  VDLDCLVLPTQEIGKANEHIYGPGTLSLGAELLIPVWTAIGAKVAEAGIRKMVIINSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  ++SIV+ E R+R++M V+ST W RF  P G+IS  E + GIHGGE+ETS+ML   P 
Sbjct: 121 NVDIMSIVARELRVRYAMAVISTQWGRFGHPGGMISEHELKYGIHGGEVETSLMLHFRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+M+ A+NF S+ +       Y++    HS  W   DLNP GVVG+A   T +KGE + 
Sbjct: 181 LVRMEKAQNFKSKAAWMREQSNYIQPLPPHSLAWIAHDLNPNGVVGDASRGTAEKGEAIC 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
            +    FI+LL D+  + +S  
Sbjct: 241 RHQVKGFIELLCDLKRYPLSSL 262


>gi|315121832|ref|YP_004062321.1| creatinine amidohydrolase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495234|gb|ADR51833.1| creatinine amidohydrolase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 268

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 197/265 (74%), Positives = 223/265 (84%), Gaps = 2/265 (0%)

Query: 1   MNPLIIFTDN-SLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           +NPL+ F DN       D  KDWIVVLPLGAYEQHGPHLPM+TDTIIA GL ER+  ILP
Sbjct: 2   VNPLVRFADNFPSLDVGD-HKDWIVVLPLGAYEQHGPHLPMDTDTIIAKGLVERVIGILP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             LPVT MPVE IGYSIEHMY  GTKTL+YAEAIE WL+II+ I+K+GIRK+VILNAHGG
Sbjct: 61  STLPVTFMPVESIGYSIEHMYAHGTKTLSYAEAIERWLSIINEIQKLGIRKVVILNAHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           NSPLVSIVSTEAR+RFS+L VSTSWSRF  P  I+   E  I IHGGEIETSMML LAPH
Sbjct: 121 NSPLVSIVSTEARVRFSVLAVSTSWSRFGFPHDIVLSSERGIDIHGGEIETSMMLVLAPH 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LVKMDL++NFSSRQSEFL+NF YLRA+G HSFGW+M+DLNP+GVVGNAM AT +KGE LL
Sbjct: 181 LVKMDLSKNFSSRQSEFLQNFTYLRAYGPHSFGWTMEDLNPEGVVGNAMIATFEKGESLL 240

Query: 240 SYFANCFIQLLNDINSFDVSIFDKD 264
           S++ANCF+QLL DIN FDVS+FDK+
Sbjct: 241 SHYANCFVQLLEDINVFDVSLFDKN 265


>gi|115522139|ref|YP_779050.1| creatininase [Rhodopseudomonas palustris BisA53]
 gi|115516086|gb|ABJ04070.1| Creatininase [Rhodopseudomonas palustris BisA53]
          Length = 270

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 111/265 (41%), Positives = 155/265 (58%), Gaps = 1/265 (0%)

Query: 3   PLIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   +T    P   A     WI VLPL A EQHGPHLP+ TD  IA     R+  +LP  
Sbjct: 5   PPRDWTAIRWPDFTAADPARWIAVLPLAATEQHGPHLPLGTDVTIAQAYLTRVHELLPAD 64

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LPV+ +P++PIG S EH+   GT TL  A AIE W AI D++ + G+RK+V++ +HGGNS
Sbjct: 65  LPVSFLPLQPIGISTEHIDYPGTLTLPPAVAIESWSAIGDSVARAGVRKLVLVTSHGGNS 124

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +++V+ E R R  ML V+TSWSRF +P+G+    E   GIHGG +ETS+MLA AP  V
Sbjct: 125 AAMALVAQELRARHRMLAVTTSWSRFGVPEGLFDAEELRHGIHGGAVETSIMLAHAPDQV 184

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D   +F S      +  + L         W  +DL+P G VG+A  A+ +KG  L+ +
Sbjct: 185 RTDKIAHFQSAGIAIAQQHRLLSTQRPAPLAWQAQDLHPSGAVGDATQASAQKGRQLIDH 244

Query: 242 FANCFIQLLNDINSFDVSIFDKDVQ 266
            A  F  LL+D++ FD++   +  Q
Sbjct: 245 GARAFCDLLDDVDRFDLAALGRLPQ 269


>gi|218672053|ref|ZP_03521722.1| probable creatininase protein [Rhizobium etli GR56]
          Length = 265

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 104/262 (39%), Positives = 150/262 (57%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + + +    A    D  I +LP+ + EQHGPHLP+ TD  IA G+   ++   P
Sbjct: 1   MALPFYWNELNTYDFAGLSPDTTIAILPIASTEQHGPHLPIATDVAIANGMLAELRKQKP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L    +P + IG + EH++  GT +L+    I  W AI   + + GIRK+VI+N+HGG
Sbjct: 61  EDLDFLVLPTQEIGKANEHIHGPGTLSLSAELLIPVWTAIGAKVAETGIRKMVIVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  ++SIV+ E R+R  M V+ST W RF  P+G+I   E + GIHGGE+ETS+ML   P 
Sbjct: 121 NVDIMSIVARELRVRCQMAVISTQWGRFGHPEGMIGEHEMKYGIHGGEVETSLMLHFRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+MD A+NF+S+     +  KY++    HS  W   DLNP GVVG+A   T  KGE + 
Sbjct: 181 LVRMDKAQNFTSKAEWMRQQSKYIQPLPPHSLAWIAHDLNPNGVVGDASLGTAGKGEAIC 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
            +    F+ LL D+  + +S  
Sbjct: 241 RHQVKGFVDLLYDLKRYPLSNL 262


>gi|85713473|ref|ZP_01044463.1| creatininase [Nitrobacter sp. Nb-311A]
 gi|85699377|gb|EAQ37244.1| creatininase [Nitrobacter sp. Nb-311A]
          Length = 272

 Score =  258 bits (660), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 108/266 (40%), Positives = 159/266 (59%), Gaps = 1/266 (0%)

Query: 2   NPLIIFTDNSLP-LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
            P   +     P + A+   +WI VLPL A EQHGPHLP+ TD +IA     +++ +LP 
Sbjct: 4   TPPFDWLTMHWPGVAAENAANWIAVLPLAATEQHGPHLPLTTDVLIAEAYIAKVRELLPQ 63

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            +P T +PV+P+G S EHM   GT+TLT   A+  W A+ + + + GI+KIV++++HGGN
Sbjct: 64  DIPATFLPVQPVGISTEHMDFPGTRTLTNEAALRAWTALGEEVARRGIKKIVMVSSHGGN 123

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           S  +S+V+ + R R  ML VST+WSRF +P G+    E   GIHGG +ETS+MLA  P  
Sbjct: 124 SAAMSMVAQDLRARHRMLAVSTAWSRFGVPDGLFDAQELRHGIHGGAVETSIMLARYPDQ 183

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+ D   +FS       + +++L       F W  +DL+P G VG+A  A+ +KGE LL+
Sbjct: 184 VRSDCIADFSPASIAIEKTYRWLGTRRPAPFAWQAQDLHPSGAVGDATLASAEKGERLLA 243

Query: 241 YFANCFIQLLNDINSFDVSIFDKDVQ 266
           + A  F +LL DI  FD ++     +
Sbjct: 244 HGARAFCELLADIMKFDPAVLTDGPR 269


>gi|190894439|ref|YP_001984732.1| putative creatininase [Rhizobium etli CIAT 652]
 gi|190700100|gb|ACE94182.1| probable creatininase protein [Rhizobium etli CIAT 652]
          Length = 265

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 107/262 (40%), Positives = 151/262 (57%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + + +    A    D  I +LP+ + EQHGPHLP+ TD  IA G+   ++   P
Sbjct: 1   MAMPFYWNELNTGDFAGLSPDTTIAILPIASTEQHGPHLPIATDVAIANGMLAELRKQKP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L    +P + IG + EH+Y  GT +L+    I  W AI   + + GIRK+VI+N+HGG
Sbjct: 61  ADLDFLVLPTQEIGKANEHVYGPGTLSLSAELLIPVWTAIGAKVAEAGIRKMVIVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  ++SIV+ E R+   M VVST W RF  P+G+I   E + GIHGGE+ETS+ML   P 
Sbjct: 121 NVDIMSIVARELRVLHQMAVVSTQWGRFGHPEGMIGEHELKYGIHGGEVETSLMLHFRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+MD AENF+S+        KY++    HS  W   DLNP GVVG+A   T +KGE + 
Sbjct: 181 LVRMDKAENFTSKAEWMRGQSKYIQPLPPHSLAWIAHDLNPNGVVGDASLGTAEKGEAIC 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
            +    FI+LL+D+  + +S  
Sbjct: 241 RHQVTGFIELLHDLKRYPLSNL 262


>gi|62317193|ref|YP_223046.1| creatinine amidohydrolase [Brucella abortus bv. 1 str. 9-941]
 gi|83269173|ref|YP_418464.1| creatininase [Brucella melitensis biovar Abortus 2308]
 gi|148558724|ref|YP_001257903.1| putative creatinine amidohydrolase [Brucella ovis ATCC 25840]
 gi|163845101|ref|YP_001622756.1| hypothetical protein BSUIS_B0981 [Brucella suis ATCC 23445]
 gi|189022454|ref|YP_001932195.1| Creatininase [Brucella abortus S19]
 gi|225686743|ref|YP_002734715.1| creatininase [Brucella melitensis ATCC 23457]
 gi|237816753|ref|ZP_04595745.1| creatinine amidohydrolase [Brucella abortus str. 2308 A]
 gi|254690695|ref|ZP_05153949.1| creatininase [Brucella abortus bv. 6 str. 870]
 gi|254698475|ref|ZP_05160303.1| creatininase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700183|ref|ZP_05162011.1| creatininase [Brucella suis bv. 5 str. 513]
 gi|254705553|ref|ZP_05167381.1| creatininase [Brucella pinnipedialis M163/99/10]
 gi|254710784|ref|ZP_05172595.1| creatininase [Brucella pinnipedialis B2/94]
 gi|254712743|ref|ZP_05174554.1| creatininase [Brucella ceti M644/93/1]
 gi|254715811|ref|ZP_05177622.1| creatininase [Brucella ceti M13/05/1]
 gi|254731922|ref|ZP_05190500.1| creatininase [Brucella abortus bv. 4 str. 292]
 gi|256015746|ref|YP_003105755.1| creatinine amidohydrolase, putative [Brucella microti CCM 4915]
 gi|256029167|ref|ZP_05442781.1| creatininase [Brucella pinnipedialis M292/94/1]
 gi|256043855|ref|ZP_05446776.1| creatininase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256058852|ref|ZP_05449068.1| creatininase [Brucella neotomae 5K33]
 gi|256157359|ref|ZP_05455277.1| creatininase [Brucella ceti M490/95/1]
 gi|256253661|ref|ZP_05459197.1| creatininase [Brucella ceti B1/94]
 gi|256255877|ref|ZP_05461413.1| creatininase [Brucella abortus bv. 9 str. C68]
 gi|256262122|ref|ZP_05464654.1| creatininase [Brucella melitensis bv. 2 str. 63/9]
 gi|260167740|ref|ZP_05754551.1| creatininase [Brucella sp. F5/99]
 gi|260544432|ref|ZP_05820253.1| creatininase [Brucella abortus NCTC 8038]
 gi|260565031|ref|ZP_05835516.1| creatininase [Brucella melitensis bv. 1 str. 16M]
 gi|260756271|ref|ZP_05868619.1| creatininase [Brucella abortus bv. 6 str. 870]
 gi|260759698|ref|ZP_05872046.1| creatininase [Brucella abortus bv. 4 str. 292]
 gi|260762939|ref|ZP_05875271.1| creatininase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882093|ref|ZP_05893707.1| creatininase [Brucella abortus bv. 9 str. C68]
 gi|261217572|ref|ZP_05931853.1| creatinase [Brucella ceti M13/05/1]
 gi|261220795|ref|ZP_05935076.1| creatininase [Brucella ceti B1/94]
 gi|261312960|ref|ZP_05952157.1| creatininase [Brucella pinnipedialis M163/99/10]
 gi|261318355|ref|ZP_05957552.1| creatinase [Brucella pinnipedialis B2/94]
 gi|261320449|ref|ZP_05959646.1| creatinase [Brucella ceti M644/93/1]
 gi|261322790|ref|ZP_05961987.1| creatininase [Brucella neotomae 5K33]
 gi|261750676|ref|ZP_05994385.1| creatininase [Brucella suis bv. 5 str. 513]
 gi|261757174|ref|ZP_06000883.1| creatininase [Brucella sp. F5/99]
 gi|265986154|ref|ZP_06098711.1| creatininase [Brucella pinnipedialis M292/94/1]
 gi|265990276|ref|ZP_06102833.1| creatininase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995848|ref|ZP_06108405.1| creatininase [Brucella ceti M490/95/1]
 gi|297249245|ref|ZP_06932946.1| creatinine amidohydrolase [Brucella abortus bv. 5 str. B3196]
 gi|62197386|gb|AAX75685.1| hypothetical creatinine amidohydrolase [Brucella abortus bv. 1 str.
           9-941]
 gi|82939447|emb|CAJ12413.1| Creatininase [Brucella melitensis biovar Abortus 2308]
 gi|148370009|gb|ABQ62881.1| putative creatinine amidohydrolase [Brucella ovis ATCC 25840]
 gi|163675824|gb|ABY39934.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021028|gb|ACD73749.1| Creatininase [Brucella abortus S19]
 gi|225642848|gb|ACO02761.1| Creatininase [Brucella melitensis ATCC 23457]
 gi|237787566|gb|EEP61782.1| creatinine amidohydrolase [Brucella abortus str. 2308 A]
 gi|255998406|gb|ACU50093.1| creatinine amidohydrolase, putative [Brucella microti CCM 4915]
 gi|260097703|gb|EEW81577.1| creatininase [Brucella abortus NCTC 8038]
 gi|260152674|gb|EEW87767.1| creatininase [Brucella melitensis bv. 1 str. 16M]
 gi|260670016|gb|EEX56956.1| creatininase [Brucella abortus bv. 4 str. 292]
 gi|260673360|gb|EEX60181.1| creatininase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676379|gb|EEX63200.1| creatininase [Brucella abortus bv. 6 str. 870]
 gi|260871621|gb|EEX78690.1| creatininase [Brucella abortus bv. 9 str. C68]
 gi|260919379|gb|EEX86032.1| creatininase [Brucella ceti B1/94]
 gi|260922661|gb|EEX89229.1| creatinase [Brucella ceti M13/05/1]
 gi|261293139|gb|EEX96635.1| creatinase [Brucella ceti M644/93/1]
 gi|261297578|gb|EEY01075.1| creatinase [Brucella pinnipedialis B2/94]
 gi|261298770|gb|EEY02267.1| creatininase [Brucella neotomae 5K33]
 gi|261301986|gb|EEY05483.1| creatininase [Brucella pinnipedialis M163/99/10]
 gi|261737158|gb|EEY25154.1| creatininase [Brucella sp. F5/99]
 gi|261740429|gb|EEY28355.1| creatininase [Brucella suis bv. 5 str. 513]
 gi|262550145|gb|EEZ06306.1| creatininase [Brucella ceti M490/95/1]
 gi|263000945|gb|EEZ13635.1| creatininase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263091823|gb|EEZ16145.1| creatininase [Brucella melitensis bv. 2 str. 63/9]
 gi|264658351|gb|EEZ28612.1| creatininase [Brucella pinnipedialis M292/94/1]
 gi|297173114|gb|EFH32478.1| creatinine amidohydrolase [Brucella abortus bv. 5 str. B3196]
 gi|326411146|gb|ADZ68210.1| Creatininase [Brucella melitensis M28]
 gi|326554438|gb|ADZ89077.1| Creatininase [Brucella melitensis M5-90]
          Length = 256

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 135/250 (54%), Positives = 177/250 (70%)

Query: 13  PLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI 72
               D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+
Sbjct: 2   TDLRDQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPV 61

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           GYSIEHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R
Sbjct: 62  GYSIEHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELR 121

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            R  ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + 
Sbjct: 122 TRLDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNA 181

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           QS+F   FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE LL++  + FI LL D
Sbjct: 182 QSQFAEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASAQAGEKLLAHAVSGFIDLLRD 241

Query: 253 INSFDVSIFD 262
           ++ F+++ F+
Sbjct: 242 VDRFELARFN 251


>gi|327188276|gb|EGE55496.1| putative creatininase protein [Rhizobium etli CNPAF512]
          Length = 265

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 108/262 (41%), Positives = 151/262 (57%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + + S    A    D  I +LP+ + EQHGPHLP+ TD  IA G+   ++   P
Sbjct: 1   MAMPFYWNELSTGDFAGLSPDTTIAILPIASTEQHGPHLPIATDVAIANGMLAELRKQKP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L    +P + IG + EH+Y  GT +L+    I  W AI   + + GIRK+VI+N+HGG
Sbjct: 61  ADLDFLVLPTQEIGKANEHVYGPGTLSLSAELLIPVWTAIGAKVAEAGIRKMVIVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  ++SIV+ E R+   M VVST W RF  P+G+I   E + GIHGGE+ETS+ML   P 
Sbjct: 121 NVDIMSIVARELRVLHQMAVVSTQWGRFGHPEGMIGEHELKYGIHGGEVETSLMLHFRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+MD AENF+S+        KY++    HS  W   DLNP GVVG+A   T +KGE + 
Sbjct: 181 LVRMDKAENFTSKAEWMRGQSKYIQPLPPHSLAWIAHDLNPNGVVGDASRGTAEKGEAIC 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
            +    FI+LL+D+  + +S  
Sbjct: 241 RHQVTGFIELLHDLKRYPLSNL 262


>gi|239834158|ref|ZP_04682486.1| creatininase [Ochrobactrum intermedium LMG 3301]
 gi|239822221|gb|EEQ93790.1| creatininase [Ochrobactrum intermedium LMG 3301]
          Length = 266

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 88/261 (33%), Positives = 140/261 (53%), Gaps = 1/261 (0%)

Query: 4   LIIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
              ++D +    +   R+  + VLP+GA EQHGPHLP+  D  I  G+ +   + LP   
Sbjct: 2   KRYWSDYTSEAFSRLEREKLVAVLPVGAIEQHGPHLPLAVDAAIVDGMVKETIARLPETS 61

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
               +P + IG S EH    GT T +    I  W  I   +   G+RK+ +LN+HGG   
Sbjct: 62  HALFLPTQAIGKSNEHSRYPGTLTFSAETIIRMWCEIGACVAGSGVRKMALLNSHGGQIS 121

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           ++ IV+ E R+R +MLVVS +W    +P+G+ S  + + GIH G++ETS+ML + P LV 
Sbjct: 122 VMDIVARELRIRHNMLVVSINWFGLGMPEGVYSDHDLKHGIHAGDMETSVMLEMHPDLVD 181

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           M   ++F +    F  +F++L   G     W ++D+NP G  G+A  AT +KG   + + 
Sbjct: 182 MSKVQDFRTLTETFASDFQHLSLSGGAKPAWQIQDINPYGAAGDATLATAEKGRATIDFA 241

Query: 243 ANCFIQLLNDINSFDVSIFDK 263
           A   +++L +I    +S  D 
Sbjct: 242 AERLVEVLAEIERAPLSWLDN 262


>gi|306841098|ref|ZP_07473818.1| creatininase [Brucella sp. BO2]
 gi|306288873|gb|EFM60182.1| creatininase [Brucella sp. BO2]
          Length = 256

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 135/250 (54%), Positives = 177/250 (70%)

Query: 13  PLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI 72
               D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+
Sbjct: 2   TDLRDQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPGDLNVNFLPAQPV 61

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           GYSIEHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R
Sbjct: 62  GYSIEHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELR 121

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            R  ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + 
Sbjct: 122 TRLDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNA 181

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           QS+F   FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE LL++  + FI LL D
Sbjct: 182 QSQFAEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASAQAGEKLLAHAVSGFIDLLRD 241

Query: 253 INSFDVSIFD 262
           ++ F+++ F+
Sbjct: 242 VDRFELARFN 251


>gi|222086849|ref|YP_002545383.1| creatininase (creatinine amidohydrolase) protein [Agrobacterium
           radiobacter K84]
 gi|221724297|gb|ACM27453.1| creatininase (creatinine amidohydrolase) protein [Agrobacterium
           radiobacter K84]
          Length = 265

 Score =  258 bits (658), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 108/262 (41%), Positives = 151/262 (57%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + + +    A    D  I +LP+ + EQHGPHLP+ TD  IA G+   +K   P
Sbjct: 1   MAKPFYWNELNTYDFAGLSPDTTIAILPIASTEQHGPHLPIATDVAIATGMLAELKVQRP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L    +P + IG + EH+Y  GT +L+    I  W AI   + + GIRK+VI+N+HGG
Sbjct: 61  NDLDFLVLPTQEIGKANEHVYGPGTLSLSAELLIPVWTAIGAKVAEAGIRKMVIVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  ++ IV+ E R+R+ M VV+T W RF  P G+IS  E   GIHGG++ETS+ML   P 
Sbjct: 121 NLDIMGIVARELRVRYQMAVVATQWMRFGTPDGMISEHEQCYGIHGGDVETSLMLHFRPE 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+MD AENF+S+         YL+    HS  W   DLNP GVVGNA + T +KG  + 
Sbjct: 181 LVRMDKAENFASKAEWMKERSNYLQPLPPHSLAWIAHDLNPNGVVGNAANGTAEKGALIC 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
           S+  N FI++L D+  + +S  
Sbjct: 241 SHQINGFIEMLRDLRDYPLSNL 262


>gi|23500710|ref|NP_700150.1| creatinine amidohydrolase [Brucella suis 1330]
 gi|23464360|gb|AAN34155.1| creatinine amidohydrolase, putative [Brucella suis 1330]
          Length = 256

 Score =  258 bits (658), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 135/250 (54%), Positives = 176/250 (70%)

Query: 13  PLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI 72
               D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+
Sbjct: 2   TDLRDQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPV 61

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           GYSIEHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R
Sbjct: 62  GYSIEHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELR 121

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            R  ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + 
Sbjct: 122 TRLDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNA 181

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           QS F   FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE LL++  + FI LL D
Sbjct: 182 QSRFAEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASAQAGEKLLAHAVSGFIDLLRD 241

Query: 253 INSFDVSIFD 262
           ++ F+++ F+
Sbjct: 242 VDRFELARFN 251


>gi|222087138|ref|YP_002545673.1| creatinine amidohydrolase (creatininase) protein [Agrobacterium
           radiobacter K84]
 gi|221724586|gb|ACM27742.1| creatinine amidohydrolase (creatininase) protein [Agrobacterium
           radiobacter K84]
          Length = 263

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 141/255 (55%), Positives = 190/255 (74%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           PL  F DN   L    R +WI VLPLGA+EQHGPHLP +TDT+IA G+   +K+ LP  L
Sbjct: 4   PLPRFDDNDRTLAPADRANWIAVLPLGAHEQHGPHLPFDTDTLIAEGIVSHLKAALPADL 63

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           PVT +PVEP+GYSIEHM V GTKTL + EA+  WL I +A+  +GIRK V+LNAHGGNSP
Sbjct: 64  PVTFLPVEPVGYSIEHMDVVGTKTLDFDEAVNRWLGIAEAMHHLGIRKFVMLNAHGGNSP 123

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           L++IV+TEAR+RF ML V+TSW+RF +P+ +I+  +  I IHGG+IETS+MLAL P +V 
Sbjct: 124 LLTIVATEARIRFDMLAVATSWTRFGVPEDLIAPEDKAIDIHGGDIETSVMLALHPEMVD 183

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           +  A +F SRQS++ + FK+LRA+G H+FGW M DL+ +GV GNA  AT +KG+ L+++ 
Sbjct: 184 VSKATDFPSRQSDYTQRFKHLRAYGPHAFGWKMSDLSAEGVAGNAGAATAEKGKRLIAHA 243

Query: 243 ANCFIQLLNDINSFD 257
               ++LL D+++FD
Sbjct: 244 VKGLVELLQDVDAFD 258


>gi|209883206|ref|YP_002287063.1| creatininase [Oligotropha carboxidovorans OM5]
 gi|209871402|gb|ACI91198.1| creatininase [Oligotropha carboxidovorans OM5]
          Length = 267

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 111/264 (42%), Positives = 159/264 (60%), Gaps = 1/264 (0%)

Query: 3   PLIIFTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           PL  +T    P    A    WI VLPL A EQHGPHLP+ TDT+IA      +++ LPP 
Sbjct: 2   PLRDWTTIHWPDVDPATASQWIAVLPLAATEQHGPHLPLGTDTMIAEAYLAEVQAQLPPN 61

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P + +PV+ +G+SIEH+   GT TL Y  AI HW+++ +++ + G++KIV++ +HGGNS
Sbjct: 62  IPASFLPVQSVGFSIEHIDYPGTVTLPYHVAIRHWMSLGESVARSGVKKIVMVTSHGGNS 121

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             ++IV+ E R R  ML VST+W RF  P+G+    E   G+HGG IETS+MLA  P LV
Sbjct: 122 APMAIVAQELRSRVGMLAVSTNWHRFGTPEGLFPEEEVTHGVHGGAIETSIMLAARPDLV 181

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D    F          F++L  H    F W+ +DL+P GV G+A  AT  KG  LL++
Sbjct: 182 RKDKIAKFEPSSVAMANEFRWLSPHRPAPFAWAAQDLHPSGVAGDATLATADKGRQLLTH 241

Query: 242 FANCFIQLLNDINSFDVSIFDKDV 265
            A  F +LL D+++FD++      
Sbjct: 242 GAKAFCELLADVHAFDMARLANRP 265


>gi|256111095|ref|ZP_05452142.1| creatininase [Brucella melitensis bv. 3 str. Ether]
 gi|265992617|ref|ZP_06105174.1| creatininase [Brucella melitensis bv. 3 str. Ether]
 gi|262763487|gb|EEZ09519.1| creatininase [Brucella melitensis bv. 3 str. Ether]
          Length = 256

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 134/250 (53%), Positives = 177/250 (70%)

Query: 13  PLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI 72
               D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+
Sbjct: 2   TDLRDQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPV 61

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           GYSIEHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R
Sbjct: 62  GYSIEHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELR 121

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            R  ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A +F + 
Sbjct: 122 TRLDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARSFPNA 181

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           QS+F   FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE LL++  + FI LL D
Sbjct: 182 QSQFAEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASAQAGEKLLAHAVSGFIDLLRD 241

Query: 253 INSFDVSIFD 262
           ++ F+++ F+
Sbjct: 242 VDRFELARFN 251


>gi|192288903|ref|YP_001989508.1| Creatininase [Rhodopseudomonas palustris TIE-1]
 gi|192282652|gb|ACE99032.1| Creatininase [Rhodopseudomonas palustris TIE-1]
          Length = 270

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 108/264 (40%), Positives = 155/264 (58%), Gaps = 1/264 (0%)

Query: 3   PLIIFTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   ++    P  A A    WI VLPL A EQHGPHLP++TD  IA     R++  LP  
Sbjct: 5   PPRDWSAIYWPEIAGADPSRWIAVLPLAAIEQHGPHLPLSTDVTIAEAYLARVRERLPAD 64

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +P T +PV+ IG S EH+   GT TL+   A++ W  I D+I + G+RK+V++ +HGGNS
Sbjct: 65  IPATFLPVQAIGLSTEHLSFPGTLTLSTETALKLWTEIGDSIARAGVRKLVMVTSHGGNS 124

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             + +V+ E R R  MLVV+T W+RF +P G+ +  E   GIHGG  ETS+MLA AP LV
Sbjct: 125 AAMGLVAQELRARHQMLVVTTGWARFGMPDGLFAADELRHGIHGGATETSIMLAHAPELV 184

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D   +F        + +++L A     F W+ +DL+P G +G+A  AT +KG  LL +
Sbjct: 185 RADRIADFRPTSVAMEQTYRWLSAQRPAPFAWAAEDLHPSGAIGDASAATAEKGWRLLDH 244

Query: 242 FANCFIQLLNDINSFDVSIFDKDV 265
            A  F +LL D++ FD++      
Sbjct: 245 GAGAFCELLADMHRFDLAALSIQP 268


>gi|86747695|ref|YP_484191.1| creatininase [Rhodopseudomonas palustris HaA2]
 gi|86570723|gb|ABD05280.1| Creatininase [Rhodopseudomonas palustris HaA2]
          Length = 270

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 105/265 (39%), Positives = 151/265 (56%), Gaps = 1/265 (0%)

Query: 3   PLIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   +T    P   DA    WI VLPL A EQHGPHLP+ TD IIA     R+  +LP  
Sbjct: 5   PPRDWTGIRWPEIGDADPARWIAVLPLAATEQHGPHLPLGTDVIIAQAYLARVHELLPAE 64

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LP T +P++P+G S EH+   GT TL+   A+  W  I D++ + G+RK+V++ +HGGNS
Sbjct: 65  LPATFLPLQPVGLSGEHLSFPGTLTLSTETALRLWTEIGDSVARAGVRKLVMVTSHGGNS 124

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             + +V+ + R R  ML V+T W+RF +P G+ +  E   GIHGG +ET++MLA AP  V
Sbjct: 125 AAMGLVAQDLRTRHRMLAVTTGWARFGLPDGLFAADELRHGIHGGAVETAIMLAHAPDQV 184

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D   +F        R F++L A     F W+ +DL+  G +G+A  A+  KG   L +
Sbjct: 185 RTDRIADFRPATLAMEREFRFLSAQRPAPFAWAAQDLHRSGAIGDATAASADKGRQALDH 244

Query: 242 FANCFIQLLNDINSFDVSIFDKDVQ 266
            A  F +LL D++ FD+       Q
Sbjct: 245 GARAFCELLADVDRFDLEALGAAPQ 269


>gi|209549277|ref|YP_002281194.1| creatininase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535033|gb|ACI54968.1| Creatininase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 265

 Score =  256 bits (654), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 105/262 (40%), Positives = 153/262 (58%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + + +    A    D  I +LP+ + EQHGPHLP+ TD  IA G+   ++   P
Sbjct: 1   MAMPFYWNELNSSDFAGLSPDTTIAILPIASTEQHGPHLPIATDVAIANGMLAELRQQKP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L    +P + IG + EH+Y  GT +L     I  W AI   + + G+RK+V++N+HGG
Sbjct: 61  DDLDFLVLPTQEIGKANEHIYGPGTLSLGAELLIPVWTAIGAKVAEAGLRKMVVVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  ++SIV+ E R+R+ M VVST W RF  P+G+IS  E + GIHGGE+ETS+ML   P 
Sbjct: 121 NVDIMSIVARELRVRYQMAVVSTQWGRFGHPEGMISEDELKYGIHGGEVETSLMLHFRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+MD A+NF+S+        +Y++    HS  W   DLNP GVVG+A   T  KGE + 
Sbjct: 181 LVRMDKAQNFTSKAEWMRGQSRYIQPLPPHSLAWIAHDLNPAGVVGDASRGTAAKGEAIC 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
            +  + FI+LL+D+  + +S  
Sbjct: 241 RHQVSGFIELLSDLKRYPLSNL 262


>gi|118592958|ref|ZP_01550346.1| probable creatininase (creatinine amidohydrolase) protein [Stappia
           aggregata IAM 12614]
 gi|118434492|gb|EAV41145.1| probable creatininase (creatinine amidohydrolase) protein [Stappia
           aggregata IAM 12614]
          Length = 265

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 110/262 (41%), Positives = 159/262 (60%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + + +    A    D +  +LP  + EQHGPHLP+ TD +IA G+    +  LP
Sbjct: 1   MAKHFFWNELNASDFAALDPDRVIAILPTASTEQHGPHLPIATDVVIAVGMLAETRKQLP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             + +  +PV+ IG + EH+Y  GT +L     I  W AI   + + GIRK+VI+N+HGG
Sbjct: 61  DDVDILVLPVQEIGKANEHIYGPGTLSLGAELLIPVWTAIGQKVSEAGIRKMVIVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N+ ++SIVS E R+R+ M V+ T WSRF  P+G+IS  E++ GIHGGE+ETS+ML   P 
Sbjct: 121 NTDIISIVSRELRVRYEMAVLVTHWSRFGHPEGMISAHESKFGIHGGEVETSLMLHFRPE 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+MD AENF SR  E L N KY++    H+  W   DLNP GVVG+A   T +KG  + 
Sbjct: 181 LVRMDKAENFVSRAEEMLENSKYIQPTPPHALAWIAHDLNPAGVVGDASKGTAEKGAAIS 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
           ++ A  FI++L D  ++ ++  
Sbjct: 241 AHQAAGFIEMLRDFAAYPLANL 262


>gi|148258657|ref|YP_001243242.1| hypothetical protein BBta_7483 [Bradyrhizobium sp. BTAi1]
 gi|146410830|gb|ABQ39336.1| hypothetical protein BBta_7483 [Bradyrhizobium sp. BTAi1]
          Length = 275

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 159/271 (58%), Gaps = 6/271 (2%)

Query: 1   MNPLIIFTDNSLPLCADA------RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI 54
           M     +T+   P    +         WI VLPL A EQHGPHLP+ TD  IA+    R+
Sbjct: 1   MTLPRDWTELHWPAFGTSTSGTPEAARWIAVLPLAATEQHGPHLPLGTDVYIASAYLARV 60

Query: 55  KSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVIL 114
           +++LP  LPVT +PV+P+G S EH+   GT T+    A++ W AI D++ + G+RK+VI+
Sbjct: 61  RTLLPATLPVTILPVQPVGISTEHIDYPGTLTVPTEIALQSWRAIGDSVARAGLRKLVIV 120

Query: 115 NAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMML 174
            +HGGNS  +++V+ E R    MLVV+TSWSRF +P G+ S  E   GIHGG +ETS+ML
Sbjct: 121 TSHGGNSAAMTLVAQELRAVHRMLVVTTSWSRFGVPDGLFSADEMRHGIHGGAVETSIML 180

Query: 175 ALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKK 234
           A  P LV+ +   +F+S  +E  + ++ L         W  +DLN  G VG+A  A+ +K
Sbjct: 181 ACHPELVRSEAIADFASSAAEMEKTYRVLSTQRPAPLAWQTQDLNASGAVGDATQASAEK 240

Query: 235 GEGLLSYFANCFIQLLNDINSFDVSIFDKDV 265
           GE +L++ A  F  LL ++  FDV+      
Sbjct: 241 GERVLAHGARAFCTLLEEVGHFDVNRLAAGP 271


>gi|254720159|ref|ZP_05181970.1| creatininase [Brucella sp. 83/13]
 gi|265985166|ref|ZP_06097901.1| creatininase [Brucella sp. 83/13]
 gi|306839535|ref|ZP_07472342.1| creatininase [Brucella sp. NF 2653]
 gi|264663758|gb|EEZ34019.1| creatininase [Brucella sp. 83/13]
 gi|306405367|gb|EFM61639.1| creatininase [Brucella sp. NF 2653]
          Length = 256

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 135/250 (54%), Positives = 177/250 (70%)

Query: 13  PLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI 72
               D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+
Sbjct: 2   TDLRDQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPV 61

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           GYSIEHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R
Sbjct: 62  GYSIEHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELR 121

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            R  ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + 
Sbjct: 122 TRLDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNA 181

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           QS+F   FKYLRA+G H+FGW M DLNP GV GNA+ A+ + GE LL++  + FI LL D
Sbjct: 182 QSQFAEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAASTQAGEKLLAHAVSGFIDLLRD 241

Query: 253 INSFDVSIFD 262
           ++ F+++ F+
Sbjct: 242 VDRFELARFN 251


>gi|254696000|ref|ZP_05157828.1| creatininase [Brucella abortus bv. 3 str. Tulya]
 gi|261216427|ref|ZP_05930708.1| creatininase [Brucella abortus bv. 3 str. Tulya]
 gi|260918034|gb|EEX84895.1| creatininase [Brucella abortus bv. 3 str. Tulya]
          Length = 256

 Score =  255 bits (651), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 135/250 (54%), Positives = 176/250 (70%)

Query: 13  PLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI 72
               D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+
Sbjct: 2   TDLRDQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPV 61

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           GYSIEHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R
Sbjct: 62  GYSIEHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELR 121

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            R  ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + 
Sbjct: 122 TRLDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNA 181

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           QS+F   FKYLRA+G H+FGW M DLNP GV GNA+ A  + GE LL++  + FI LL D
Sbjct: 182 QSQFAEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAARAQAGEKLLAHAVSGFIDLLRD 241

Query: 253 INSFDVSIFD 262
           ++ F+++ F+
Sbjct: 242 VDRFELARFN 251


>gi|299132803|ref|ZP_07025998.1| Creatininase [Afipia sp. 1NLS2]
 gi|298592940|gb|EFI53140.1| Creatininase [Afipia sp. 1NLS2]
          Length = 270

 Score =  254 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 108/265 (40%), Positives = 158/265 (59%), Gaps = 1/265 (0%)

Query: 2   NPLIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
            P   +T    P     A  +WI VLPL A EQHGPHLP+ TDT IA     R++++LP 
Sbjct: 4   TPPRDWTTIHWPETDPAAASEWIAVLPLAATEQHGPHLPVGTDTFIAEAYLARVQALLPG 63

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            +P + +PV+ IG+SIEH+   GT TL Y  AI HW+++ +++ + G++K+V++ +HGGN
Sbjct: 64  HVPASFLPVQSIGFSIEHIDYPGTVTLPYHVAIRHWMSLGESVARSGVKKLVMVTSHGGN 123

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           S  ++IV+ E R R  ML V+T+W RF  P+G+    E   GIHGG +ETS+MLA  P L
Sbjct: 124 SAPMAIVAQELRARLGMLAVTTNWHRFGTPEGLFPHEEIAHGIHGGAVETSIMLAAQPDL 183

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+ D   NF        R F++L  H    F W+ +DL+P GV G+A  A+  KG  L+ 
Sbjct: 184 VRKDKIANFEPASVAMAREFRWLSPHRPAPFAWAAQDLHPSGVAGDATLASADKGRQLIE 243

Query: 241 YFANCFIQLLNDINSFDVSIFDKDV 265
           + A    +LL D++ FD++      
Sbjct: 244 HGAKALCELLADVHGFDMARLANRP 268


>gi|27375203|ref|NP_766732.1| hypothetical protein blr0092 [Bradyrhizobium japonicum USDA 110]
 gi|27348339|dbj|BAC45357.1| blr0092 [Bradyrhizobium japonicum USDA 110]
          Length = 268

 Score =  254 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 100/266 (37%), Positives = 147/266 (55%), Gaps = 1/266 (0%)

Query: 1   MNPLIIFTDNSLPL-CADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   +T+             WI VLPL A EQHGPHLP+ TD +IA     R++ +LP
Sbjct: 1   MMPSRDWTEIRWADAVPAEVSRWIAVLPLAATEQHGPHLPLATDVLIADAYLARVRELLP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             +P + +PVEP+G S EH+   GT+TL    A++ W AI + + + G++K+VI+ +HGG
Sbjct: 61  ATIPASFLPVEPVGISTEHIDYPGTQTLPTDVALKRWTAIGEEVARRGVKKLVIITSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           NS  + +V+ + R    + VV+TSWSR +    +    E   GIHGG IETS+MLA  P 
Sbjct: 121 NSAAMMLVAQDLRAHHKLFVVTTSWSRLSGADKLFPAEEVRHGIHGGAIETSIMLARYPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            V+ D   +F +        +++L       F W  +DLN  G +GNA  A  +KG  LL
Sbjct: 181 QVRKDAIADFPASSVAMETQYRWLSTQRPAPFAWQAQDLNASGAIGNATLAVPEKGAQLL 240

Query: 240 SYFANCFIQLLNDINSFDVSIFDKDV 265
              A  F +LL ++++FDV+   K  
Sbjct: 241 DQGARAFCELLTEVDNFDVNRLAKGP 266


>gi|92116046|ref|YP_575775.1| creatininase [Nitrobacter hamburgensis X14]
 gi|91798940|gb|ABE61315.1| Creatininase [Nitrobacter hamburgensis X14]
          Length = 272

 Score =  254 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 103/250 (41%), Positives = 151/250 (60%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           +   +WI VLPL A EQHGPHLP+ TD +IA     R++ +LP  +P   +PV+PIG S 
Sbjct: 20  ETAANWIAVLPLAATEQHGPHLPLTTDVLIAEAYLARVRELLPQDIPANFLPVQPIGIST 79

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EH    GT+TLT   A++ W A+ + + + GIRKIV++++HGGNS  +++V+ + R R  
Sbjct: 80  EHTDFPGTQTLTNEAALKAWTALGEDVARTGIRKIVMVSSHGGNSAAMTMVAQDLRARHR 139

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           ML V+T+WSRF +P G+    E   GIHGG IETS+MLA  P  V+ D   +F       
Sbjct: 140 MLAVTTAWSRFGVPDGLFDAQELRHGIHGGAIETSIMLARYPEQVRRDSIADFHPASIAI 199

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
            + +++L       F W  +DL+P G VG+A  A+ +KGE LL + A  F +LL D+  F
Sbjct: 200 EKIYRWLGTQRPAPFAWQTQDLHPSGAVGDATQASAEKGERLLEHGARAFCELLADMARF 259

Query: 257 DVSIFDKDVQ 266
           D ++     +
Sbjct: 260 DPAVLTDGPR 269


>gi|154246579|ref|YP_001417537.1| creatininase [Xanthobacter autotrophicus Py2]
 gi|154160664|gb|ABS67880.1| Creatininase [Xanthobacter autotrophicus Py2]
          Length = 285

 Score =  254 bits (649), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 107/260 (41%), Positives = 150/260 (57%), Gaps = 1/260 (0%)

Query: 7   FTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
           + + S P  A   K   + VLP+ A EQHGPHLP+ TD  IA G  ERI   +P  L   
Sbjct: 26  WAELSSPAIAALDKTRLVAVLPVAAVEQHGPHLPLGTDLFIAEGYIERIAFQVPRDLDAV 85

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
            +PV+ +G S EH+   GT TL+ A A+  W+ + D + + G+R++V++N HGGN P++ 
Sbjct: 86  FLPVQAVGKSDEHITFAGTLTLSPATALATWVELGDCLARAGVRRLVLMNTHGGNVPVID 145

Query: 126 IVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
           +V+   R++  ML V+ S  RF  P G+ +  E   GIHGGEIETS+MLA  P LV +  
Sbjct: 146 LVARTLRVKHRMLAVTCSMHRFGYPVGLFTDHERAHGIHGGEIETSLMLAFRPELVDLTH 205

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
           A +FS         F  LRA+    FGW  +DL+  G +G+A  AT  KGE    + A  
Sbjct: 206 AGDFSPYSVAMESEFARLRANHPVGFGWLAEDLSADGAMGDARGATALKGEAATEFGARA 265

Query: 246 FIQLLNDINSFDVSIFDKDV 265
           FI+LL D+ +FD+  FD  V
Sbjct: 266 FIELLRDVANFDLERFDHHV 285


>gi|148252832|ref|YP_001237417.1| hypothetical protein BBta_1271 [Bradyrhizobium sp. BTAi1]
 gi|146405005|gb|ABQ33511.1| hypothetical protein BBta_1271 [Bradyrhizobium sp. BTAi1]
          Length = 270

 Score =  254 bits (649), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 90/264 (34%), Positives = 140/264 (53%), Gaps = 1/264 (0%)

Query: 4   LIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
              + D S         +  + +LP+GA EQHGPHLP+  D  I AG+  R   ++PP  
Sbjct: 5   SRFWWDLSTTEFGALDTERTVAILPVGAIEQHGPHLPVKVDAAINAGILSRALELMPPHS 64

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
               +P  P G S EH+   GT TL++      W  I +++ + G+RKI+  N+HGG   
Sbjct: 65  AALVLPPLPYGKSDEHLAFPGTLTLSHETLGRVWYEIAESVHRAGVRKILFFNSHGGQPQ 124

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           L+ I+  + R++  ML V+T+W +      + +  E  +GIHGG+IETS ML LAP  V+
Sbjct: 125 LLDIICRDLRVKLGMLAVNTTWWQLIDISDLFAADEIRLGIHGGQIETSAMLHLAPDDVR 184

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           MD AE F S  +   + F  L    +  FGW  +DL+P GV G+A  A+ + G  ++   
Sbjct: 185 MDRAETFISAAAAIEQEFALLGPEAAARFGWQAQDLHPAGVCGDARAASAELGRAVVERA 244

Query: 243 ANCFIQLLNDINSFDVSIFDKDVQ 266
           A   + L++DI+ + +S      +
Sbjct: 245 APRLVALVDDISRYPLSRIVAGHR 268


>gi|161621034|ref|YP_001594920.1| creatininase [Brucella canis ATCC 23365]
 gi|254703303|ref|ZP_05165131.1| creatinine amidohydrolase, putative [Brucella suis bv. 3 str. 686]
 gi|260567766|ref|ZP_05838235.1| creatininase [Brucella suis bv. 4 str. 40]
 gi|261753932|ref|ZP_05997641.1| creatininase [Brucella suis bv. 3 str. 686]
 gi|161337845|gb|ABX64149.1| Creatininase [Brucella canis ATCC 23365]
 gi|260154431|gb|EEW89512.1| creatininase [Brucella suis bv. 4 str. 40]
 gi|261743685|gb|EEY31611.1| creatininase [Brucella suis bv. 3 str. 686]
          Length = 256

 Score =  254 bits (649), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 135/250 (54%), Positives = 175/250 (70%)

Query: 13  PLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI 72
               D   D IVVLPLGA+EQHGPHLP  TDTII  G+  R+   LP  L V  +P +P+
Sbjct: 2   TDLRDQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVSDALPADLNVNFLPAQPV 61

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           GYSIEHM   GT++L +AEA+  W+AI + +   GIRK+V+LNAHGGNSPL++IV+TE R
Sbjct: 62  GYSIEHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELR 121

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            R  ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NF + 
Sbjct: 122 TRLDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMAKARNFPNA 181

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           QS F   FKYLRA+G H+FGW M DLNP GV GNA+ A  + GE LL++  + FI LL D
Sbjct: 182 QSRFAEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIAARAQAGEKLLAHAVSGFIDLLRD 241

Query: 253 INSFDVSIFD 262
           ++ F+++ F+
Sbjct: 242 VDRFELARFN 251


>gi|218438486|ref|YP_002376815.1| creatininase [Cyanothece sp. PCC 7424]
 gi|218171214|gb|ACK69947.1| Creatininase [Cyanothece sp. PCC 7424]
          Length = 270

 Score =  253 bits (647), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 74/260 (28%), Positives = 134/260 (51%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +     +   +++ +++ P+GA EQHGPHLP+  D+ I+ G+  +    L
Sbjct: 6   IPPDRFFPYLTWTDIQEMSDKENVVIIQPVGAIEQHGPHLPIIVDSAISMGVLGKALLKL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P   +P    G S EH +  GT TL+    +     + +++ + G RK+V++N+HG
Sbjct: 66  DSHIPAYALPCLYYGKSNEHWHFPGTITLSAETLLSVIKEMAESLYRSGFRKLVLMNSHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I + +    +   +V    +W    + + +++  E E GIH G+ ETS++L+L
Sbjct: 126 GQPQIMEIAARDIHQEYQDFLVFPLFTWRVPHVAKELLTPEEIEFGIHAGDAETSIILSL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  VKM+ A        + L +   L   G   F W   +L+  GV+G+A  AT +KGE
Sbjct: 186 LPDQVKMERAV---KEYPQGLPSESLLSMEGKLPFAWLTAELSKSGVMGDATTATREKGE 242

Query: 237 GLLSYFANCFIQLLNDINSF 256
            LL   ++ ++Q++ D+  F
Sbjct: 243 RLLESVSDGWVQVIKDVYKF 262


>gi|209523828|ref|ZP_03272381.1| Creatininase [Arthrospira maxima CS-328]
 gi|209495860|gb|EDZ96162.1| Creatininase [Arthrospira maxima CS-328]
          Length = 272

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 81/260 (31%), Positives = 128/260 (49%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +    A+    ++ +++ P+GA EQHGPHLP+  D  IA  +       L
Sbjct: 5   IPPHRFFPYLTWTEIAEMPDPENTVIIQPIGAIEQHGPHLPLIVDAAIATAVTGLALEKL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P   +     G S EH +  GT TLT    I   + + ++I + G RK+V LNAHG
Sbjct: 65  DRTIPAYALSTLYYGKSNEHWHFPGTITLTSETLISVLMEVGESIYRAGFRKLVFLNAHG 124

Query: 119 GNSPLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ +V+ +   +    +V     W    I + + S  E E+GIH G+IETS+ML++
Sbjct: 125 GQPQILDMVARDLHQQHEDFMVFPLFVWRVPHIAKELFSPEELELGIHAGDIETSVMLSI 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P +V+ D A          L +   L   G   F W  +DL+  GV+G+A  AT +KG 
Sbjct: 185 LPDVVRRDKAVR---EFPHGLPSDSLLSMEGKLPFAWVTRDLSASGVLGDATAATEEKGS 241

Query: 237 GLLSYFANCFIQLLNDINSF 256
            LL    + +++ + DI  F
Sbjct: 242 RLLESVVDSWVKAIADIYKF 261


>gi|75910216|ref|YP_324512.1| creatininase [Anabaena variabilis ATCC 29413]
 gi|75703941|gb|ABA23617.1| Creatininase [Anabaena variabilis ATCC 29413]
          Length = 262

 Score =  252 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 72/260 (27%), Positives = 133/260 (51%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +     +   +++ +++ P+GA EQHGPHLP+  D  I  G+  +  S L
Sbjct: 5   IPPERFFAYLTWTEIQEMPNKENVVIIQPVGAIEQHGPHLPLIVDAAIGVGVLGKALSKL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P   +P    G S EH +  GT TL+        + + ++I + G RK+V++N+HG
Sbjct: 65  DASIPAYALPTLYYGKSNEHWHFPGTITLSTETLTAIIMEVGESIYRAGFRKLVLMNSHG 124

Query: 119 GNSPLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ +V+ +  +++    V    +W    I + +++  E   G+H G+ ETS+MLA+
Sbjct: 125 GQPQVMQMVARDLHVKYGDFAVFPLFTWRVPHITKELLTPKEATQGMHAGDAETSIMLAI 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  V++D A    +           L   G     W  KD++  GV+G+A  AT +KG+
Sbjct: 185 LPDQVQLDKAV---AEYPPEQPEGSLLSWEGKLPVAWVTKDISKSGVIGDATTATREKGD 241

Query: 237 GLLSYFANCFIQLLNDINSF 256
            +L   ++ ++Q++ +I +F
Sbjct: 242 RILESVSDGWVQVIKEIYAF 261


>gi|86606203|ref|YP_474966.1| creatininase [Synechococcus sp. JA-3-3Ab]
 gi|86554745|gb|ABC99703.1| creatininase [Synechococcus sp. JA-3-3Ab]
          Length = 274

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 74/260 (28%), Positives = 130/260 (50%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +         +++ +++ P+ + EQHGPHLP+  D  I   +  R    L
Sbjct: 5   IPPHRFFPYLTWTEIQAMPDKENVVIIQPVASIEQHGPHLPLVVDACIGTAIIGRAMEKL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
            P +P   +P +  G + EH +  GT TL+    +     + ++I + G RK+V LN+HG
Sbjct: 65  EPEIPAYVLPTQCYGKANEHWHFPGTITLSAQTLMAVLTEVAESIYRAGFRKLVFLNSHG 124

Query: 119 GNSPLVSIVSTEARMRFSMLVVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ IV+ +   ++   ++     W      Q +++  E E+GIH G+ ETSM++ L
Sbjct: 125 GQPEVLQIVARDLHQKYEDFLLFPVSVWRVPHQGQELMTAKEQELGIHAGDGETSMLMYL 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  V+ D            L     L   G  SF W+ +DL+  GV+G+A  AT +KG+
Sbjct: 185 LPETVRTDRLVC---EYPSDLPQDSLLSLEGRISFAWTTRDLSRSGVLGDATAATPEKGK 241

Query: 237 GLLSYFANCFIQLLNDINSF 256
            L+   A+ +++L+ D++ F
Sbjct: 242 LLVESMADGWVRLIRDLHKF 261


>gi|303276611|ref|XP_003057599.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226460256|gb|EEH57550.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 301

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 94/252 (37%), Positives = 144/252 (57%), Gaps = 2/252 (0%)

Query: 10  NSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
            +     +    + I +LP+GA EQHGPHLP+  D  I AG+ +    +LP  +P+T +P
Sbjct: 1   MTTAEFDEMDASNVIALLPVGAIEQHGPHLPVCVDAAINAGVLDVALRLLPSEIPLTVLP 60

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
             P G S+EH    GT +L+ +  I  W  I +++ + GI K+V+ N+HGG   ++ IV+
Sbjct: 61  AFPYGKSVEHDDFAGTISLSASTLIAAWTDIGESVHRAGIEKLVLFNSHGGQPQVMDIVA 120

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
            + R RF M VV  +W  F +P+G+    E + G+H G++ETS+ML L P  V M  A +
Sbjct: 121 RDLRKRFGMFVVCVNWFSFGVPEGLYDDEEIKHGLHAGDVETSVMLHLHPESVTMSRARD 180

Query: 189 FSSRQSEFLRNFKYLRAH-GSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
           F S  ++  R+F YL    G   FGW  +DLN  G  GNA +AT  KGE  + + A   +
Sbjct: 181 FPSAGADMERDFTYLSPEGGGIGFGWLAQDLNHAGATGNASEATAVKGEATVEHAAERLV 240

Query: 248 QLLNDINSFDVS 259
           +LL +++ FD +
Sbjct: 241 ELLREVHDFDPA 252


>gi|254414331|ref|ZP_05028098.1| creatininase subfamily [Microcoleus chthonoplastes PCC 7420]
 gi|196179006|gb|EDX74003.1| creatininase subfamily [Microcoleus chthonoplastes PCC 7420]
          Length = 267

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 75/260 (28%), Positives = 134/260 (51%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +         +++ +++ P+GA EQHG HLP+  D+ I  G+  +  + L
Sbjct: 5   IPPERFFPYLTWTDIQTIPDKENVVIIQPVGAIEQHGHHLPLVVDSAIGVGVLGKALAQL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
            P +P   +P    G S EH +  GT TL+    +   + + D+I + G RK+V++N+HG
Sbjct: 65  EPTIPAYALPNLFYGKSNEHWHFPGTITLSAQTLLAVLMEVADSIYRAGFRKLVLMNSHG 124

Query: 119 GNSPLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I + +   ++   +V    +W    + + +IS  E E+GIH G+ ETS+ML+L
Sbjct: 125 GQPQIMEIAARDIHQKYGDFLVFPLFTWRVPNVAKELISAKELELGIHAGDAETSLMLSL 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  VKM+ A    +   + L     L   G   F W  ++L+  G +G+   AT +KG+
Sbjct: 185 LPEQVKMERAV---AEYPQGLPEDSLLSMEGKLPFAWLTQELSQSGTLGDPTPATKEKGD 241

Query: 237 GLLSYFANCFIQLLNDINSF 256
            +L    + +++++ DI  F
Sbjct: 242 RILESLVSGWVKVIQDIYRF 261


>gi|240138723|ref|YP_002963195.1| creatininase (creatine amidohydrolase) [Methylobacterium extorquens
           AM1]
 gi|240008692|gb|ACS39918.1| creatininase (creatine amidohydrolase) [Methylobacterium extorquens
           AM1]
          Length = 258

 Score =  251 bits (642), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 105/257 (40%), Positives = 149/257 (57%), Gaps = 1/257 (0%)

Query: 3   PLIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   + D +            I VLP+ A EQHGPHLP+ TDT+IA G   R+   +P  
Sbjct: 2   PARSWLDLTTAEIRARDMSRTIAVLPVAAVEQHGPHLPLGTDTLIAEGYLARVAPQVPEA 61

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           L V  +PV+ +G S EH    GT TLT   A+  W  I  ++ + G  K+VI+++HGGNS
Sbjct: 62  LDVLLLPVQSVGKSDEHDSFPGTLTLTAPTALAAWTEIGASLHRAGCTKLVIVSSHGGNS 121

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            L+ +V+ E R RF M+ V+TSWSR  +P+G+    E   GIH G IET++MLAL P LV
Sbjct: 122 ALIDLVAGELRGRFGMVAVTTSWSRLGLPEGLFPAGEIRHGIHAGGIETALMLALRPDLV 181

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D  E+F  R     R+F  LRA    +F W  +DL+P G +G+A   T + GE  L+Y
Sbjct: 182 RRDHIEDFEPRTVAMERDFALLRAGRPAAFAWKTEDLHPSGALGDARLGTAEAGEAALAY 241

Query: 242 FANCFIQLLNDINSFDV 258
            A  F++LL +++ F +
Sbjct: 242 GAQAFVRLLEEVDRFSL 258


>gi|67921761|ref|ZP_00515278.1| Creatininase [Crocosphaera watsonii WH 8501]
 gi|67856353|gb|EAM51595.1| Creatininase [Crocosphaera watsonii WH 8501]
          Length = 266

 Score =  251 bits (641), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 80/260 (30%), Positives = 135/260 (51%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCA--DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   S       + +++ ++V P+GA EQHGPHLP+  D  I+ G+  +    L
Sbjct: 5   IPPQRFFPYLSWTDIDSMEDKENMVIVQPIGAIEQHGPHLPIAVDAAISLGVLGKALEKL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           PP +P   +P    G S EH    GT TL+    I     +  +I + G RK++++N+HG
Sbjct: 65  PPEIPCYALPCLYYGKSNEHWGFPGTITLSANTLISVISEVAQSIYRSGFRKLILMNSHG 124

Query: 119 GNSPLVSIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ IV+ +   ++    +    +W    I + +++  E E GIH G+ ETS++LAL
Sbjct: 125 GQPQIMDIVARDIHQKYQDFSLFPFFTWRVPNIAKELLTPQELEYGIHAGDAETSIILAL 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  VKM  A        + L     +   G   F W  K+L+  GV+G+A  A+ +KG+
Sbjct: 185 LPDQVKMSQAV---KEYPQGLPEDSLVSMEGKLPFAWLTKELSKSGVMGDATVASKEKGD 241

Query: 237 GLLSYFANCFIQLLNDINSF 256
            LL+  ++ ++Q++ D+ SF
Sbjct: 242 RLLASVSDGWVQVIKDVYSF 261


>gi|218248815|ref|YP_002374186.1| Creatininase [Cyanothece sp. PCC 8801]
 gi|218169293|gb|ACK68030.1| Creatininase [Cyanothece sp. PCC 8801]
          Length = 267

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 75/260 (28%), Positives = 129/260 (49%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +          +  +++ P+G+ EQHG HLP+  D+ I  G+  +    L
Sbjct: 6   IPPNRFFPYLTWAEIQSISDPESVVIIQPVGSIEQHGYHLPIIVDSAIGMGVLGKALEKL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
            P +P   +P    G S EH +  GT TL+    +   + + D + + G RK+V++N+HG
Sbjct: 66  KPEIPAYSLPCLYYGKSNEHWHFPGTITLSATTLLTILMEVADNLYRSGFRKLVLMNSHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I + +   ++   +V    +W    I   +++  E E GIH G+ ETS++L+L
Sbjct: 126 GQPQIMEIAARDIHQKYEDFLVFPLFTWRVPNIASELLTEKELEYGIHAGDAETSLLLSL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P+ V M+ A        + L     L   G   F W  K+L   GV+G+A  AT +KG+
Sbjct: 186 LPNQVNMEKAV---KEYPQGLPENSLLSMEGKLPFAWLTKELTKSGVMGDATVATKEKGD 242

Query: 237 GLLSYFANCFIQLLNDINSF 256
            LL   ++ ++QL+ +I  F
Sbjct: 243 KLLESLSDSWVQLIENIYQF 262


>gi|222106356|ref|YP_002547147.1| creatinine amidohydrolase [Agrobacterium vitis S4]
 gi|221737535|gb|ACM38431.1| creatinine amidohydrolase [Agrobacterium vitis S4]
          Length = 278

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 98/262 (37%), Positives = 143/262 (54%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + D+S    A+      +VVLP+ A EQHGPHLP++ D  I A +  R  + L 
Sbjct: 1   MTRSFYWVDHSTQTFAERDLSKTVVVLPIAAVEQHGPHLPVDVDAAINAEIIRRTVARLQ 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
           P   V  +P   +G S EH+   GT  ++       WL +  ++++ G  K+++ N+HGG
Sbjct: 61  PDTDVLFLPPMMVGKSDEHIAFPGTLAISGETLRHVWLDLARSVKRAGAAKLILFNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
              L+ IV  + R+   ML VS SW R    + + S  E + GIHGG+IETSMMLA+AP 
Sbjct: 121 QMALMDIVCRDIRIELGMLAVSCSWFRIAPVEDLFSRAEIDHGIHGGDIETSMMLAIAPE 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            V MD AENF        ++   L A G+  FGW  +DL+P GV GNA +AT +KG+ +L
Sbjct: 181 RVAMDKAENFVPLTVAIEKSGSMLTAEGAVGFGWQAQDLHPAGVCGNASNATAQKGQIVL 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
              A+  + L+    +FD+S  
Sbjct: 241 DRAADGLVSLIAATQAFDLSQL 262


>gi|284052490|ref|ZP_06382700.1| Creatininase [Arthrospira platensis str. Paraca]
 gi|291569639|dbj|BAI91911.1| creatininase [Arthrospira platensis NIES-39]
          Length = 272

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 78/260 (30%), Positives = 128/260 (49%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +    A+   R++ +++ P+GA EQHGPHLP+  D  IA  +  +    L
Sbjct: 5   IPPHRFFPYLTWTEIAEMPDRENTVIIQPIGAIEQHGPHLPLIVDAAIATAVTGKALEKL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P   +     G S EH +  GT TLT    +   + + ++I + G RK+V +NAHG
Sbjct: 65  DRTIPAYALSTLYYGKSNEHWHFPGTITLTSETLMSVLMEVGESIYRAGFRKLVFVNAHG 124

Query: 119 GNSPLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ +V+ +   +    +V     W    I + + S  E E+GIH G+IETS+ML++
Sbjct: 125 GQPQILEMVARDLHQQHEDFMVFPLFVWRVPHIAKELFSPEELELGIHAGDIETSVMLSI 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P +V+ +            L +   L   G   F W  +DL+  GV+G+A  AT  KG 
Sbjct: 185 LPDVVRREKVVR---EFPHGLPSDSLLSMEGKLPFAWVTRDLSASGVLGDATAATEDKGT 241

Query: 237 GLLSYFANCFIQLLNDINSF 256
            LL    + +++ + DI  F
Sbjct: 242 RLLESVVDSWVKAIADIYKF 261


>gi|218530365|ref|YP_002421181.1| creatininase [Methylobacterium chloromethanicum CM4]
 gi|218522668|gb|ACK83253.1| Creatininase [Methylobacterium chloromethanicum CM4]
          Length = 258

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 105/257 (40%), Positives = 150/257 (58%), Gaps = 1/257 (0%)

Query: 3   PLIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   + D +            I VLP+ A EQHGPHLP+ TDT+IA G   R+   +P  
Sbjct: 2   PTRSWLDLTTAEIRARDMSRTIAVLPVAAVEQHGPHLPLGTDTLIAEGYLARVAPQVPEA 61

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           L V  +PV+ +G S EH    GT TLT   A+  W  I  ++ + G  K+VI+++HGGNS
Sbjct: 62  LDVLLLPVQTVGKSDEHDSFPGTLTLTAPTALAAWTEIGASLHRAGCTKLVIVSSHGGNS 121

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            L+ +V+ E R RF M+ V+TSWSR  +P+G+    E   GIH G IET++MLAL P LV
Sbjct: 122 ALIDLVAGELRGRFGMVAVTTSWSRLGLPEGLFPAGEIRHGIHAGGIETALMLALRPDLV 181

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D  E+F  R     R+F  LRA    +F W  +DL+P G +G+A   T + GE  L+Y
Sbjct: 182 RRDHIEDFEPRTVAMERDFALLRAGRPAAFAWKTEDLHPSGALGDARLGTAEAGEAALAY 241

Query: 242 FANCFIQLLNDINSFDV 258
            A+ F++LL +++ F +
Sbjct: 242 GAHAFVRLLEEVDRFSL 258


>gi|257061874|ref|YP_003139762.1| creatininase [Cyanothece sp. PCC 8802]
 gi|256592040|gb|ACV02927.1| Creatininase [Cyanothece sp. PCC 8802]
          Length = 267

 Score =  249 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 75/260 (28%), Positives = 129/260 (49%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +          +  +++ P+G+ EQHG HLP+  D+ I  G+  +    L
Sbjct: 6   IPPHRFFPYLTWAEIQSISDPESVVIIQPVGSIEQHGYHLPIIVDSAIGMGVLGKALEKL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
            P +P   +P    G S EH +  GT TL+    +   + + D + + G RK+V++N+HG
Sbjct: 66  KPEIPAYSLPCLYYGKSNEHWHFPGTITLSATTLLSILMEVADNLYRSGFRKLVLMNSHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I + +   ++   +V    +W    I   +++  E E GIH G+ ETS++L+L
Sbjct: 126 GQPQIMEIAARDIHQKYEDFLVFPLFTWRVPNIASELLTEKELEYGIHAGDAETSLLLSL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P+ V M+ A        + L     L   G   F W  K+L   GV+G+A  AT +KG+
Sbjct: 186 LPNQVNMEKAV---KEYPQGLPENSLLSMEGKLPFAWLTKELTKSGVMGDATVATKEKGD 242

Query: 237 GLLSYFANCFIQLLNDINSF 256
            LL   ++ ++QL+ +I  F
Sbjct: 243 KLLESLSDSWVQLIENIYQF 262


>gi|17228869|ref|NP_485417.1| hypothetical protein alr1374 [Nostoc sp. PCC 7120]
 gi|17130721|dbj|BAB73331.1| alr1374 [Nostoc sp. PCC 7120]
          Length = 262

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 71/260 (27%), Positives = 132/260 (50%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +     +   +++ +++ P+GA EQHG HLP+  D  I  G+  +  S L
Sbjct: 5   IPPERFFAYLTWKEIEEMPNKENVVIIQPVGAIEQHGLHLPLIVDAAIGVGVLGKALSKL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P   +P    G S EH +  GT TL+        + + ++I + G RK+V++N+HG
Sbjct: 65  DASIPAYALPTLYYGKSNEHWHFPGTITLSTETLTATIMEVAESIYRAGFRKLVLMNSHG 124

Query: 119 GNSPLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ +V+ +  +++    V    +W    I + ++S  E   G+H G+ ETS+MLA+
Sbjct: 125 GQPQVMQMVARDLHVKYGDFAVFPLFTWRVPHITKELLSPKEAIQGMHAGDAETSIMLAI 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  V++D A    +           L   G     W  KD++  GV+G+A  AT +KG+
Sbjct: 185 LPDQVQLDKAV---AEYPPEKPEGSLLSWEGRLPVAWVTKDISKSGVIGDATTATKEKGD 241

Query: 237 GLLSYFANCFIQLLNDINSF 256
            +L   ++ +++++ +I +F
Sbjct: 242 RILESVSDGWVEVIKEIYAF 261


>gi|159027358|emb|CAO90544.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 267

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 78/260 (30%), Positives = 130/260 (50%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +         +++ +++ P+GA EQHGPHLP+  D  I+ G+  +    L
Sbjct: 5   IPPHRYFPYLTWTDIDSMLDKENVVIIQPIGAIEQHGPHLPIAVDAAISLGVLGKAFEKL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P   +P    G S EH    GT TL+ A  +     I +++ + G RK+V++N+HG
Sbjct: 65  NTNVPAFALPCLYYGKSNEHWSFPGTITLSGATLLTLIQEIAESLYRSGFRKLVLMNSHG 124

Query: 119 GNSPLVSIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I + +   ++   +V    +W        + S  E E GIH G++ETS+ML+L
Sbjct: 125 GQPQVMEIAARDIHQQYPDFLVFPFFTWRVPHNAAELFSEYELEYGIHAGDVETSIMLSL 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  VK++ A        + L     L   G   F W  K+L   GV+G+A +A+ +KG+
Sbjct: 185 LPEQVKIERAVR---EYPQGLPENSLLTMEGKLPFAWLTKELTKSGVMGDATNASKEKGD 241

Query: 237 GLLSYFANCFIQLLNDINSF 256
            LL   AN ++Q + D+  F
Sbjct: 242 RLLESVANGWVQAIIDVYRF 261


>gi|307154149|ref|YP_003889533.1| Creatininase [Cyanothece sp. PCC 7822]
 gi|306984377|gb|ADN16258.1| Creatininase [Cyanothece sp. PCC 7822]
          Length = 270

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 75/260 (28%), Positives = 131/260 (50%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +         +++ +++ P+GA EQHGPHLP+  D+ I+ G+  +    L
Sbjct: 6   IPPKRFFPYLTWTDIQAMPDKENVVIIQPVGAIEQHGPHLPIIVDSAISMGVLGKALLKL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P   +P    G S EH +  GT TL+    +     +  ++ + G RK+V++N+HG
Sbjct: 66  DAEIPAYALPCLYYGKSNEHWHFPGTITLSAQTLLSVIQEMAQSLYRSGFRKLVLMNSHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I + +   ++    V    +W    I + +++  E E GIH G+ ETS++L+L
Sbjct: 126 GQPQIMEIAARDLHQQYPDFSVFPLFTWRVPHIAKELLTPQELEYGIHAGDAETSILLSL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  VKMD A        + L     L   G   F W   +L+  GV+G+A  A+ +KG+
Sbjct: 186 LPEQVKMDQAV---KEYPQGLPADSLLSMEGKLPFAWLTAELSQSGVMGDATAASREKGD 242

Query: 237 GLLSYFANCFIQLLNDINSF 256
            LL   +N ++Q++ D+  F
Sbjct: 243 RLLESVSNGWVQVIKDVYQF 262


>gi|119510979|ref|ZP_01630100.1| Creatininase [Nodularia spumigena CCY9414]
 gi|119464324|gb|EAW45240.1| Creatininase [Nodularia spumigena CCY9414]
          Length = 267

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 75/260 (28%), Positives = 133/260 (51%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +         +++ +++ P+GA EQHGPHLP+  D  I  G+       L
Sbjct: 5   IPPERFFPYLTWTDIQAMPDKENVVIIQPVGAIEQHGPHLPLIVDAAIGVGVLGAALKKL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
             R+P   +P    G S EH +  GT TL+        + + ++I + G RK+V++N+HG
Sbjct: 65  DVRIPAYALPTLYYGKSNEHWHFPGTITLSTQTLTAIIMEMGESIYRAGFRKLVLMNSHG 124

Query: 119 GNSPLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ +V+ +  +++   +V    +W    I + +++  E   G+H G+ ETS+MLA+
Sbjct: 125 GQPQVMQMVARDLHIQYDDFLVFPLFTWRVPHITKELLTPKEATQGMHAGDAETSIMLAI 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  VKMDLA    +           L   G     W+ +D++  GV+G+A  AT +KG+
Sbjct: 185 LPEQVKMDLAV---AEYPPEQPQSSLLSLEGKLPVSWATRDVSKSGVIGDATTATKEKGD 241

Query: 237 GLLSYFANCFIQLLNDINSF 256
            +L   ++ ++Q + DI +F
Sbjct: 242 RILESVSDGWVQAIQDIYAF 261


>gi|119485478|ref|ZP_01619806.1| Creatininase [Lyngbya sp. PCC 8106]
 gi|119457234|gb|EAW38360.1| Creatininase [Lyngbya sp. PCC 8106]
          Length = 271

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 74/271 (27%), Positives = 126/271 (46%), Gaps = 13/271 (4%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +         +++ +++ P+G+ EQHGPHLP+  D+ IA  +     + L
Sbjct: 5   IPPERFFPYLTWTEINAMSDKENIVIIQPIGSIEQHGPHLPLIVDSAIATAVTGEALAKL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P   +P    G S EH +  GT TL         +   ++I + G RK+V +NAHG
Sbjct: 65  NTEIPAYALPTLYYGKSNEHWHFPGTITLNSNTLSSVLIETGESIYRAGFRKLVFINAHG 124

Query: 119 GNSPLVSIVSTEARMRFS--MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ +V+ +   ++   ML     W        +++  E E GIH G+ ETS+ML++
Sbjct: 125 GQPQILEMVARDLHQKYEDFMLFPLFVWRVPNAATELLTPKELEYGIHAGDAETSVMLSI 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  V+ +            L     L   G   F W  +DL   GV+G+A  AT +KG+
Sbjct: 185 LPEQVRKNQVVC---EYPHDLPKNSMLSMEGKLPFAWVTRDLTKSGVLGDATVATKEKGD 241

Query: 237 GLLSYFANCFIQLLNDINSFDVSIFDKDVQK 267
            +L   A  +++++ DI  F      +  Q+
Sbjct: 242 KILESLAESWVKVITDIYKF------RQPQR 266


>gi|209964752|ref|YP_002297667.1| Creatinine amidohydrolase, putative [Rhodospirillum centenum SW]
 gi|209958218|gb|ACI98854.1| Creatinine amidohydrolase, putative [Rhodospirillum centenum SW]
          Length = 272

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 94/262 (35%), Positives = 142/262 (54%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
              + + +           + +LP+ A EQHGPHLP+ TD +I  G+ ER  ++LPP LP
Sbjct: 9   TRFWDELTTEDIRALPPGTVAILPVAATEQHGPHLPLATDAVINRGILERALALLPPELP 68

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
              +P + +G+S EH    GT TL    A   W  + +     G+R++V+ N+HGGN PL
Sbjct: 69  ALALPAQGVGHSPEHGGFPGTLTLRAETARAAWTELAEGAHAAGVRRLVLFNSHGGNPPL 128

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           + +++ + R+R  +LVV  SW+RF  P G+    E E GIHGG +ETS+ML L P LV+ 
Sbjct: 129 LDLMAVDLRVRRGLLVVPASWTRFGYPPGLFPPEELEFGIHGGAVETSLMLHLRPDLVRR 188

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D   +F S         ++LR+HG    GW   DLNP G VG+A  AT + G+ LL + A
Sbjct: 189 DRIADFPSAARAVAAGNRFLRSHGRIGTGWMTGDLNPAGAVGDARLATAEAGQALLEHAA 248

Query: 244 NCFIQLLNDINSFDVSIFDKDV 265
                L+ +++   +     + 
Sbjct: 249 TALATLVGEVHRLPLPWDGAEP 270


>gi|222149787|ref|YP_002550744.1| creatinine amidohydrolase [Agrobacterium vitis S4]
 gi|221736769|gb|ACM37732.1| creatinine amidohydrolase [Agrobacterium vitis S4]
          Length = 273

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 151/257 (58%), Positives = 189/257 (73%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           P   F  N   L    R +WI VLPLGA+EQHGPHLP  TDTIIA G+ +R+   LP  L
Sbjct: 4   PEPYFQCNDPALSPAERANWIAVLPLGAHEQHGPHLPFETDTIIAQGVVDRLILALPDTL 63

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           PVT +PVEP+GYS+EHM V GT+TLT+ EA+E WL I + +   GIRK+++LNAHGGNSP
Sbjct: 64  PVTFLPVEPVGYSVEHMDVFGTRTLTFNEAVERWLGIAETLSGQGIRKLMMLNAHGGNSP 123

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           L+++V+TEAR+RFSML V+TSW+RF  P G+I   +  I IHGG+IETS+MLAL P LV 
Sbjct: 124 LMTVVATEARIRFSMLAVATSWTRFGQPDGLIRPEDKAIDIHGGDIETSVMLALRPDLVA 183

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           MD A+NFSSRQSEF   F +LRA+G H+FGW M DLNP GV GNA  AT +KGE LLS+ 
Sbjct: 184 MDKAQNFSSRQSEFAARFTHLRAYGPHAFGWKMADLNPLGVAGNASVATAEKGENLLSHA 243

Query: 243 ANCFIQLLNDINSFDVS 259
            +  ++LL DI+ FD+ 
Sbjct: 244 VHGLVELLWDIHDFDIE 260


>gi|220924362|ref|YP_002499664.1| Creatininase [Methylobacterium nodulans ORS 2060]
 gi|219948969|gb|ACL59361.1| Creatininase [Methylobacterium nodulans ORS 2060]
          Length = 267

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 104/258 (40%), Positives = 153/258 (59%), Gaps = 1/258 (0%)

Query: 3   PLIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   + D +            I VLP+ A EQHGPHLP+ TD IIA G   R+++++P  
Sbjct: 2   PARSWQDLTTAEIRARPLHRAIAVLPVAAVEQHGPHLPLGTDVIIAEGYLARMRALVPED 61

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           L V  +PV+ +G S EH+   GT TL+   A+  W+ I  A+ + G RK+VI+ +HGGNS
Sbjct: 62  LEVLLLPVQAVGKSDEHLSFPGTLTLSGPTALAAWVEIGTAVHRAGCRKLVIVTSHGGNS 121

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            L+ +V+ E R    ++ V+T+WSRF  P G+    E   GIHGG +ET++MLAL P LV
Sbjct: 122 ALIDLVALELRRSCGLVAVTTAWSRFGYPPGLFPPEEVRHGIHGGAVETALMLALRPDLV 181

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D   +F  R     R+F +LRA    +F W  +DLNP G +G+A  AT+  GE  L++
Sbjct: 182 RRDELRDFMPRSRAMERDFTHLRAGRPAAFAWLAEDLNPSGAIGDATLATLDAGEAALAH 241

Query: 242 FANCFIQLLNDINSFDVS 259
            A  F++LL D++ F ++
Sbjct: 242 GARAFVELLRDVDRFSLT 259


>gi|121610089|ref|YP_997896.1| creatininase [Verminephrobacter eiseniae EF01-2]
 gi|121554729|gb|ABM58878.1| Creatininase [Verminephrobacter eiseniae EF01-2]
          Length = 272

 Score =  248 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 87/263 (33%), Positives = 135/263 (51%), Gaps = 1/263 (0%)

Query: 4   LIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
              ++D S        R+  I VLPLGA EQHGPHLPM+TDT     +     + LP  L
Sbjct: 7   SRFWSDLSSQEFSRLDRERLIAVLPLGAIEQHGPHLPMSTDTATIDAMVRASLAHLPDAL 66

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           PV  +P    G S EH    GT TL+ + +I     I   + + G+RK+V+ N+HGG   
Sbjct: 67  PVLFLPTLAYGKSNEHARYPGTLTLSASTSIALCKEIGACVARAGVRKLVLYNSHGGQMS 126

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           ++ IV+ + R   SM+VV+ +W    +P+G+ +  E   GIH G +E+S+ML + P  V 
Sbjct: 127 VMDIVARDLRQEQSMMVVAANWFTLGLPEGLFAAQELRHGIHAGALESSVMLQIRPGDVH 186

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
                +F S         ++L   G +  GW M+D+NP G  G+A  A+ +KG  +L + 
Sbjct: 187 TGELRDFDSLGQTLAAQGQWLAITGGNKLGWQMQDINPAGAAGDATCASAEKGAAVLDHV 246

Query: 243 ANCFIQLLNDINSFDVSIFDKDV 265
                +LL++++ F +       
Sbjct: 247 GRRLAELLHEVDRFPLERLANLP 269


>gi|260459614|ref|ZP_05807868.1| Creatininase [Mesorhizobium opportunistum WSM2075]
 gi|259034416|gb|EEW35673.1| Creatininase [Mesorhizobium opportunistum WSM2075]
          Length = 267

 Score =  248 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 105/258 (40%), Positives = 152/258 (58%), Gaps = 1/258 (0%)

Query: 4   LIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
            + + D      A    +  I VLP+ A EQHGPHLP++TDT I  G+ + + S LP  L
Sbjct: 7   RVWWGDYRTTEYASIDPEATIAVLPVAAIEQHGPHLPVSTDTSIMNGMLDTVISRLPDDL 66

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            +  +PV+ +G S EH++  GT TL     +E W  +  +I + G+RK++++N+HGGN  
Sbjct: 67  DIRILPVQAVGKSNEHLHAPGTLTLPATTLVEAWTELGLSIARAGVRKLIVVNSHGGNEE 126

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           ++ I++ E R+R  ML V TSW RF  P G+ +  E   GIHGG++ETS+ML   P LV 
Sbjct: 127 IMGIITRELRVREKMLAVKTSWQRFGRPAGMYTELEDRHGIHGGDVETSLMLHFRPDLVD 186

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           M  A+NF S  ++  + F  LR  G+H+F W   DLNP GVVG+A  AT +KG     Y 
Sbjct: 187 MGKADNFVSNVAKAEQEFSLLRHTGTHAFAWIASDLNPNGVVGDASIATAEKGRLTAEYQ 246

Query: 243 ANCFIQLLNDINSFDVSI 260
           A+ FI LL D+    ++ 
Sbjct: 247 ADGFISLLKDVRKAKLAE 264


>gi|86608888|ref|YP_477650.1| creatininase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557430|gb|ABD02387.1| creatininase [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 274

 Score =  248 bits (633), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 71/260 (27%), Positives = 127/260 (48%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +         +++ +++ P+ + EQHGPHLP+  D  I   +  R    L
Sbjct: 5   VPPHRFFPYLTWTEIQAMPDKENVVIIQPVASIEQHGPHLPLVVDACIGTAIIGRAMEKL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
            P +P   +P +  G + EH +  GT TL+    +     + ++I + G RK+V LN+HG
Sbjct: 65  EPEIPAYVLPTQCYGKANEHWHFPGTITLSAQTLMAVLTEVAESIYRAGFRKLVFLNSHG 124

Query: 119 GNSPLVSIVSTEARMRFSMLVVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ IV+ +   ++   ++     W      + + +  E E+GIH G+ ETSM++ L
Sbjct: 125 GQPQVLEIVARDLHQKYEDFMLFPVSVWRVPHEGRELFTEKERELGIHAGDGETSMLMHL 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  V+ D            L     L   G   F W+ +DL   GV+G+A  AT +KG+
Sbjct: 185 LPDTVRTDRLVC---EYPHDLPENSLLSMEGRIPFAWATRDLTQSGVLGDATAATPEKGK 241

Query: 237 GLLSYFANCFIQLLNDINSF 256
            L+   ++ +++L+ D++ F
Sbjct: 242 VLVESMSDGWVRLIRDLHRF 261


>gi|166368413|ref|YP_001660686.1| creatininase [Microcystis aeruginosa NIES-843]
 gi|166090786|dbj|BAG05494.1| creatininase [Microcystis aeruginosa NIES-843]
          Length = 268

 Score =  248 bits (633), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 76/260 (29%), Positives = 129/260 (49%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +         +++ +++ P+GA EQHGPHLP+  D  I+ G+  +    L
Sbjct: 6   IPPHRYFPYLTWTDIDSMPDKENVVIIQPIGAIEQHGPHLPIAVDAAISLGVLGKAFEKL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +    +P    G S EH    GT TL+ A  +     I +++ + G RK+V++N+HG
Sbjct: 66  DTNIAAFALPCLYYGKSNEHWSFPGTITLSAATLLTLIQEIAESLYRSGFRKLVLMNSHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I + +   ++   +V    +W        + S  E E GIH G++ETS+ML+L
Sbjct: 126 GQPQVMEIAARDIHQQYPDFLVFPFFTWRVPHNAAELFSEYELEYGIHAGDVETSIMLSL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  VK++ A        +       L   G   F W  K+L   GV+G+A +A+ +KG+
Sbjct: 186 LPEQVKIERAVR---EYPQGWPENSLLTMEGKLPFAWLTKELTKSGVMGDATNASKEKGD 242

Query: 237 GLLSYFANCFIQLLNDINSF 256
            LL   AN ++Q++ D+  F
Sbjct: 243 RLLESVANGWVQVIADVYQF 262


>gi|163851556|ref|YP_001639599.1| creatininase [Methylobacterium extorquens PA1]
 gi|163663161|gb|ABY30528.1| Creatininase [Methylobacterium extorquens PA1]
          Length = 258

 Score =  248 bits (633), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 104/257 (40%), Positives = 149/257 (57%), Gaps = 1/257 (0%)

Query: 3   PLIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   + D +            I VLP+ A EQHGPHLP+ TDT+IA G   R+   +P  
Sbjct: 2   PARSWLDLTTAEIRARDMSRTIAVLPVAAVEQHGPHLPLGTDTLIAEGYLARVAPQVPEA 61

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           L V  +PV+ +G S EH    GT TLT   A+  W  I  ++ + G  K+VI+++HGGNS
Sbjct: 62  LDVLLLPVQSVGKSDEHDSFPGTLTLTAPTALAAWTEIGASLHRAGCTKLVIVSSHGGNS 121

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            L+ +V+ E R RF M+ V+TSWSR  +P+G+    E   GIH G IET++MLAL P LV
Sbjct: 122 ALIDLVAGELRGRFGMVAVTTSWSRLGLPEGLFPAGEIRHGIHAGGIETALMLALRPDLV 181

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           +    E+F  R     R+F  LRA    +F W  +DL+P G +G+A   T + GE  L+Y
Sbjct: 182 RQAHIEDFEPRTVAMERDFALLRAGRPAAFAWKTEDLHPSGALGDARLGTAEAGEAALAY 241

Query: 242 FANCFIQLLNDINSFDV 258
            A+ F++LL +++ F +
Sbjct: 242 GAHAFVRLLEEVDRFSL 258


>gi|16332320|ref|NP_443048.1| creatinine amidohydrolase [Synechocystis sp. PCC 6803]
 gi|1653950|dbj|BAA18860.1| creatinine amidohydrolase [Synechocystis sp. PCC 6803]
          Length = 273

 Score =  248 bits (633), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 76/267 (28%), Positives = 123/267 (46%), Gaps = 6/267 (2%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +         +   I++ PLG+ EQHGPHLP+  D  I+ G+  +    L
Sbjct: 7   IPPQRYFAYLTWTDIEALPDKDKTIIIQPLGSIEQHGPHLPLVVDAAISEGVLGKALQTL 66

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
            P +P   +P    G S EHM   G  TL+    +     +  ++ + G RK ++LN+HG
Sbjct: 67  APEIPAYVLPTLYYGKSNEHMGFPGVITLSAETLLVILKEVAASLYQSGFRKWILLNSHG 126

Query: 119 GNSPLVSIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I + +    +  L +    +W        +++  E   GIH G+ ETS+M+AL
Sbjct: 127 GQIQVLEIAARDLHQIYPDLQIFPFFTWRMPHCAADLLTPKEMTHGIHAGDGETSLMMAL 186

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P LV+ D              + + L   GS  F W  K+++  GV+G+A  AT +KGE
Sbjct: 187 WPELVREDRLV--KEFPQGIPADDELLSMEGSLPFAWLTKEVSRSGVMGDATVATKEKGE 244

Query: 237 GLLSYFANCFIQLLNDINSFDVSIFDK 263
            LL   A+   Q +  +  F     D+
Sbjct: 245 VLLDCLADGCRQAIEAVYHFQPPSLDR 271


>gi|13471353|ref|NP_102919.1| hypothetical protein mlr1298 [Mesorhizobium loti MAFF303099]
 gi|14022095|dbj|BAB48705.1| mlr1298 [Mesorhizobium loti MAFF303099]
          Length = 267

 Score =  247 bits (632), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 105/257 (40%), Positives = 151/257 (58%), Gaps = 1/257 (0%)

Query: 4   LIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
            + + D      A    +  I VLP+ A EQHGPHLP++TDT I  G+ + + S LP  L
Sbjct: 7   RVWWGDYRTTEYASIDPEATIAVLPVAAIEQHGPHLPVSTDTSIMNGMLDTVISRLPDDL 66

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            +  +PV+ +G S EH++  GT TL     +E W  +  +I + G+RK++++N+HGGN  
Sbjct: 67  DIRILPVQAVGKSNEHLHAPGTLTLPATTLVEAWTELGVSIARAGVRKLIVVNSHGGNEE 126

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           ++ I++ E R+R  ML V TSW RF  P G+ S  E   GIHGG++ETS+ML   P LV 
Sbjct: 127 IMGIITRELRVREKMLAVKTSWQRFGRPAGMYSELEDRHGIHGGDVETSLMLHFRPDLVD 186

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           M  A+NF S  +   + F  LR  G+H+F W   DLNP GVVG+A  AT +KG     + 
Sbjct: 187 MAKADNFVSNVTRAEKEFSLLRHTGTHAFAWIASDLNPNGVVGDASIATAEKGRLTAEHQ 246

Query: 243 ANCFIQLLNDINSFDVS 259
           A+ FI LL D+    ++
Sbjct: 247 ADGFISLLRDVRKAKLA 263


>gi|126658335|ref|ZP_01729485.1| Creatininase [Cyanothece sp. CCY0110]
 gi|126620484|gb|EAZ91203.1| Creatininase [Cyanothece sp. CCY0110]
          Length = 270

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 75/260 (28%), Positives = 129/260 (49%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCA--DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   S       + +++ ++V P+GA EQHGPHLP+  D+ I+ G+  +    L
Sbjct: 6   IPPHRFFPYLSWTEIESMEDKENVVIVQPIGAIEQHGPHLPIAVDSAISLGVLGKTLEKL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P   +P    G S EH    GT TL+    +     +  ++   G RK++++N+HG
Sbjct: 66  DLEIPAYSLPCLYYGKSNEHSGFPGTITLSATTLLSVITEVAQSVYNSGFRKLILMNSHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I + +    +    V    +W    I + +++  E E GIH G+ ETS++L+L
Sbjct: 126 GQPQIMEIAARDIHQHYQNFSVFPFFTWRVPHIAKELLTSQELEYGIHAGDAETSIILSL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  VKM  A        + L     +   G   F W  K+L   GV+G+A  AT +KG+
Sbjct: 186 LPDQVKMSQAV---KEYPQGLPEDSLVSMEGKLPFAWLTKELTKSGVMGDATAATKEKGD 242

Query: 237 GLLSYFANCFIQLLNDINSF 256
            LL+  ++ ++Q++ D+  F
Sbjct: 243 RLLASVSDGWVQVIKDVYRF 262


>gi|113474118|ref|YP_720179.1| creatininase [Trichodesmium erythraeum IMS101]
 gi|110165166|gb|ABG49706.1| Creatininase [Trichodesmium erythraeum IMS101]
          Length = 267

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 76/260 (29%), Positives = 130/260 (50%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +         +++ +++ P+G+ EQHG HLP+  D+ IA  +  +    L
Sbjct: 5   IPPDRFFPYLTWQDIETMPDKENVVIIQPVGSIEQHGLHLPLIVDSAIATYVTGKALEKL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P   +P +  G S EH +  GT TL     +       +++ + G RK+V LNAHG
Sbjct: 65  EKNIPAYALPTQYYGKSNEHWHFPGTITLCAQTLMAILTETGESLYRAGFRKLVFLNAHG 124

Query: 119 GNSPLVSIVSTEARMRFSMLVVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ IV+ +   ++   ++    +W      Q +++  E E+GIH G+ ETS+ML++
Sbjct: 125 GQPQVLKIVARDLHQKYEDFLLFPLSAWRVPNPCQELLTEKEMELGIHAGDAETSVMLSM 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P +VKMD A        + L     L   G  SF W  ++L   GV+G+A  AT +KG+
Sbjct: 185 LPDVVKMDKAVC---EYPQGLPEESMLSMEGKLSFAWLTRELTHSGVLGDATVATKEKGD 241

Query: 237 GLLSYFANCFIQLLNDINSF 256
            +L    N + +L+ D+  F
Sbjct: 242 HILDGLTNSWAKLIRDLYKF 261


>gi|99078031|ref|YP_611289.1| creatininase [Ruegeria sp. TM1040]
 gi|99035169|gb|ABF62027.1| Creatininase [Ruegeria sp. TM1040]
          Length = 263

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 86/258 (33%), Positives = 132/258 (51%), Gaps = 1/258 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M+    + +          +D I VLPLGA EQHGPHLP++ DT +    A R+ + L P
Sbjct: 1   MSIQGYWAELKTTEFQTLSQDCIAVLPLGATEQHGPHLPLSVDTDLVQETAARMLANLDP 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V  +P   I  S EH    GT +L+    +     I  ++ + GI ++V+ N HGGN
Sbjct: 61  AQSVLVLPALAITKSNEHNRFSGTLSLSPETLLAVLREIGASVARAGIERLVLFNGHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           + ++ + + E R+   ++VV  SWS F    G+       + +H G+ ETS MLA  P L
Sbjct: 121 TAILQVAARELRISHDLIVVVCSWSGFAEADGLFDPAAYAVDLHAGDSETSAMLASHPGL 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHG-SHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           V M  A+ F +   ++   F+++   G   + GW   DLNP GV G+A+ AT +KGE +L
Sbjct: 181 VDMSRAKTFGTAMEDWAGEFRFIGLTGEPATPGWIADDLNPDGVCGDAVAATAEKGEAML 240

Query: 240 SYFANCFIQLLNDINSFD 257
           +     F + L +   FD
Sbjct: 241 ASAGRNFARFLAEFAHFD 258


>gi|75674528|ref|YP_316949.1| creatininase [Nitrobacter winogradskyi Nb-255]
 gi|74419398|gb|ABA03597.1| creatininase [Nitrobacter winogradskyi Nb-255]
          Length = 272

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 105/265 (39%), Positives = 154/265 (58%), Gaps = 1/265 (0%)

Query: 2   NPLIIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
            P   +     P  A +A  +WI VLPL A EQHGPHLP+ TD +IA     +++  LP 
Sbjct: 4   TPPFDWLAIDWPGVAPEAAANWIAVLPLAATEQHGPHLPLTTDVLIAEAYLAKVREWLPQ 63

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            +P T +PV+PIG S EHM   GT+TL+   A+  W A+ +   + GIRKIV++++HGGN
Sbjct: 64  EIPATFLPVQPIGISTEHMDFPGTRTLSNEAALRAWTALGEEAARRGIRKIVMVSSHGGN 123

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           S  +S+V+ + R R  ML V+T+W+RF +P G+    E   G+HGG +ETS+MLA  P  
Sbjct: 124 SAAMSMVAQDLRARHRMLAVTTAWARFGVPDGLFDAQELRHGVHGGAVETSIMLARYPDR 183

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+ D   +FS       + +++L       F W  +DL+P G  G+A  A+ +KGE LL+
Sbjct: 184 VRSDRIADFSPASIAIEKTYRWLGTQRPAPFAWQAQDLHPSGAAGDATQASAEKGERLLA 243

Query: 241 YFANCFIQLLNDINSFDVSIFDKDV 265
           + A  F +LL D+  FD +      
Sbjct: 244 HGARAFCELLADVARFDPAALTGGP 268


>gi|254471105|ref|ZP_05084508.1| creatininase [Pseudovibrio sp. JE062]
 gi|211960247|gb|EEA95444.1| creatininase [Pseudovibrio sp. JE062]
          Length = 262

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 101/263 (38%), Positives = 142/263 (53%), Gaps = 2/263 (0%)

Query: 1   MNPLIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   + D           +  I +LP  + EQHGPHLP+  DT I  G+ E + +  P
Sbjct: 1   MFPRRYWMDFKTTDFESIDPQRTIAILPTASVEQHGPHLPLGVDTYINQGMLETLCARAP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L    +P++ IG S EH++  GT +L    A +HW+ +  ++   GIRK+VI N+HGG
Sbjct: 61  EALDFRILPLQCIGKSDEHIHAPGTLSLRADTAAKHWIDVGTSVAACGIRKMVIANSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  L+ IV+ E R+R  MLV    WS F  P+G+ S  E + G+HGG+ ETS+ML     
Sbjct: 121 NLDLIGIVARELRIRSKMLVGKCLWSSFGAPEGMFSEEELKFGLHGGDEETSLMLHFRAD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV M  A++F S   + L     L   G  S+GW   DLNP G VGNA +A+ +KG    
Sbjct: 181 LVDMQRAQDFRSSAQD-LDENARLGPTGLPSYGWIASDLNPHGTVGNAANASSEKGRLTA 239

Query: 240 SYFANCFIQLLNDINSFDVSIFD 262
            +  + FI  L +   FD+S FD
Sbjct: 240 EHQVDGFIGFLQETADFDISRFD 262


>gi|218529990|ref|YP_002420806.1| creatininase [Methylobacterium chloromethanicum CM4]
 gi|218522293|gb|ACK82878.1| Creatininase [Methylobacterium chloromethanicum CM4]
          Length = 272

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 94/262 (35%), Positives = 140/262 (53%), Gaps = 1/262 (0%)

Query: 2   NPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
                + D +    +       + +LP+ A EQHGPHLP+  D  I AG+  R  +++P 
Sbjct: 3   PASRWWWDLTTEDFSRLDWGPLVAILPVAAVEQHGPHLPVRVDAAINAGILARAVALMPD 62

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LP   +P+ PIG S EH    GT +L++      W+   +++ + G R+++ILN+HGG 
Sbjct: 63  ELPALVLPMLPIGKSNEHHAFPGTLSLSHETLARLWIETAESVHRAGCRRLLILNSHGGQ 122

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
             ++ IV+ E R+R  ML V +SW   T    + +  E   GIHGGEIETS MLAL P L
Sbjct: 123 PQVMEIVTRELRVRLGMLAVGSSWGGVTPMDDLFAQAERRHGIHGGEIETSAMLALHPDL 182

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+M+ A++F     E  R    L   G   FGW  +DL+P GV GNA  A V++G  L+ 
Sbjct: 183 VRMERADDFVPLSVEMERAGGLLTPEGRVGFGWMAQDLHPSGVSGNAAAADVRRGAELVE 242

Query: 241 YFANCFIQLLNDINSFDVSIFD 262
             A   ++L+ +I  F +    
Sbjct: 243 RAAAGVVRLVREIADFPLERLG 264


>gi|319783017|ref|YP_004142493.1| creatininase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168905|gb|ADV12443.1| Creatininase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 267

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 105/257 (40%), Positives = 152/257 (59%), Gaps = 1/257 (0%)

Query: 4   LIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
            + + D      A    +  I VLP+ A EQHGPHLP++TDT I  G+ + + S LP  L
Sbjct: 7   RVWWGDYRTTEYASIDPEATIAVLPVAAIEQHGPHLPVSTDTSIMNGMLDTVISRLPDDL 66

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            +  +PV+ +G S EH++  GT TL     IE W  +  +I + G+RK++++N+HGGN  
Sbjct: 67  DIRILPVQAVGKSNEHLHAPGTLTLPATTLIEAWTELGLSIARAGVRKLIVVNSHGGNEE 126

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           ++ IV+ E R+R  ML V TSW RF  P G+ +  E   GIHGG++ETS+ML   P LV 
Sbjct: 127 IMGIVTRELRVREKMLAVKTSWQRFGRPAGMYTELEDRHGIHGGDVETSLMLHFRPDLVD 186

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           M  +++F S  ++  + F  LR  G+H+F W   DLNP GVVG+A  AT +KG     Y 
Sbjct: 187 MGKSDSFVSNVAKAEKEFSLLRHTGTHAFAWIASDLNPNGVVGDASIATAEKGRLTAEYQ 246

Query: 243 ANCFIQLLNDINSFDVS 259
           A+ FI LL D+    ++
Sbjct: 247 ADGFISLLQDVRKAKLA 263


>gi|300718743|ref|YP_003743546.1| Creatininase [Erwinia billingiae Eb661]
 gi|299064579|emb|CAX61699.1| Creatininase [Erwinia billingiae Eb661]
          Length = 265

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 94/257 (36%), Positives = 133/257 (51%), Gaps = 1/257 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + D S    ++   D +  VLP+GA EQHGPHLP+  D  I AG+  R   ++P
Sbjct: 3   MPSSRWWWDLSTREFSELDMDKVIAVLPIGAVEQHGPHLPVRVDAAINAGIIARAVELMP 62

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             LPV  +P  P+G S EH+   GT TL Y    + W  +  +  + GIRK++  N+HGG
Sbjct: 63  ADLPVLILPALPVGKSDEHLNFPGTLTLPYEVLGKVWFEVAKSAWRAGIRKLIFWNSHGG 122

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
              L+ IV  + R+   +  V  SW R      + S  E + GIHGGE ETS+ML L P 
Sbjct: 123 QPQLMEIVCRQLRIELDLFAVGASWFRTIDSSDLFSAEELQHGIHGGESETSVMLHLHPD 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+MD A+NF S           L   G   FGW  +DL+P G  GNA  A  ++G+   
Sbjct: 183 LVQMDYAQNFVSASVALAETGGILTPEGGVGFGWMAEDLHPSGTTGNAAAADAERGKIET 242

Query: 240 SYFANCFIQLLNDINSF 256
              A   I+L+ ++ ++
Sbjct: 243 DRAAEALIRLIEEVQAY 259


>gi|116253884|ref|YP_769722.1| hypothetical protein RL4147 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258532|emb|CAK09636.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 262

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 147/261 (56%), Positives = 191/261 (73%), Gaps = 1/261 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P   F D S P  A   +  I VLPLGA+EQHGPHLP  TDT+IA G+A R+K  LP 
Sbjct: 2   MTPSPRFED-SNPAFAPDGRHLIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKMALPA 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPVT +P E +GYSIEHM V+GTKTL + EA+  WL I + + K GIRK V+LNAHGGN
Sbjct: 61  GLPVTFLPAESVGYSIEHMDVEGTKTLAFDEAVNGWLGIAEGLAKQGIRKFVMLNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPL+S+V+TEAR+RF+ML V+TSW+RF +P G+I+  E  IGIHGG+IETS+MLAL P  
Sbjct: 121 SPLISVVATEARVRFAMLAVATSWTRFGVPDGVITPEEKAIGIHGGDIETSVMLALHPDK 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M  A +F S+Q+EF  +FK+LRA+G H+FGW M DLN +GV GNA  AT +KGE L++
Sbjct: 181 VDMAKAADFRSQQTEFAESFKHLRAYGPHAFGWKMSDLNTEGVAGNAAAATAEKGEALIA 240

Query: 241 YFANCFIQLLNDINSFDVSIF 261
           +     ++LL+D+++FDV+  
Sbjct: 241 HAVKGLVELLSDVDAFDVAQL 261


>gi|163758918|ref|ZP_02166005.1| creatinine amidohydrolase [Hoeflea phototrophica DFL-43]
 gi|162284208|gb|EDQ34492.1| creatinine amidohydrolase [Hoeflea phototrophica DFL-43]
          Length = 247

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 122/236 (51%), Positives = 164/236 (69%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
            I VLPLGA+EQHGPHLP  TD +IA  +A+R+    PP + V  +P+EP+GYSIEHM V
Sbjct: 7   TIAVLPLGAHEQHGPHLPFETDAVIAGAVAQRLAKTAPPGIKVEVLPLEPVGYSIEHMDV 66

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
           DGT+TL + EA+  W+ I       G+R++++LNAHGGNSPL++IV+TEAR+RF+MLVV+
Sbjct: 67  DGTQTLAFDEAVNRWIRIAGECADRGVRRLMLLNAHGGNSPLLTIVATEARVRFNMLVVA 126

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSW+RF +P  +IS  +    IH G+IETS+MLAL P LV+ +   +F S Q +F   FK
Sbjct: 127 TSWTRFGVPDEVISPDDKAYDIHAGDIETSVMLALRPELVRQEAIRDFPSSQQDFTARFK 186

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
           +LRA+G H+FGW M DLN  G  G A  A+  KGE LL +      +LL+D+  FD
Sbjct: 187 HLRAYGPHAFGWKMSDLNSDGAAGKASQASAAKGEALLDHAVAGLCELLDDMAQFD 242


>gi|170747316|ref|YP_001753576.1| creatininase [Methylobacterium radiotolerans JCM 2831]
 gi|170653838|gb|ACB22893.1| Creatininase [Methylobacterium radiotolerans JCM 2831]
          Length = 262

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 101/255 (39%), Positives = 147/255 (57%), Gaps = 1/255 (0%)

Query: 6   IFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
            +++ +    A       I VLP+ A EQHGPHLP+ TDT+IA G   R++  +P  L V
Sbjct: 5   FWSELTTDDLARRDMGRAIAVLPVAATEQHGPHLPLATDTLIAEGYLARVRDGVPADLDV 64

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +PV+P+G S EH    GT +L    A+  W  I  A+ + G RK+VI+ +HGGNS L+
Sbjct: 65  LLLPVQPVGKSDEHDAFPGTLSLETGTALAAWTGIGAAVHRAGCRKLVIVTSHGGNSALI 124

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
            +V+ E R RF M+ V+TSW+R   P G+    E   GIH G IET++MLAL P LV+ D
Sbjct: 125 DLVAGELRARFGMVAVTTSWARLGYPDGLFPADEIAHGIHAGGIETALMLALRPDLVRTD 184

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
              +F  R    +R+F +LRA    +F W   DL   G +G+A   T + G   L + A 
Sbjct: 185 RVADFPPRTLSMIRDFTHLRAGRPAAFAWKAGDLQASGAMGDARLGTAEAGRAALDHGAR 244

Query: 245 CFIQLLNDINSFDVS 259
            F+ LL D+++F+++
Sbjct: 245 AFVALLRDVDAFELA 259


>gi|254421444|ref|ZP_05035162.1| creatininase subfamily [Synechococcus sp. PCC 7335]
 gi|196188933|gb|EDX83897.1| creatininase subfamily [Synechococcus sp. PCC 7335]
          Length = 281

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 81/267 (30%), Positives = 132/267 (49%), Gaps = 8/267 (2%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F     P   D   + + +++ P+GA EQHGPHLP+  DT+IA  +  +    L
Sbjct: 18  IPPQRFFPYLQWPQIRDLPDKANTLIIQPVGAIEQHGPHLPIIVDTVIATSIIGKALHQL 77

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +    +P    G S EH    GT  L+        +   ++I   G RK++++N HG
Sbjct: 78  DDAIAAYALPPLYYGKSNEHSQFPGTIALSAQTLTAVLMETAESIYHAGFRKLLLVNGHG 137

Query: 119 GNSPLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ IV+ + R++   L++     W        I+   E + GIH G+IETS++LAL
Sbjct: 138 GQPQILEIVARDLRVQHDDLMIFPLFVWGVPHRVAEIVGQTEYDEGIHAGDIETSVLLAL 197

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  VKM  A     +          L   G+    W+MKDL+  GVVG+A  AT +KGE
Sbjct: 198 LPEQVKMAAAVREFPKAFP---PGSLLSLEGNLPMAWTMKDLSRSGVVGDATAATSEKGE 254

Query: 237 GLLSYFANCFIQLLNDINSFD-VSIFD 262
            +L+  +  ++++  +I  F+ +S+ D
Sbjct: 255 AILNSVSAGWVKVFEEIYRFEGLSLQD 281


>gi|332709220|ref|ZP_08429186.1| uncharacterized protein, putative amidase [Lyngbya majuscula 3L]
 gi|332352029|gb|EGJ31603.1| uncharacterized protein, putative amidase [Lyngbya majuscula 3L]
          Length = 269

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 78/260 (30%), Positives = 132/260 (50%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P   F   +         +++ +++ P+ + EQHGPHLP+  D  I  G+  +    L
Sbjct: 5   IPPERFFPYLTWTDIEQMPDKENVVIIQPVASIEQHGPHLPLIVDAAIGVGVLGKALGCL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
            P +P   +P    G S EH +  GT TL+    +   + + D+I + G RK+V++N+HG
Sbjct: 65  DPEIPAYALPPLYYGKSNEHWHFPGTITLSAQTLLAVLMEMADSIYRCGFRKLVLMNSHG 124

Query: 119 GNSPLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I + +   +    +V    +W    + + + +  E E+GIHGG++ETS+ML L
Sbjct: 125 GQPQVMEIAARDIHHKHEDFMVFPLFTWGVPNMAKELATQKELELGIHGGDLETSLMLCL 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  VKMD A        + L     L   G+ SF W  K L   GV+G+A  A+ +KG+
Sbjct: 185 LPGQVKMDRAV---KEYPQGLPEDSLLSMEGNLSFAWLTKGLTQSGVLGDATAASEEKGD 241

Query: 237 GLLSYFANCFIQLLNDINSF 256
            LL+   + ++ ++ DI  F
Sbjct: 242 RLLASLCDGWVNVIRDIYRF 261


>gi|172036274|ref|YP_001802775.1| putative creatininase [Cyanothece sp. ATCC 51142]
 gi|171697728|gb|ACB50709.1| putative creatininase [Cyanothece sp. ATCC 51142]
          Length = 269

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 74/260 (28%), Positives = 127/260 (48%), Gaps = 7/260 (2%)

Query: 1   MNPLIIFTDNSLPLCA--DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +     F   S       + +++ ++V P+GA EQHGPHLP+  D+ I+ G+  +    L
Sbjct: 6   IPAHRFFPYLSWTEIDSMEDKENVVIVQPIGAIEQHGPHLPIAVDSAISLGVLGKALEKL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P   +P    G S EH    GT TL+    +     +  ++   G RK++++N+HG
Sbjct: 66  DLEIPAYSLPCLYYGKSNEHSGFPGTITLSATTLLSVITEVAQSVYNSGFRKLILMNSHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I + +    +    V    +W    I   +++  E E GIH G+ ETS++L+L
Sbjct: 126 GQPQIMEIAARDIHQHYQDFSVFPFFTWRVPHIAGELLTPQELEYGIHAGDAETSIILSL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  VKM  A        + L     +   G   F W  K+L   GV+G+A  AT +KG+
Sbjct: 186 LPDQVKMSQAV---KEYPQGLPEDSLVSMEGKLPFAWLTKELTKSGVMGDATAATKEKGD 242

Query: 237 GLLSYFANCFIQLLNDINSF 256
            LL+  ++ ++Q++ D+  F
Sbjct: 243 RLLASVSDGWVQVIKDVYRF 262


>gi|188581345|ref|YP_001924790.1| creatininase [Methylobacterium populi BJ001]
 gi|179344843|gb|ACB80255.1| Creatininase [Methylobacterium populi BJ001]
          Length = 258

 Score =  241 bits (616), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 103/255 (40%), Positives = 148/255 (58%), Gaps = 1/255 (0%)

Query: 3   PLIIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   + D +            I VLP+ A EQHGPHLP+ TDT+IA G  ER+  ++P  
Sbjct: 2   PARSWLDLTTEEIRTRDMSRAIAVLPVAAVEQHGPHLPLGTDTLIAEGYLERVARLVPDG 61

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           L V  +PV+ +G S EH    GT TLT A A+  W  I  ++ + G  ++VI+++HGGNS
Sbjct: 62  LDVLLLPVQAVGKSDEHDSFPGTLTLTAATALAAWTEIGASLHRAGCTRLVIVSSHGGNS 121

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            L+ +V+ E R RF M+ V+TSWSR  +P+G+    E   GIH G IET++MLAL P LV
Sbjct: 122 ALIDLVAGELRGRFGMVAVTTSWSRLGLPEGLFPAEEIRHGIHAGGIETALMLALRPDLV 181

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + +    F  R     R+F  LRA    +F W  +DL+P G +G+A   T + GE  L +
Sbjct: 182 RREHVAAFVPRTVAMARDFTLLRAGRPAAFAWKTEDLHPSGALGDARLGTAEAGEAALDH 241

Query: 242 FANCFIQLLNDINSF 256
            A  F++LL +++ F
Sbjct: 242 GARTFVRLLEEVDRF 256


>gi|150397964|ref|YP_001328431.1| creatininase [Sinorhizobium medicae WSM419]
 gi|150029479|gb|ABR61596.1| Creatininase [Sinorhizobium medicae WSM419]
          Length = 263

 Score =  241 bits (616), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 151/260 (58%), Positives = 187/260 (71%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           P   + DNS  L A  R DWI VLPLGAYEQHGPHLP  TD +IA G+ ER+ + +P  L
Sbjct: 4   PKPRWNDNSDALAAAERHDWIAVLPLGAYEQHGPHLPFETDRLIAGGIVERVIAAMPRTL 63

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P T +PVEP+GYS+EHM+V GT+TL Y EA+E WL I + +   GIRK V+LNAHGGNSP
Sbjct: 64  PATFLPVEPVGYSVEHMHVPGTRTLAYDEAVERWLGIAEDLAGRGIRKFVMLNAHGGNSP 123

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           L+++V+TEAR RF ML V+TSW+RF  P G I   +  I IHGG+IETS+MLAL P  V 
Sbjct: 124 LMTVVATEARRRFRMLAVATSWTRFGQPDGWIGAKDRTIDIHGGDIETSVMLALHPDKVD 183

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           M  A +F SRQSEF R+FK+LRA+G H+FGW M DLNP GV GNA  AT ++GE LL + 
Sbjct: 184 MMQARDFPSRQSEFARSFKHLRAYGPHAFGWRMSDLNPDGVAGNAAAATAERGEALLGHV 243

Query: 243 ANCFIQLLNDINSFDVSIFD 262
           A   I+LL D+N+FD+   D
Sbjct: 244 AKSIIELLEDVNAFDIGELD 263


>gi|254561323|ref|YP_003068418.1| creatininase [Methylobacterium extorquens DM4]
 gi|254268601|emb|CAX24560.1| creatininase (creatine amidohydrolase) [Methylobacterium extorquens
           DM4]
          Length = 258

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 104/257 (40%), Positives = 149/257 (57%), Gaps = 1/257 (0%)

Query: 3   PLIIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   + D +            I VLP+ A EQHGPHLP+ TDT+IA G   R+   +P  
Sbjct: 2   PARSWLDLTTAEIRGRDMSRTIAVLPVAAVEQHGPHLPLGTDTLIAEGYLARVAPQVPEA 61

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           L V  +PV+ +G S EH    GT TLT   A+  W  I  ++ + G  K+VI+++HGGNS
Sbjct: 62  LDVLLLPVQSVGKSDEHDSFPGTLTLTATTALAAWTEIGASLHRAGCTKLVIVSSHGGNS 121

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            L+ +V+ E R R  M+ V+TSWSR  +P+G+    E   GIH G IET++MLAL P LV
Sbjct: 122 ALIDLVAGELRGRLGMVAVTTSWSRLGLPEGLFPAGEIRHGIHAGGIETALMLALRPDLV 181

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D  E+F  R     R+F  LRA    +F W  +DL+P G +G+A   T + GE  L+Y
Sbjct: 182 RRDHIEDFEPRTVAMERDFALLRAGRPAAFAWKTEDLHPSGALGDARLGTAEAGEAALAY 241

Query: 242 FANCFIQLLNDINSFDV 258
            A+ F++LL +++ F +
Sbjct: 242 GAHAFVRLLEEVDRFSL 258


>gi|91790093|ref|YP_551045.1| creatininase [Polaromonas sp. JS666]
 gi|91699318|gb|ABE46147.1| Creatininase [Polaromonas sp. JS666]
          Length = 282

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 99/267 (37%), Positives = 132/267 (49%), Gaps = 8/267 (2%)

Query: 3   PLIIFTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
               ++D   P  A   K   I VLP+ A EQHGPHLP+N D  +  G+       LP  
Sbjct: 10  STRFWSDLKSPDFARLDKTRCIAVLPVAAIEQHGPHLPLNVDATLVEGVIAAALPQLPAD 69

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LPV  +P + +G+S EH    GT TL     I+ W AI +++   G++K+V+LN+HGG  
Sbjct: 70  LPVLFLPTQSVGFSPEHTRFAGTLTLKAETIIQLWTAIAESVAATGVQKLVLLNSHGGQV 129

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQ-------GIISFPETEIGIHGGEIETSMML 174
            L+ +V+ + R R  MLV S +W    +          + S  E   GIH GE+ETSMML
Sbjct: 130 GLLDVVARDLRARLGMLVYSVNWFSLPLVDEQGASVSDLFSAQEHRFGIHAGEMETSMML 189

Query: 175 ALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKK 234
           AL P  V M  A++F S   +    F  L    S    W M+D NP+G VGNA  AT  K
Sbjct: 190 ALKPEQVDMAKAQDFHSTSQDRAEKFSILGDGRSAKLAWQMQDYNPQGAVGNAAAATADK 249

Query: 235 GEGLLSYFANCFIQLLNDINSFDVSIF 261
           G  LL        QLL +I        
Sbjct: 250 GRALLGAAGRSLAQLLEEIGQLPADTL 276


>gi|81300401|ref|YP_400609.1| creatinine amidohydrolase [Synechococcus elongatus PCC 7942]
 gi|2570206|gb|AAB82046.1| ORF271 [Synechococcus elongatus PCC 7942]
 gi|22002497|gb|AAM82649.1| creatininase [Synechococcus elongatus PCC 7942]
 gi|81169282|gb|ABB57622.1| creatinine amidohydrolase [Synechococcus elongatus PCC 7942]
          Length = 271

 Score =  239 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 72/265 (27%), Positives = 113/265 (42%), Gaps = 7/265 (2%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVL--PLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +     F     P  A       V++  P+GA EQHGPHLP+  DT IA  +       L
Sbjct: 6   IPAERFFPYLRWPEIAALPDRDRVLIIQPIGAIEQHGPHLPLVVDTAIATAVTGEALRRL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +    +P    G S EH    GT +L     +   +    ++   G R+++ LN HG
Sbjct: 66  PAEIAAYALPTLCYGKSNEHCQFPGTISLRTETLLAVLIDSAHSLYAAGFRRLIWLNGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ + + + R +F    V     W+       +++  E  +G+H G+ ETS+ML L
Sbjct: 126 GQPQVLQLAARDLREQFPGFEVLPLFVWNVPNQIGELLTPREQTLGLHAGDAETSLMLHL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  V+MD A    +     L     L   G+    W   DL+  GV+G+   AT  KG 
Sbjct: 186 LPDQVRMDQA---IAEYPPDLDAEGLLSWEGNLPIAWLTHDLSQSGVIGDPTPATAAKGA 242

Query: 237 GLLSYFANCFIQLLNDINSFDVSIF 261
            +       ++Q+L  I  +  S  
Sbjct: 243 EIFEQLVQGWVQVLTVIAHWQRSSL 267


>gi|15966622|ref|NP_386975.1| hypothetical protein SMc02977 [Sinorhizobium meliloti 1021]
 gi|307300343|ref|ZP_07580123.1| Creatininase [Sinorhizobium meliloti BL225C]
 gi|307319626|ref|ZP_07599052.1| Creatininase [Sinorhizobium meliloti AK83]
 gi|15075894|emb|CAC47448.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306894748|gb|EFN25508.1| Creatininase [Sinorhizobium meliloti AK83]
 gi|306904509|gb|EFN35093.1| Creatininase [Sinorhizobium meliloti BL225C]
          Length = 263

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 153/260 (58%), Positives = 190/260 (73%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           P   +TDNS  L    R+DWI VLPLGA+EQHGPHLP  TD +IAAG+ ER+ + LP  L
Sbjct: 4   PKPRWTDNSAALEPVERRDWIAVLPLGAHEQHGPHLPFETDRLIAAGIVERVIAALPQAL 63

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           PVT +PVEP+GYSIEHM V GT+TL Y EAIE WL I +++  +G+RK V+LNAHGGNSP
Sbjct: 64  PVTFLPVEPVGYSIEHMDVSGTRTLAYDEAIERWLGIAESLAGLGVRKFVMLNAHGGNSP 123

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           L++IV+TEAR+RF ML V+TSW+RF  P G IS  +  + IHGG+IETS+MLAL P  V 
Sbjct: 124 LMTIVATEARIRFRMLAVATSWTRFGQPDGWISAKDKAVDIHGGDIETSVMLALHPDKVD 183

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           M  A  F SRQ EF  +FK+LRA+G H+FGW M DLNP GV GNA  AT ++GE LL++ 
Sbjct: 184 MAKARAFPSRQGEFALSFKHLRAYGPHAFGWKMSDLNPDGVAGNAAAATAERGEALLAHA 243

Query: 243 ANCFIQLLNDINSFDVSIFD 262
           A   I+LL D+N+FD    D
Sbjct: 244 AKGIIELLEDVNAFDAGELD 263


>gi|90418743|ref|ZP_01226654.1| putative creatinine amidohydrolase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336823|gb|EAS50528.1| putative creatinine amidohydrolase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 282

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 95/261 (36%), Positives = 145/261 (55%), Gaps = 3/261 (1%)

Query: 4   LIIFTDNSLPLC---ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              + + +         +  D + V+P+ A EQHGPHLP+ TD I+A  + + + + LP 
Sbjct: 21  RRRYEEMTTTEMSAEGASLADAVAVVPIAAIEQHGPHLPLGTDAILADAMVDAVIARLPE 80

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             PVT +P   IG S EH    GT +  +  A    + +  ++   G R++VI+NAHGGN
Sbjct: 81  DRPVTFLPTLRIGKSCEHAAFPGTLSHEWQTATSALIEVGASLAAAGFRRLVIVNAHGGN 140

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           +P++   + E R R  +LV + SW RF  P G++   E   GIHGG +ET++ML L P +
Sbjct: 141 TPVMDTAALELRRRHGLLVATCSWLRFGYPDGLLPPEEIASGIHGGAVETALMLHLRPDM 200

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+ +    F S Q E   +  +LRAHG   FGW  +DLNP GVVG+A  AT + G  + +
Sbjct: 201 VRREAIAAFDSLQDELGGSAAHLRAHGRIGFGWMAQDLNPAGVVGDARLATAEIGAAIAA 260

Query: 241 YFANCFIQLLNDINSFDVSIF 261
           + A+ F   L+D+ +FD +  
Sbjct: 261 HQADAFTAFLDDVLAFDPARL 281


>gi|121603309|ref|YP_980638.1| creatininase [Polaromonas naphthalenivorans CJ2]
 gi|120592278|gb|ABM35717.1| Creatininase [Polaromonas naphthalenivorans CJ2]
          Length = 289

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 98/267 (36%), Positives = 130/267 (48%), Gaps = 8/267 (2%)

Query: 5   IIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
             + D   P  A       I VLP+ A EQHGPHLP+N D  +  G+       LP  LP
Sbjct: 19  RFWADLKSPDFARLELDRCIAVLPVAAIEQHGPHLPLNVDATLVDGVIASALPHLPASLP 78

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V  +P + IG+S EH    GT TL     +  W  + +++   G++K+V+LN+HGG   L
Sbjct: 79  VLFLPTQSIGFSPEHTRFAGTLTLKAETILRLWTELAESVASTGVKKLVLLNSHGGQVGL 138

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQG-------IISFPETEIGIHGGEIETSMMLAL 176
           + +V+ + R R  MLV S +     +            S  E   GIH GEIETSMMLAL
Sbjct: 139 MDVVARDLRTRLGMLVYSVNSFNLPLVDERGDSVAARFSAHEHRFGIHAGEIETSMMLAL 198

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  V M  A++F S   +    F  L    S   GW M+D NP G VGNA+ AT +KG 
Sbjct: 199 RPGQVDMAKAQDFHSTSQDRSERFGILGDGRSAKLGWQMQDYNPHGAVGNALAATAEKGH 258

Query: 237 GLLSYFANCFIQLLNDINSFDVSIFDK 263
            LLS       QLL +I+         
Sbjct: 259 ALLSAMGRSLAQLLAEIDQLPPDTLRD 285


>gi|310814586|ref|YP_003962550.1| Creatininase [Ketogulonicigenium vulgare Y25]
 gi|308753321|gb|ADO41250.1| Creatininase [Ketogulonicigenium vulgare Y25]
          Length = 263

 Score =  238 bits (608), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 101/259 (38%), Positives = 145/259 (55%), Gaps = 1/259 (0%)

Query: 1   MNPLIIFTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M   I + D S            I +LP+ A EQHGPHLP+ TD II  G  E +    P
Sbjct: 1   MTRKIWWNDFSASDFDAIDPMKTIAILPIAAVEQHGPHLPVGTDVIINTGHLEMLAKAAP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L +  +PV+P+G S EH++  GT +      I+ W+ I   + + GIRK+VI+N+HGG
Sbjct: 61  ADLDIRILPVQPVGKSNEHIWAKGTVSHEAKTLIDSWVEIGLHVARTGIRKLVIVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  ++ IV  E R+R  + VV TSWSRF  P G+IS  E   GIHGGE+ET+++L   P 
Sbjct: 121 NEEIMGIVGRELRVRCGLFVVKTSWSRFGAPAGLISDTEARQGIHGGEVETALVLHFRPE 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV M  A NF+S  +    ++ YLR  G+H++ W   D++P G +GNA   T +KG  + 
Sbjct: 181 LVDMAKAGNFTSVAAAEEVDYTYLRPTGTHAWSWIASDVHPSGAIGNATLGTAEKGAAIA 240

Query: 240 SYFANCFIQLLNDINSFDV 258
               + F+ LL ++    V
Sbjct: 241 QNHVDRFLDLLAEVLRHPV 259


>gi|227823444|ref|YP_002827417.1| creatinine amidohydrolase [Sinorhizobium fredii NGR234]
 gi|227342446|gb|ACP26664.1| creatinine amidohydrolase [Sinorhizobium fredii NGR234]
          Length = 263

 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 148/260 (56%), Positives = 181/260 (69%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           P   +  N   L    R+DWI VLPLGA+EQHGPHLP  TD +IA G+ +R+ + LP  L
Sbjct: 4   PKPRWGLNPADLAPAERRDWIAVLPLGAHEQHGPHLPFETDRLIAEGIVDRVIARLPHDL 63

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P T +P EPIGYSIEHM V GT+TL Y EAI  WL I + + ++GIRK V+LNAHGGNS 
Sbjct: 64  PATFLPAEPIGYSIEHMDVAGTRTLAYDEAIARWLGIAENLSRLGIRKFVMLNAHGGNSA 123

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           L++IV+TEARMRF ML V+TSW+RF  P G IS  +  I IHGG+IE S+MLAL P  V 
Sbjct: 124 LMTIVATEARMRFGMLAVATSWTRFGQPGGWISAEDKAIDIHGGDIEASVMLALHPDKVD 183

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           M  A  F SRQSEF R F++LRA+G H+FGW M DLNP G VGNA  AT ++GE LL + 
Sbjct: 184 MAKARQFPSRQSEFQRRFEHLRAYGPHAFGWKMSDLNPDGAVGNAAAATAERGEALLGHA 243

Query: 243 ANCFIQLLNDINSFDVSIFD 262
           A   I+LL D+ +FDV  F 
Sbjct: 244 AGGIIELLQDVQAFDVGEFG 263


>gi|56750058|ref|YP_170759.1| creatinine amidohydrolase [Synechococcus elongatus PCC 6301]
 gi|56685017|dbj|BAD78239.1| creatinine amidohydrolase [Synechococcus elongatus PCC 6301]
          Length = 271

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 72/265 (27%), Positives = 113/265 (42%), Gaps = 7/265 (2%)

Query: 1   MNPLIIFTDNSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +     F   S P  A        +++ P+GA EQHGPHLP+  DT IA  +       L
Sbjct: 6   IPAERFFPYLSWPEIAALPDPDRVLIIQPIGAIEQHGPHLPLVVDTAIATAVTGEALRRL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +    +P    G S EH    GT  L     +   +    ++   G R+++ LN HG
Sbjct: 66  PAEIAAYALPTLCYGKSNEHCQFPGTIRLRTETLLAVLIDSAHSLYAAGFRRLIWLNGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ + + + R +F    V     W+       +++  E  +G+H G+ ETS+ML L
Sbjct: 126 GQPQVLQLAARDLREQFPGFEVLPLFVWNVPNQIGELLTPREQTLGLHAGDAETSLMLHL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  V+MD A    +     L     L   G+    W   DL+  GV+G+   AT  KG 
Sbjct: 186 LPDQVRMDQA---IAEYPPDLDAEGLLSWEGNLPIAWLTHDLSQSGVIGDPTPATAAKGA 242

Query: 237 GLLSYFANCFIQLLNDINSFDVSIF 261
            +       ++Q+L  I  +  S  
Sbjct: 243 EIFEQLVQGWVQVLTVIAHWQRSSL 267


>gi|163760221|ref|ZP_02167304.1| hypothetical protein HPDFL43_08164 [Hoeflea phototrophica DFL-43]
 gi|162282620|gb|EDQ32908.1| hypothetical protein HPDFL43_08164 [Hoeflea phototrophica DFL-43]
          Length = 264

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 106/260 (40%), Positives = 156/260 (60%), Gaps = 1/260 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M+  I + D +     D   D  I VLP+ A EQHGPHLP++TD+ I  G+ + + +  P
Sbjct: 1   MSRKIWWGDFTTREFDDIDPDATIAVLPIAAIEQHGPHLPVSTDSAIMQGMLDTVIAQTP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L +  +P++P+G S EH +  GT T+     IEHW+ +  +I + G+RK+VI+N+HGG
Sbjct: 61  ADLDIRILPIQPVGKSNEHQHAPGTLTIPATTLIEHWVELGHSIARAGVRKLVIVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  ++ IV+ E R+R  MLV  TSW RF  P+G+ S  E   GIHGG++ETS+ML   P 
Sbjct: 121 NEEIMGIVARELRVRARMLVAKTSWMRFGFPEGLYSARELAYGIHGGDVETSLMLHFRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV M+ AE+F S  +     F+ LR  G+H+F W   DLNP G VG A  AT  KG+   
Sbjct: 181 LVAMEKAEDFVSAVTRAETEFELLRHAGTHAFAWIASDLNPAGAVGEASKATPGKGQLTA 240

Query: 240 SYFANCFIQLLNDINSFDVS 259
           ++ A  F++L+ D+ +  + 
Sbjct: 241 AHQAEGFVKLMMDVRAAKLD 260


>gi|182678069|ref|YP_001832215.1| creatininase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633952|gb|ACB94726.1| Creatininase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 272

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 102/266 (38%), Positives = 145/266 (54%), Gaps = 1/266 (0%)

Query: 1   MNPLIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   + + +         +D I VLP+ A EQHGPHLP+  DT +      RI + LP
Sbjct: 1   MLPTHFWAEMTWTDFQTNPMQDVIAVLPVAATEQHGPHLPLGVDTFLMEETIARITNRLP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             LPV  +PV+  G S+EH+   GT +++    +  W  +   I + G RK+V+ N+HGG
Sbjct: 61  DDLPVLFLPVQNCGLSVEHLDFPGTLSISPDILLRAWGELGACIHRAGCRKLVLANSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  L+ +++ E R +  + VV  +  RF  P G+ S  E   GIH G+IETS MLAL P 
Sbjct: 121 NVGLLDMLAHELRAKLGLFVVMATLHRFGTPDGLFSEEEKRHGIHAGDIETSQMLALRPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+ +   +FSS      R+F +LR      FGW  +DL+  G +GNA  A+ +KGE  L
Sbjct: 181 LVRREALADFSSASESLERDFTWLRTGRPTGFGWMSQDLSASGAMGNAAAASAEKGEPCL 240

Query: 240 SYFANCFIQLLNDINSFDVSIFDKDV 265
            Y A  FI+LL DI +FD+S      
Sbjct: 241 DYAATAFIELLQDIAAFDLSRLGDPP 266


>gi|310814587|ref|YP_003962551.1| Creatininase [Ketogulonicigenium vulgare Y25]
 gi|308753322|gb|ADO41251.1| Creatininase [Ketogulonicigenium vulgare Y25]
          Length = 268

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 97/259 (37%), Positives = 145/259 (55%), Gaps = 4/259 (1%)

Query: 6   IFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
            + + S    A       + +LP+   EQHGPHLP+  D++I AG+  R+ + + P LPV
Sbjct: 4   YWWNLSTAEFAGRDMSQAVAILPIATVEQHGPHLPVGVDSMINAGIIARVMAQIDPALPV 63

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P+ P+G S EH+   GT TL++    + W  + + +R+ G RKI++ N+HGG   L 
Sbjct: 64  FTLPMIPVGKSTEHLSYPGTLTLSWELVAKIWFEMGECVRRTGCRKIILFNSHGGQVALS 123

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
            IV+ + R +  ML V+ +W R T  +GI S  E   G HGGEIETSMMLAL P LV M 
Sbjct: 124 EIVARDLRAKLGMLAVAATWFRITPVEGIFSAYEDLHGYHGGEIETSMMLALHPELVDMT 183

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
            AE+F       +   + LR      FGW  +DL+P GV GNA  +   +GE L+   A+
Sbjct: 184 KAEDFRQLSQVMVDEAEILRPG---LFGWMAEDLHPAGVSGNAAASDAARGEALVQRAAD 240

Query: 245 CFIQLLNDINSFDVSIFDK 263
             +QL+++  +F +S   +
Sbjct: 241 RLVQLIHETAAFPLSRLSQ 259


>gi|111223656|ref|YP_714450.1| putative creatinine amidohydrolase [Frankia alni ACN14a]
 gi|111151188|emb|CAJ62899.1| Putative creatinine amidohydrolase (creatininase) [Frankia alni
           ACN14a]
          Length = 257

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 79/254 (31%), Positives = 115/254 (45%), Gaps = 3/254 (1%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
              F D   P  A    D + VLP+G+ EQHGPHLP++TD ++A  LA            
Sbjct: 2   SRHFADLRAPEAAGLSPDAVAVLPVGSIEQHGPHLPLSTDLVVAESLARDAVDAFGDACD 61

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +  +P      S EH +  GT  L+    +     +   +    +R++V LN HGGNS L
Sbjct: 62  LWLLPALAYSKSNEHAWSPGTMWLSATTLLAVLDDLARCLATTPVRRLVFLNGHGGNSAL 121

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           + + S + R+   +       S      G     E  +GIH G  ETS++L L P LV++
Sbjct: 122 LQVASRDVRLAHGLRTFVMHPSLPADHGGTSPAAELGMGIHAGIDETSLLLHLRPDLVRL 181

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           DL         E L +F  +R  G+ SFGW   D    G +G+   AT ++G+ L     
Sbjct: 182 DL---GVRSVPEQLASFDRVRFGGAVSFGWLSDDFGTDGTIGDPTGATAERGKRLYEAMV 238

Query: 244 NCFIQLLNDINSFD 257
               Q L +I  FD
Sbjct: 239 VAAGQSLAEIARFD 252


>gi|332717166|ref|YP_004444632.1| creatinine amidohydrolase [Agrobacterium sp. H13-3]
 gi|325063851|gb|ADY67541.1| creatinine amidohydrolase [Agrobacterium sp. H13-3]
          Length = 266

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 137/241 (56%), Positives = 181/241 (75%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
             I VLPLGA+EQHGPHLP  TDT+IAAG+  R+ ++LP  LPV+ +PVEP+GYSIEHM 
Sbjct: 22  GAISVLPLGAHEQHGPHLPFETDTLIAAGIVSRLAAVLPAGLPVSFLPVEPVGYSIEHMN 81

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           V GTK+L Y EA+E WL I  A  + G+RK V+LNAHGGNSPL++IV+TEAR RF ML V
Sbjct: 82  VPGTKSLRYDEAVERWLGIAKAEYEKGVRKFVMLNAHGGNSPLMTIVATEARARFGMLAV 141

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           +TSW+RF +P  I+   +  I IHGG+IETS+MLAL P  V M+   NF SRQS+F   F
Sbjct: 142 ATSWTRFGVPADIVKPEDKAIDIHGGDIETSVMLALCPERVAMEKTANFPSRQSDFASRF 201

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
           ++LRA+G H+FGW M DLNP GV GNA  A+ +KGE ++S+  +  ++LL D+++FD+++
Sbjct: 202 RHLRAYGPHAFGWLMSDLNPDGVAGNAAAASAEKGERIISHAVSGLVELLEDVHAFDITL 261

Query: 261 F 261
           F
Sbjct: 262 F 262


>gi|209550959|ref|YP_002282876.1| creatininase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209536715|gb|ACI56650.1| Creatininase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 262

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 144/261 (55%), Positives = 189/261 (72%), Gaps = 1/261 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P   F D S  + A   +  I VLPLGA+EQHGPHLP  TDT+IA G+A R+K+ L  
Sbjct: 2   MTPSPRFDD-SDAVSAHGGRRPIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKAALSA 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            L VT +P E +GYSIEHM V+ TKTL + EA++ WL I + + +  IRK+V+LNAHGGN
Sbjct: 61  GLRVTFLPAESVGYSIEHMDVEETKTLAFDEAVDRWLGIAERLAEQDIRKLVMLNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPL++IV+TEAR+RF+ML V+TSW+RF +P G+I   E  IGIHGG+IETS+MLAL P  
Sbjct: 121 SPLMTIVATEARIRFAMLAVATSWTRFGLPDGVIPPEEKAIGIHGGDIETSVMLALHPDK 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M  A +FSSRQSEF   FK+LRA+G H+FGW M DLNP+G  GNA  AT +KGE L++
Sbjct: 181 VDMAKAADFSSRQSEFAGRFKHLRAYGPHAFGWKMSDLNPQGAAGNAAAATAEKGEALIA 240

Query: 241 YFANCFIQLLNDINSFDVSIF 261
           +     ++LL D+++FD++ F
Sbjct: 241 HAVKGLVELLEDVDAFDITQF 261


>gi|327189537|gb|EGE56690.1| putative creatininase protein [Rhizobium etli CNPAF512]
          Length = 259

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 146/261 (55%), Positives = 187/261 (71%), Gaps = 4/261 (1%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P       S P    A +  I VLPLGA+EQHGPHLP  TDT+IA G+A R+K+ LP 
Sbjct: 2   MTPSPD----SNPASVPAPRPPIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKAALPA 57

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPVT +P E +GYSIEHM V+GTKTL + EA+  WL I + + +  IRK+V+LNAHGGN
Sbjct: 58  GLPVTFLPAESVGYSIEHMDVEGTKTLAFDEAVNRWLGIAERLAEQNIRKLVMLNAHGGN 117

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPL++IV+TEAR+RF+ML V+TSW+RF +P G+I   E  IGIHGG+IETS+MLAL P  
Sbjct: 118 SPLMTIVATEARIRFAMLAVATSWTRFGLPDGVIRPEEKAIGIHGGDIETSVMLALHPDK 177

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M  A +F SRQSEF   FK+LRA+G H+FGW M DLNP+GV GNA  AT +KGE L++
Sbjct: 178 VDMAKAADFPSRQSEFAERFKHLRAYGQHAFGWKMSDLNPQGVAGNAAAATAEKGEALMA 237

Query: 241 YFANCFIQLLNDINSFDVSIF 261
           +     ++LL D+++FDV   
Sbjct: 238 HAVKGLVELLGDVDAFDVGEL 258


>gi|163851139|ref|YP_001639182.1| creatininase [Methylobacterium extorquens PA1]
 gi|163662744|gb|ABY30111.1| Creatininase [Methylobacterium extorquens PA1]
          Length = 273

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 93/262 (35%), Positives = 136/262 (51%), Gaps = 1/262 (0%)

Query: 2   NPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
                + D +    +       + +LP+ A EQHGPHLP+  D  I AG+  R  +++P 
Sbjct: 4   PASRWWWDLTTEDFSRLDWGPLVAILPVAAVEQHGPHLPVRVDAAINAGILARAVALMPD 63

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            L    +P+ PIG S EH    GT +L++      W+   +++ + G R+++ILN+HGG 
Sbjct: 64  DLSALVLPMLPIGKSNEHHAFPGTLSLSHETLARLWIETAESVHRAGCRRLLILNSHGGQ 123

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
             L+ IV+ E R+R  ML V   W   T    + S  E   GIHGGEIETS MLAL P L
Sbjct: 124 PQLMEIVTRELRVRLGMLAVGCGWGGVTPMDDLFSEAERRHGIHGGEIETSAMLALHPDL 183

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+M+ A++F     E  R    L   G   FGW  +DL+P GV GNA  A  ++G  L+ 
Sbjct: 184 VRMERADDFVPLSVEMERAGSLLTPEGQVGFGWMAQDLHPSGVSGNAAAADARRGAELVE 243

Query: 241 YFANCFIQLLNDINSFDVSIFD 262
             A   ++L+ +I  F +    
Sbjct: 244 RAAAGVVRLVREIADFPLERLG 265


>gi|218673256|ref|ZP_03522925.1| creatinine amidohydrolase (creatininase) protein [Rhizobium etli
           GR56]
          Length = 262

 Score =  232 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 147/261 (56%), Positives = 190/261 (72%), Gaps = 1/261 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P   F + S P    A +  I VLPLGA+EQHGPHLP  TDT+IA G+A+R+K+ LP 
Sbjct: 2   MTPSPRFDE-SRPASTPAPRRPIAVLPLGAHEQHGPHLPFETDTLIAEGIAQRLKAALPA 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPVT +P E +GYSIEHM V+GTKTL + EA+  WL I + + K G RK+V+LNAHGGN
Sbjct: 61  GLPVTFLPAESVGYSIEHMDVEGTKTLAFDEAVHRWLGIAEGLAKQGTRKLVMLNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPL++IV+TEAR+RF+ML V+TSW+RF +P G+I   E  IGIHGG+IETS+MLAL P  
Sbjct: 121 SPLMTIVATEARVRFAMLAVATSWTRFGLPDGVIPRGEKAIGIHGGDIETSVMLALHPDR 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M  A +F SRQ+EF   FK+LRA+G H+FGW M DLN +GV GNA  AT +KGE L++
Sbjct: 181 VDMAKAADFPSRQTEFAERFKHLRAYGPHAFGWKMSDLNAEGVAGNAAAATAEKGEALIA 240

Query: 241 YFANCFIQLLNDINSFDVSIF 261
           +     ++LL D+++FDV  F
Sbjct: 241 HAVRGLVELLEDVDAFDVGEF 261


>gi|254560834|ref|YP_003067929.1| creatininase [Methylobacterium extorquens DM4]
 gi|254268112|emb|CAX23988.1| putative creatininase (creatine amidohydrolase) [Methylobacterium
           extorquens DM4]
          Length = 273

 Score =  232 bits (591), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 93/262 (35%), Positives = 137/262 (52%), Gaps = 1/262 (0%)

Query: 2   NPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
                + D +    +       + +LP+ A EQHGPHLP+  D  I AG+  R  +++P 
Sbjct: 4   PASRWWWDLTTEDFSRLDWGPLVAILPVAAVEQHGPHLPVRVDAAINAGILARAVALMPD 63

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LP   +P+ PIG S EH    GT +L++      W+   +++ + G R+++ILN+HGG 
Sbjct: 64  DLPALVLPMLPIGKSNEHHAFPGTLSLSHETLARLWIETAESVHRAGCRRLLILNSHGGQ 123

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
             ++ IV+ E R+R  ML V   W   T    + S  E   GIHGGEIETS MLAL P L
Sbjct: 124 PQVMEIVTRELRVRLGMLAVGCGWGGVTPVDDLFSQAERRHGIHGGEIETSAMLALHPDL 183

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+M+ A++F     E  R    L   G   FGW  +DL+P GV GNA  A  ++G  L+ 
Sbjct: 184 VRMERADDFVPLSVEMERAGGLLTPEGRVGFGWMAQDLHPSGVSGNAAAADARRGAELVE 243

Query: 241 YFANCFIQLLNDINSFDVSIFD 262
             A   ++L+ +I  F +    
Sbjct: 244 RAAAGVVRLVREIADFPLERLG 265


>gi|319409084|emb|CBI82729.1| creatinine amidohydrolase [Bartonella schoenbuchensis R1]
          Length = 247

 Score =  232 bits (591), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 123/240 (51%), Positives = 167/240 (69%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
            + +LPLGA+E HG HLP  TD IIA   A+ +   +  +  +  +PVE IGYSIEHM V
Sbjct: 7   SLALLPLGAHEYHGNHLPFETDWIIAEAFAKALILQIKGQFHIKLLPVEKIGYSIEHMDV 66

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT+TLT+++AIE W+ I +   + GI++ + LNAHGGNSPL+SIV TE R RFSML V+
Sbjct: 67  PGTQTLTFSDAIERWINIGERCHRKGIKRFLFLNAHGGNSPLISIVITELRKRFSMLAVA 126

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSW+RF +P+G+I   E  + IHGG IETS+ML LAP  V+M+ AENF ++Q++ + N++
Sbjct: 127 TSWNRFGLPEGLIEPSEHHLDIHGGFIETSLMLYLAPEKVQMEQAENFYNKQADMIANYQ 186

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           YLRA+G H+FGW+M+DLNP+G  GNA  AT K G  + S+       LL DIN F +S  
Sbjct: 187 YLRAYGPHAFGWTMRDLNPRGAAGNASKATSKAGAAIFSHVLCGLRDLLYDINQFKISTL 246


>gi|319406030|emb|CBI79660.1| creatinine amidohydrolase [Bartonella sp. AR 15-3]
          Length = 246

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 120/240 (50%), Positives = 162/240 (67%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
            + +LPLGA+E HG HLP  TD IIA   A+ +      +  +T +PVE IGYS+EHM V
Sbjct: 7   TLALLPLGAHEYHGNHLPFETDWIIAESFAKALTLATKEQFQITLLPVEKIGYSVEHMDV 66

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT+TLT+++AI+ W+ I +     GIR+ +ILNAHGGN PL++IV TE R RF+ML V+
Sbjct: 67  IGTQTLTFSKAIKRWIHIGENCYHKGIRRFLILNAHGGNGPLMNIVITELRRRFAMLAVA 126

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSWSRF +P+G++   +  + IHGG IETS+ML LAP  V M+  ENF ++Q+E ++N++
Sbjct: 127 TSWSRFGLPEGLMEPSQAHLDIHGGFIETSLMLYLAPEKVHMEKTENFYNKQAEMIQNYR 186

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           YLRA+G HSFGW M DLN KG  GNA  AT + GE + S+       LLNDI  F +   
Sbjct: 187 YLRAYGPHSFGWMMHDLNEKGAAGNASQATAQAGEAIFSHVLRELRALLNDIKKFKIDSL 246


>gi|296446248|ref|ZP_06888195.1| Creatininase [Methylosinus trichosporium OB3b]
 gi|296256285|gb|EFH03365.1| Creatininase [Methylosinus trichosporium OB3b]
          Length = 264

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 150/262 (57%), Gaps = 1/262 (0%)

Query: 1   MNPLIIFTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P   +TD +     D  +   I VLPL A EQHGPHLP+  D+ I  G+ ER+   LP
Sbjct: 1   MLPSRYWTDLTTVDFRDLDRSRVIAVLPLAAVEQHGPHLPVGVDSAIMQGMIERVVERLP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L V  +P + IG SIEH    GT TL++  A+     I + + + G RK+V+LN+HGG
Sbjct: 61  EDLDVLFLPQQAIGVSIEHGDFPGTLTLSHETALRLVTEIGEGVARAGCRKLVLLNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N+PL+S  + E R R  ML V+ SW RF  P G+    E  +G+HGGEIETS+MLALAP 
Sbjct: 121 NTPLLSQAALELRARRGMLAVACSWHRFGYPDGLFPEDEIRLGVHGGEIETSLMLALAPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            V    A  F S    F R F +LRA     FGW  +DL+  G +G+A  A+  KGE   
Sbjct: 181 FVDTARAARFGSESEAFEREFTWLRADKPIGFGWMTQDLSRDGALGDAAAASAAKGEAAA 240

Query: 240 SYFANCFIQLLNDINSFDVSIF 261
            Y+A  F++LL D+ +FD+   
Sbjct: 241 DYWATAFVELLRDVEAFDLERL 262


>gi|312198439|ref|YP_004018500.1| creatininase [Frankia sp. EuI1c]
 gi|311229775|gb|ADP82630.1| Creatininase [Frankia sp. EuI1c]
          Length = 257

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 75/254 (29%), Positives = 115/254 (45%), Gaps = 3/254 (1%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
             IF D   P  AD     I VLP+G+ EQHGPHLP++TD ++A  L   + +     + 
Sbjct: 2   TRIFADLRAPEIADLSPGAIAVLPVGSVEQHGPHLPLSTDLVVADTLGRDVVATYGDEID 61

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +  +P      S EH +  GT  L+    +     +   +    I+++V LN HGGNS L
Sbjct: 62  LLLLPTLAYSKSNEHAWSAGTMWLSATTMLAMLDDLGRCLATTPIQRLVFLNGHGGNSAL 121

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           + + S + R+   +       S      G     E  +GIH G  ETS+M+ L P LV++
Sbjct: 122 LQVASRDLRLAHGLRTFVMHPSVPPDQGGTSPATELGMGIHAGIEETSVMMHLRPELVRL 181

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           +L    +    E L +++ +    S SFGW   D    G +G+   AT + G+       
Sbjct: 182 EL---GTRSVPEHLASYERVGFGRSVSFGWLSDDFGTDGTIGDPTGATAEHGKQRYEAMV 238

Query: 244 NCFIQLLNDINSFD 257
                 L +I  FD
Sbjct: 239 ETAAASLREIARFD 252


>gi|190893466|ref|YP_001980008.1| creatininase [Rhizobium etli CIAT 652]
 gi|190698745|gb|ACE92830.1| putative creatininase protein [Rhizobium etli CIAT 652]
          Length = 259

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 140/237 (59%), Positives = 180/237 (75%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           VLPLGA+EQHGPHLP  TDT+IA G+A R+K+ LP  LPVT +P E +GYSIEHM V+GT
Sbjct: 22  VLPLGAHEQHGPHLPFETDTLIAEGIAGRLKAALPAGLPVTFLPAESVGYSIEHMDVEGT 81

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSW 144
           KTL + EA+  WL I + + +  IRK+V+LNAHGGNSPL++IV+TEAR+RF+ML V+TSW
Sbjct: 82  KTLAFDEAVNRWLGIAERLAEQNIRKLVMLNAHGGNSPLMTIVATEARIRFAMLAVATSW 141

Query: 145 SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLR 204
           +RF +P G+I   E  IGIHGG+IETS+MLAL P  V M  A +F SRQSEF   FK+LR
Sbjct: 142 TRFGLPDGVIRPEEKAIGIHGGDIETSVMLALHPDKVDMAKAADFPSRQSEFAERFKHLR 201

Query: 205 AHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           A+G H+FGW M DLNP+GV GNA  AT +KGE L+++     ++LL D+++FDV   
Sbjct: 202 AYGPHAFGWKMSDLNPQGVAGNAAAATAEKGEALMAHAVKGLVELLGDVDAFDVGEL 258


>gi|90655538|gb|ABD96377.1| creatininase [uncultured marine type-A Synechococcus GOM 3O12]
          Length = 276

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 74/268 (27%), Positives = 121/268 (45%), Gaps = 4/268 (1%)

Query: 4   LIIFTDNSLPLCADAR--KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
              +   + P        +   ++ P GA EQHGPHLP+ TD + A  + E + + L P+
Sbjct: 5   QRRYEQLAWPEIQRLANGEGSTLIWPFGACEQHGPHLPLVTDALFAERITEAVVADLNPQ 64

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LP+  +P + IG+S EH    GT +L+    I   + + + +  MG R++V+ NAHGG  
Sbjct: 65  LPIWSLPTQVIGFSPEHRSFPGTLSLSSDLLIAVVVQLGEQLAAMGWRRLVLFNAHGGQI 124

Query: 122 PLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
            L+ + + E R R   + V     WS       ++   E E G+H G  ETS+ML  AP 
Sbjct: 125 ALLQVAARELRQRCPAMAVLPCFLWSGVEGLADLLPAHELENGLHAGMAETSLMLHQAPE 184

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV      +                  G+  F W M+DL+  GV+G++  A+   G+ L 
Sbjct: 185 LVGEQRPVDGLPGLEGRPCPPSGWSLEGAAPFAWLMQDLSHSGVIGDSSAASADLGKLLE 244

Query: 240 SYFANCFIQLLNDINSFDVSIFDKDVQK 267
            +    + + L  +   D     +   +
Sbjct: 245 QHLVVHWTKRLRALLVSDWPGPGEAADR 272


>gi|302337723|ref|YP_003802929.1| creatininase [Spirochaeta smaragdinae DSM 11293]
 gi|301634908|gb|ADK80335.1| Creatininase [Spirochaeta smaragdinae DSM 11293]
          Length = 257

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 73/258 (28%), Positives = 126/258 (48%), Gaps = 8/258 (3%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL-PPR 61
             + F   +           I + P+G+ EQHG HLP+ TD++IA  +++ +K I+    
Sbjct: 2   DKLTFQHKTYKEIEKEASSLIAIQPIGSTEQHGSHLPVGTDSLIAEAISKGLKEIMRTAN 61

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
            P   +P+ P G S EH    GT  +     I     I  ++++ G RK+V LN HGGN 
Sbjct: 62  YPAVFLPLIPYGKSNEHNSFPGTVCMQVETLIRILSDIGASLQRSGFRKLVFLNGHGGNH 121

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQ----GIISFPETEIGIHGGEIETSMMLALA 177
            ++  +  E R++  +           +P+    G  S  E + GIH G +ETS++L + 
Sbjct: 122 EVLDFMCREIRIQTGIKTFVLHPFLKIMPENFDFGEYSESERKFGIHAGRMETSIILYID 181

Query: 178 PHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
           P LV+    +   +   EFL+  +++       FGW  +D++  GV+G+   AT  +GE 
Sbjct: 182 PELVRK---KEIKASIPEFLQQKEFINFSECVPFGWITEDVSENGVIGDPSQATQVEGEK 238

Query: 238 LLSYFANCFIQLLNDINS 255
           LL+  A    +++ +I +
Sbjct: 239 LLTGIAQTLFKVMEEIRA 256


>gi|240851047|ref|YP_002972447.1| creatinine amidohydrolase [Bartonella grahamii as4aup]
 gi|240268170|gb|ACS51758.1| creatinine amidohydrolase [Bartonella grahamii as4aup]
          Length = 247

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 120/238 (50%), Positives = 170/238 (71%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA+E HG HLP  TD IIA   A+ +      +  +  +PVE IGYSIEHM V 
Sbjct: 8   LALLPLGAHEYHGEHLPFETDWIIAEAFAKALTLQTKEQFHIALLPVEKIGYSIEHMDVT 67

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT+TLT+++AIE W++I +   + GI++ ++LNAHGGNSPL+SIV TE R RFSML V+T
Sbjct: 68  GTQTLTFSDAIERWISIGENCYRKGIKRFLLLNAHGGNSPLMSIVITELRRRFSMLAVAT 127

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SWSRF +PQG+++  +  + IHGG IETS+ML LAP  V M+ A NF ++Q++ + N++Y
Sbjct: 128 SWSRFGLPQGLMAPSQQHLDIHGGFIETSLMLYLAPEKVHMEKATNFHNKQADMIANYQY 187

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
           LRA+G H+FGW+M+DLN +G  GNA  AT + GE + S+  +    LL+DIN F+++ 
Sbjct: 188 LRAYGPHAFGWTMRDLNTQGAAGNASKATPQAGEAIFSHVLSQLRDLLDDINRFNINT 245


>gi|114705396|ref|ZP_01438304.1| putative creatine amidohydrolase [Fulvimarina pelagi HTCC2506]
 gi|114540181|gb|EAU43301.1| putative creatine amidohydrolase [Fulvimarina pelagi HTCC2506]
          Length = 267

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 94/260 (36%), Positives = 139/260 (53%), Gaps = 3/260 (1%)

Query: 4   LIIFTDNSLPLCADARKD---WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              F D +    A+AR D    + +LPL A E HGPHLP+ TD I+A  +   +      
Sbjct: 2   QRFFEDWTTEKMAEARADLPGVVPILPLAAMESHGPHLPLGTDAILAREMVYLVDERADD 61

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             P   +PV+  G S EH +  GT  L +    E   AI  ++ + G  K+ ++NAHGGN
Sbjct: 62  DWPGVFLPVQNFGVSTEHTHFAGTIDLGWRTMGETIFAIGRSLERAGFTKMALVNAHGGN 121

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           + ++  +S + R +  +L  + SW RF  P G++   E   GIHGG +ETS+ML   P L
Sbjct: 122 AAMMGQISVDLRAKTGLLAATCSWLRFGFPDGLLPAGEISDGIHGGAVETSLMLHFRPDL 181

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V  +    F SRQ+E     +YL AHG   FGW   DLNP GVVG++  A  + G  +  
Sbjct: 182 VHFERMGVFHSRQAEMREENRYLTAHGRLGFGWMSDDLNPAGVVGDSSLAEPEIGRAIAE 241

Query: 241 YFANCFIQLLNDINSFDVSI 260
           + A+ FI  ++++ +FDV+ 
Sbjct: 242 HQADAFITFIDEVAAFDVAR 261


>gi|319899180|ref|YP_004159273.1| creatinine amidohydrolase [Bartonella clarridgeiae 73]
 gi|319403144|emb|CBI76702.1| creatinine amidohydrolase [Bartonella clarridgeiae 73]
          Length = 247

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 118/240 (49%), Positives = 165/240 (68%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
            + +LPLGA+E HG HLP  TD IIA   A+ +      +  +T +PVE +GYS+EHM V
Sbjct: 7   PLALLPLGAHEYHGNHLPFETDWIIAESFAKALALATKEQFQITLLPVEKVGYSVEHMSV 66

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT+TLT+++AIE W+ I +     GI++ +ILNAHGGN+PL+SIV TE R RFSML V+
Sbjct: 67  IGTQTLTFSKAIERWINIGENCYHKGIKRFLILNAHGGNTPLMSIVITELRRRFSMLAVA 126

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           TSW+RF +P+G++   +  + IHGG IETS+ML LAP  V MD AENF ++Q+E ++N++
Sbjct: 127 TSWNRFDLPEGLMEQSQKHLDIHGGFIETSLMLYLAPEKVHMDKAENFHNKQAEMIQNYR 186

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           YLRA+G H+FGW M D+N +G  GNA  AT K GE + S+       LL+D+  F + + 
Sbjct: 187 YLRAYGPHAFGWMMHDINEQGAAGNASQATAKAGEAIFSHVLCELRALLDDMKKFKIDLL 246


>gi|254438886|ref|ZP_05052380.1| creatininase subfamily [Octadecabacter antarcticus 307]
 gi|198254332|gb|EDY78646.1| creatininase subfamily [Octadecabacter antarcticus 307]
          Length = 259

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 103/259 (39%), Positives = 142/259 (54%), Gaps = 6/259 (2%)

Query: 1   MNPLIIFTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M   + +T        D      I +LP  A EQHGPHLP+ TDT+IA G+  + +   P
Sbjct: 1   MTRRLDWTQYRFAEFKDIDPMQTIAILPTAAIEQHGPHLPVGTDTMIAEGMLAQFRRDCP 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L V  +PV+ +G S EH++  GT TLT A  ++ W  I  ++ + G+RKIVI+N+HGG
Sbjct: 61  SDLDVRILPVQSVGKSNEHLWATGTITLTAATVLQAWTEIGLSVARAGLRKIVIVNSHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N  LVSI++ E R++  ML +   WS F  P G+    E   GIHGG++ETS+ML+ AP 
Sbjct: 121 NLDLVSILTRELRVQADMLAIKCQWSGFGTPVGLYPEKEMAYGIHGGDVETSLMLSFAPD 180

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            V+M  A +F S           L   GS S+GW   DL   GVVG+A  AT KKG    
Sbjct: 181 TVEMSCARDFPST-----AENTRLHPTGSVSYGWISSDLGAAGVVGDASLATAKKGADTA 235

Query: 240 SYFANCFIQLLNDINSFDV 258
            +    FI LL D+   ++
Sbjct: 236 VHQVAGFIDLLRDVREANL 254


>gi|126695895|ref|YP_001090781.1| creatininase [Prochlorococcus marinus str. MIT 9301]
 gi|126542938|gb|ABO17180.1| Creatininase [Prochlorococcus marinus str. MIT 9301]
          Length = 264

 Score =  228 bits (581), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 67/255 (26%), Positives = 112/255 (43%), Gaps = 9/255 (3%)

Query: 7   FTDNSLPLCA--DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           F   +          K   V+ P GA EQHGPHLP+ TD+I    +   +  +    +P+
Sbjct: 10  FEYLNWQEIECVAKNKRSTVIWPFGAVEQHGPHLPLATDSIFVDEIISEVFKLFSADIPL 69

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P + IG+S EH    GT +L+          +   + +MG ++++++N HGG   L+
Sbjct: 70  KKLPTQYIGFSPEHKGFAGTISLSSNLITSMIKEVGSQLSEMGFKRLILINGHGGQISLL 129

Query: 125 SIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           +  + E R     + V     WS       +++  E E G+H    ETS+MLAL P LV 
Sbjct: 130 NTAARELRSVAPGMAVFPCFLWSGVNGLSELLTKTEIEDGLHASLAETSLMLALKPELVG 189

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
            D     +      +   K     G+    W   D +  GV+G++  A    G+ L    
Sbjct: 190 DDRPNEGNK-----VEIPKGWSLEGNAPTAWLTDDFSKSGVIGDSRGANESLGKNLKELL 244

Query: 243 ANCFIQLLNDINSFD 257
            N + +L+ ++   D
Sbjct: 245 INHWSELIMNLMQSD 259


>gi|240138292|ref|YP_002962764.1| putative creatininase (creatine amidohydrolase) [Methylobacterium
           extorquens AM1]
 gi|240008261|gb|ACS39487.1| putative creatininase (creatine amidohydrolase) [Methylobacterium
           extorquens AM1]
          Length = 273

 Score =  228 bits (581), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 92/262 (35%), Positives = 137/262 (52%), Gaps = 1/262 (0%)

Query: 2   NPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
                + D +    +       + +LP+ A EQHGPHLP+  D  I AG+  R  +++P 
Sbjct: 4   PASRWWWDLTTGDFSRLDWGPLVAILPVAAVEQHGPHLPVRVDAAINAGILARAVALMPD 63

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LP   +P+ PIG S EH    GT +L++      W+   +++ + G R+++ILN+HGG 
Sbjct: 64  DLPALVLPMLPIGKSNEHHAFPGTLSLSHETLARLWIETAESVHRAGCRRLLILNSHGGQ 123

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
             ++ IV+ E R+R  ML V   W   T    + S  E   GIHGGEIETS MLAL P L
Sbjct: 124 PQVMEIVTRELRVRLGMLAVGCGWGGVTPMDDLFSQAERRHGIHGGEIETSAMLALHPDL 183

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+++ A++F     E  R    L   G   FGW  +DL+P GV GNA  A  ++G  L+ 
Sbjct: 184 VRIERADDFVPLSVEMERAGGLLTPEGRVGFGWMAQDLHPSGVSGNAAAADARRGAELVE 243

Query: 241 YFANCFIQLLNDINSFDVSIFD 262
             A   ++L+ +I  F +    
Sbjct: 244 RAAAGVVRLVREIADFPLERLG 265


>gi|89053969|ref|YP_509420.1| creatininase [Jannaschia sp. CCS1]
 gi|88863518|gb|ABD54395.1| Creatininase [Jannaschia sp. CCS1]
          Length = 261

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 90/258 (34%), Positives = 140/258 (54%), Gaps = 5/258 (1%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
              + D   P         I +LP+ A EQHGPHLP+  DT+I  GL + + +  P  L 
Sbjct: 2   SRYWIDYPAPDLQIDPDRTIAILPVAAVEQHGPHLPVGVDTMINQGLCDELVARCPDTLD 61

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +  +P++ +G S EH++  GT TL+   A++ W+ I  ++ + G RK++I+N+HGGN  L
Sbjct: 62  IRLLPLQAVGKSNEHLWAPGTLTLSAETAMKAWVEIGLSVARAGARKMLIVNSHGGNMDL 121

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +SIVS E R+R  M  V   W    +P G+ S  ET  GIHGG+ ETS+ML   P  V M
Sbjct: 122 ISIVSRELRVRAGMYCVRMVWGAGGVPDGVFSAQETTQGIHGGDNETSLMLHFRPDAVDM 181

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
             A++F    ++       +   G  + GW   D++P+GV G A  AT +KG    +++ 
Sbjct: 182 SKAKDFRWTHTQGE-----IPPVGPIAHGWIASDVHPEGVAGEAHLATAEKGRVTAAHYV 236

Query: 244 NCFIQLLNDINSFDVSIF 261
           +  I +L+ I +  +  F
Sbjct: 237 DGVIDVLHKIAAQPLDRF 254


>gi|33863500|ref|NP_895060.1| creatininase [Prochlorococcus marinus str. MIT 9313]
 gi|33640949|emb|CAE21407.1| Creatininase [Prochlorococcus marinus str. MIT 9313]
          Length = 273

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 71/255 (27%), Positives = 119/255 (46%), Gaps = 5/255 (1%)

Query: 5   IIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
             F   S P  A+A   +   +V P GA EQHGPHLP+ TD   A  +   +   LP  L
Sbjct: 6   RRFDHLSWPEAAEAVGLEGSTLVWPFGACEQHGPHLPLITDAFFAERMLVEVLERLPADL 65

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P+  +P + +G+S EH    GT +L+     +  + +   +  MG+R++++ NAHGG   
Sbjct: 66  PIWMLPAQSLGFSPEHEAFPGTLSLSANLMFQLVIEVGQQLAAMGVRRLLLFNAHGGQIG 125

Query: 123 LVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           L+ + + + R +   + V     WS     + ++   E E+G+H G  ETS+ML++AP L
Sbjct: 126 LLHVAARQLRAQCPAMAVLPCFLWSGVGALKDLLPESEREVGLHAGLAETSLMLSMAPEL 185

Query: 181 VKMDLAENFSSRQSEFLRNFK-YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           V +D   +                   G     W   D +  GV+G++ +A    G+ L 
Sbjct: 186 VGLDRPVDGDHYTPGLSTTPPMGWSLEGHAPCAWLTDDFSESGVIGDSREANAALGKALE 245

Query: 240 SYFANCFIQLLNDIN 254
               + ++ LL  + 
Sbjct: 246 QALVDHWVNLLISLM 260


>gi|188580367|ref|YP_001923812.1| creatininase [Methylobacterium populi BJ001]
 gi|179343865|gb|ACB79277.1| Creatininase [Methylobacterium populi BJ001]
          Length = 272

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 93/261 (35%), Positives = 139/261 (53%), Gaps = 1/261 (0%)

Query: 2   NPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
                + D +    +    D  + +LP+ A EQHGPHLP+  D  I AG+  R  +++P 
Sbjct: 3   PASRWWWDLTTEAFSRLDWDSLVAILPVAAVEQHGPHLPVRVDAAINAGILARAVALMPD 62

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LP   +P+ P+G S EH    GT +L++      W+   +++ + G R+++ILN+HGG 
Sbjct: 63  DLPALVLPMLPVGKSNEHHAFPGTLSLSHETLARLWIETAESVHRAGCRRLLILNSHGGQ 122

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
             ++ IV+ E R+R  ML V   W   T    + S  E   GIHGGEIETS+MLAL P L
Sbjct: 123 PQVMEIVTRELRVRLGMLAVGCGWGGVTAMDDLFSEAERRHGIHGGEIETSLMLALHPDL 182

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+M+ A++F        R    L A G   FGW  +DL+P GV GNA  A  ++G  L+ 
Sbjct: 183 VRMERADDFVPLTVALERAGGLLTAEGRVGFGWMAQDLHPAGVSGNAAAADARRGAELVE 242

Query: 241 YFANCFIQLLNDINSFDVSIF 261
             A   ++L+ +I  F +   
Sbjct: 243 RAAAGVVRLVREIADFPLERL 263


>gi|120613080|ref|YP_972758.1| creatininase [Acidovorax citrulli AAC00-1]
 gi|120591544|gb|ABM34984.1| Creatininase [Acidovorax citrulli AAC00-1]
          Length = 282

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 88/242 (36%), Positives = 129/242 (53%), Gaps = 8/242 (3%)

Query: 3   PLIIFTDNSLPLCADARK-----DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           P   + D S    ++A+        + VLP+ A EQHGPHLP+  D  +  G+ +    +
Sbjct: 10  PSRFWADLSTRDFSEAQASGLAARTVAVLPVAAVEQHGPHLPLGVDATLLRGVIDAALPL 69

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
           LP  LPV  +P + +G+S EH    GT TL+ A  +  W  +   + + G++K+++LN H
Sbjct: 70  LPADLPVLFLPPQDVGFSTEHTSFPGTLTLSPATVMALWSELGACVARAGVKKLLLLNGH 129

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQ---GIISFPETEIGIHGGEIETSMML 174
           GG   ++ IV+ E R R  +LV S SW    +P+   G+ S  E   GIH G+IETSMML
Sbjct: 130 GGQVSVMDIVARELRQRHGLLVYSASWFSLPLPEAVQGLFSAEEHRFGIHAGQIETSMML 189

Query: 175 ALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKK 234
            LAP  V+M  A  F S   +    +  L    S   GW+++D +P G VG+A  AT  K
Sbjct: 190 HLAPDTVRMAHAGCFRSTSQDRAERYAILGNGRSAKMGWAIEDYHPSGAVGDAAGATAGK 249

Query: 235 GE 236
           G 
Sbjct: 250 GR 251


>gi|89902506|ref|YP_524977.1| creatininase [Rhodoferax ferrireducens T118]
 gi|89347243|gb|ABD71446.1| Creatininase [Rhodoferax ferrireducens T118]
          Length = 286

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 97/278 (34%), Positives = 135/278 (48%), Gaps = 13/278 (4%)

Query: 1   MNP-LIIFTDNSLPLCADA-----RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI 54
           MNP    + + S    A           I VLP+ A EQHGPHLP++ DT++  G+    
Sbjct: 4   MNPCSRYWANLSTRDFAQLIAGGQAAKTIAVLPVAATEQHGPHLPLSVDTVLVDGIVTAA 63

Query: 55  KSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVIL 114
              L   L V  +P + +G S EH    GT TL     +  W  I +++   GI+K+++ 
Sbjct: 64  LPHLAADLNVLFLPTQAVGLSPEHARFPGTLTLKNETILRLWTDIGESVAAAGIQKLLLF 123

Query: 115 NAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFT-------IPQGIISFPETEIGIHGGE 167
           N+HGGN  ++ +V+ + R R  MLV S SW               + S  E   GIH GE
Sbjct: 124 NSHGGNVSVMDLVARDLRARLGMLVYSVSWFNLPLTDAQGQDVNALFSADEHRFGIHAGE 183

Query: 168 IETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNA 227
           +ETSMMLAL P  V M  A+NF S   +  + F  L    S   GW M+D NP G VGNA
Sbjct: 184 METSMMLALDPARVNMVQAQNFHSTAQDRAQKFAILGNGKSAKLGWQMQDYNPAGAVGNA 243

Query: 228 MDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDV 265
             A+ +KG  L++       +LL +IN   +S      
Sbjct: 244 AAASAEKGRALVAAAGLGLARLLAEINQLPLSTLVTGP 281


>gi|110635177|ref|YP_675385.1| creatininase [Mesorhizobium sp. BNC1]
 gi|110286161|gb|ABG64220.1| Creatininase [Chelativorans sp. BNC1]
          Length = 246

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 127/244 (52%), Positives = 171/244 (70%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A ++ I +LPLGA EQHGPHLP  TD IIA  +A+RIK  +   + +  +PVE  GYSIE
Sbjct: 2   APREKIAILPLGATEQHGPHLPPETDWIIAEAIADRIKMRVGGAMHLDILPVEKTGYSIE 61

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           H     T++L + EAIE W+ I + + + G  K V+LNAHGGNSPL++IV+TE R R  M
Sbjct: 62  HSDDPRTRSLGFPEAIERWIGIGEDLCRKGTYKFVMLNAHGGNSPLMTIVATELRARHGM 121

Query: 138 LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
           L V+TSW+RF  P G++S  E  +GIHGG IETS+MLAL P LVKM+ A++FSS Q+ F 
Sbjct: 122 LAVATSWTRFGTPPGLVSDVEKALGIHGGFIETSVMLALRPDLVKMEEAKDFSSEQARFQ 181

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
           R F YLRA+G H+FGW M+DL+ +GVVGNA  A+ + GE LL +  + F +LL D++ F+
Sbjct: 182 REFTYLRAYGPHAFGWMMRDLSAEGVVGNAAAASAEAGETLLEHAVSGFAELLADVDRFE 241

Query: 258 VSIF 261
           +  F
Sbjct: 242 LKTF 245


>gi|317969605|ref|ZP_07970995.1| creatininase [Synechococcus sp. CB0205]
          Length = 277

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 74/267 (27%), Positives = 118/267 (44%), Gaps = 10/267 (3%)

Query: 4   LIIFTDNSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
                  + P    A +     VV P GA+EQHGPHLP+ TD + A  + +++   LP  
Sbjct: 11  SRRLERLTWPAFQAAAQTCGSTVVWPFGAFEQHGPHLPLGTDALFAEQILDQVLESLPQE 70

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
            P+  +P++ IG+S EH+   GT +L     I     +   +   G  ++V+ N HGG  
Sbjct: 71  APIWRLPLQSIGFSPEHLGFPGTLSLPAELLISSIETVGGQLAAAGFERLVLFNGHGGQI 130

Query: 122 PLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
            L+ + + + R     L V     WS       +I  PE   G+H G++ETS+ML L P 
Sbjct: 131 ALLQVAARQLRAAHPSLGVLPCFLWSGPKGIGELIEEPERSDGLHAGQVETSLMLQLNPE 190

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV    AE+    Q       +     G+    W  +DL+  GV+G+   A   +GE L 
Sbjct: 191 LVGPKRAEDGLGAQQP----PQGWSLEGAVPNAWLTQDLSSSGVIGDPSQANGAQGEALR 246

Query: 240 SYFANCFIQLLNDINSFDVSIFDKDVQ 266
                 + +L   +   D     ++ +
Sbjct: 247 HRLVQGWSELFGSLLGSD--WPPREPK 271


>gi|124022487|ref|YP_001016794.1| creatininase [Prochlorococcus marinus str. MIT 9303]
 gi|123962773|gb|ABM77529.1| Creatininase [Prochlorococcus marinus str. MIT 9303]
          Length = 273

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 71/255 (27%), Positives = 120/255 (47%), Gaps = 5/255 (1%)

Query: 5   IIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
             F   S P  A+A   +   +V P GA EQHGPHLP+ TD   A  +   +   LP  L
Sbjct: 6   RRFAHLSWPEAAEAVGLEGSTLVWPFGACEQHGPHLPLITDAFFAERMLVEVLERLPADL 65

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P+  +P + +G+S EH    GT +L+     +  + +   +  MG+R++++ NAHGG   
Sbjct: 66  PIWMLPAQSLGFSPEHEAFPGTLSLSANLMFQLVIEVGQQLAAMGVRRLLLFNAHGGQIG 125

Query: 123 LVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           L+ + + + R +   + V     WS     + ++   E E+G+H G  ETS+ML++AP L
Sbjct: 126 LLHVAARQLRAQCPAMAVLPCFLWSGVGALKDLLPESEREVGLHAGLAETSLMLSMAPEL 185

Query: 181 VKMDLAENFSSRQSEFLRNFK-YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           V ++   +                   G     W   D +  GV+G++ +A    G+ L 
Sbjct: 186 VGLERPVDGDHYTPGLSTTPPMGWSLEGHAPCAWLTDDFSESGVIGDSREANAALGKALE 245

Query: 240 SYFANCFIQLLNDIN 254
              A+ ++ LL  + 
Sbjct: 246 QALADHWVNLLISLM 260


>gi|33239982|ref|NP_874924.1| creatininase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
 gi|33237508|gb|AAP99576.1| Creatinine amidohydrolase related enzyme [Prochlorococcus marinus
           subsp. marinus str. CCMP1375]
          Length = 277

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 77/270 (28%), Positives = 128/270 (47%), Gaps = 8/270 (2%)

Query: 4   LIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
                  S P  ++A  ++   +V P GA EQHGPHLP+ TDT+ A  + + +   LP  
Sbjct: 10  SRNLAFLSWPEASEAASKEGSTLVWPFGACEQHGPHLPLITDTLFAESILKEVFDCLPND 69

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LP+  +P + IG+S EH+   GT +L+    ++    +   + +MG +++V  NAHGG  
Sbjct: 70  LPIWSLPSQSIGFSPEHLSFPGTLSLSGDLMLKMISEVGKQLSEMGFQRLVFFNAHGGQI 129

Query: 122 PLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
            L+  ++ E R++   + V     WS     + +I   E E G+H    ETS+ML+L   
Sbjct: 130 GLLQAIARELRVQCPSMAVLPCFLWSGIDSLKDLIPHKEVEQGLHAALAETSLMLSLNSD 189

Query: 180 LVKMDLAENFSSRQSEFLR--NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
           LV      +      +  R    +     G+    W  +DL+  GVVG++  +T + G  
Sbjct: 190 LVGEARPFDGDMDVFDKKRILPPEGWSLEGAAPCAWLTQDLSKTGVVGDSRGSTPELGNQ 249

Query: 238 LLSYFANCFIQLLNDINSFDVSIFDKDVQK 267
           L       +I+L  ++   D +    D QK
Sbjct: 250 LRKKLVEHWIKLFLNL--LDSNWPPIDHQK 277


>gi|159043925|ref|YP_001532719.1| creatininase [Dinoroseobacter shibae DFL 12]
 gi|157911685|gb|ABV93118.1| creatininase [Dinoroseobacter shibae DFL 12]
          Length = 265

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 98/261 (37%), Positives = 135/261 (51%), Gaps = 7/261 (2%)

Query: 1   MNPLI-IFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           M      + +           +  I +LP  A EQHGPHLP  TDT+I AG+ + + + L
Sbjct: 1   MAERRHWWAEYRTTEFDGLDPERVIAILPTAAIEQHGPHLPTGTDTMIMAGMLDALCAAL 60

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  L +  +P++ +G S EH++  GT TL    A+  W     ++ + G+RKIV +N+HG
Sbjct: 61  PEDLNIRILPIQAVGKSNEHIHAPGTLTLEAETALGAWRETGLSVARAGLRKIVCVNSHG 120

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           GN  LVSI+S E R+R  ML V T W  F  P+G+ S  E   GIHGG++ETS+ML   P
Sbjct: 121 GNLDLVSILSRELRVRAGMLAVKTQWMSFGTPEGMYSDTERAFGIHGGDVETSLMLHFQP 180

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
           H V M  A NF+S           +   G  S GW   DLN  G VG+A  AT  KGE  
Sbjct: 181 HTVDMAQARNFASTAQGAP-----ISPIGPVSLGWVSSDLNAAGTVGDASAATAAKGEAT 235

Query: 239 LSYFANCFIQLLNDINSFDVS 259
            ++     I LL  +    + 
Sbjct: 236 CAHQVGGMIDLLRKLRDLPLD 256


>gi|163868834|ref|YP_001610060.1| creatinine amidohydrolase [Bartonella tribocorum CIP 105476]
 gi|161018507|emb|CAK02065.1| creatinine amidohydrolase [Bartonella tribocorum CIP 105476]
          Length = 247

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 116/238 (48%), Positives = 166/238 (69%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA+E HG HLP  TD IIA   ++ +      +  +  +PVE IGYS+EHM V 
Sbjct: 8   LALLPLGAHEYHGEHLPFETDWIIAEAFSKALILQTKEQFHIALLPVEKIGYSVEHMDVI 67

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT+TLT+++AI+ W+ I +     GI+++++LNAHGGNSPL++IV TE R R SML V+T
Sbjct: 68  GTQTLTFSDAIKRWIKIGENCYHKGIKRLLLLNAHGGNSPLMNIVITELRRRLSMLAVAT 127

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SWSRF +PQG+I   +  + IHGG IETS+ML LAP  V M+ A NF ++Q++ + N++Y
Sbjct: 128 SWSRFGLPQGLIEPAQQHLDIHGGFIETSLMLYLAPEKVHMEKAANFHNKQADMIANYRY 187

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
           LRA+G H+FGW+M+DLN  G  GNA  AT + GE + S+  +    LL+DIN F+++ 
Sbjct: 188 LRAYGPHAFGWTMRDLNTHGAAGNASKATPQAGEAIFSHVLSQLRDLLDDINRFNINT 245


>gi|170742681|ref|YP_001771336.1| creatininase [Methylobacterium sp. 4-46]
 gi|168196955|gb|ACA18902.1| Creatininase [Methylobacterium sp. 4-46]
          Length = 267

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 106/258 (41%), Positives = 150/258 (58%), Gaps = 1/258 (0%)

Query: 3   PLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P   + D +     D A    I VLP+ A EQHGPHLP+ TD +I  G   R+   +P  
Sbjct: 2   PARSWQDLTTAEIRDRAMDRAIAVLPVAAVEQHGPHLPLGTDAVIQEGYLARVAPQVPED 61

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           L V  +PV+ IG S EH+   GT TL    A+  W+ I +A+ + G RK+VI+ +HGGNS
Sbjct: 62  LDVLLLPVQAIGKSDEHLSFPGTLTLAGPTALAAWVEIGEAVHRAGCRKLVIVTSHGGNS 121

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            L+ +V+ E R R  +L V+T+WSRF  P G+    E   GIHGG +ET++MLAL P LV
Sbjct: 122 ALIDLVALELRRRCGLLAVTTAWSRFGYPPGLFPEEEIRHGIHGGAVETALMLALRPDLV 181

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D   +F  R     R++  LRA    +F W  +DLNP+G +G+A  AT   GE  L++
Sbjct: 182 RRDRVRDFVPRSRAMERDYAQLRAGRPAAFAWLAEDLNPEGAIGDARLATAAAGEAALAH 241

Query: 242 FANCFIQLLNDINSFDVS 259
            A  F+ LL D++ F ++
Sbjct: 242 GARAFVALLGDVDRFSLA 259


>gi|82799325|gb|ABB92251.1| creatininase [uncultured marine type-A Synechococcus 5B2]
          Length = 268

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 73/258 (28%), Positives = 117/258 (45%), Gaps = 4/258 (1%)

Query: 3   PLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
               F   + P   +   +    +V P GA EQHGPHLP+ TD + A  + + + + L  
Sbjct: 4   SARRFDQLTWPEVRELAPQAGSTLVWPFGACEQHGPHLPLATDALFAERILDVVLADLDR 63

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LP+  +P + IG+S EH    GT +L+    I   + +   +  MG +++V+ NAHGG 
Sbjct: 64  ALPIWRLPAQAIGFSPEHQSFPGTLSLSSELLIGIVVQLGAQLAGMGWQRLVLFNAHGGQ 123

Query: 121 SPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
             L+ + + E R +   + V     WS       +I   E   G+H G  ET++ML LAP
Sbjct: 124 IGLLQVAARELRQKCPDMAVLPCFLWSGVAGLDTLIPDVELVDGLHAGLGETALMLQLAP 183

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV      +  S               G+  + W   DL+P GV+G++ DA+V  G  L
Sbjct: 184 DLVGSSRPVDGLSSGDPTQSPPPGWSLEGAAPYTWLTDDLSPSGVIGDSRDASVALGSAL 243

Query: 239 LSYFANCFIQLLNDINSF 256
                  + +L + +   
Sbjct: 244 EKRLVQHWSRLFDALLRS 261


>gi|33866271|ref|NP_897830.1| creatininase [Synechococcus sp. WH 8102]
 gi|33639246|emb|CAE08254.1| Creatininase [Synechococcus sp. WH 8102]
          Length = 276

 Score =  224 bits (572), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 74/259 (28%), Positives = 118/259 (45%), Gaps = 4/259 (1%)

Query: 3   PLIIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
               F   + P   +        ++ P GA EQHGPHLP+ TD + A  +AE + + L P
Sbjct: 4   HRRRFDQLAWPEIQERAHGDGSTLIWPFGACEQHGPHLPLVTDALFAERIAEAVLAELNP 63

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LP+  +P + IG+S EH    GT +L+    I   + + + +  MG R++V+ NAHGG 
Sbjct: 64  ELPIWRLPTQVIGFSPEHQSFPGTLSLSSDLLIALVVQLGEQLAGMGWRRLVLFNAHGGQ 123

Query: 121 SPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
             L+ + + E R R   + V     WS       ++   E E G+H G  ETS+ML  AP
Sbjct: 124 IALLQVAARELRQRCPAMAVLPCFLWSGVEGLADLLPADELENGLHAGLAETSLMLHQAP 183

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV     ++                  G+    W M+DL+  GV+G++  A+ + G+ L
Sbjct: 184 ELVGDQRPKDGLPGVDGCPVPPSGWSLEGAAPSAWLMQDLSRSGVIGDSGAASAELGQAL 243

Query: 239 LSYFANCFIQLLNDINSFD 257
                  +      + + D
Sbjct: 244 EQRLVVHWTARFQALLTSD 262


>gi|123968122|ref|YP_001008980.1| creatininase [Prochlorococcus marinus str. AS9601]
 gi|123198232|gb|ABM69873.1| Creatininase [Prochlorococcus marinus str. AS9601]
          Length = 264

 Score =  224 bits (572), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 68/255 (26%), Positives = 113/255 (44%), Gaps = 9/255 (3%)

Query: 7   FTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           F   +          K   V+ P GA EQHGPHLP+ TD+I    +   +  +LP  +P+
Sbjct: 10  FEYLNWQEIESIATEKRSTVIWPFGAVEQHGPHLPLATDSIFVDDIISEVFKLLPADIPL 69

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P + IG+S EH    GT +L+          +   + +MG ++++++N HGG   L+
Sbjct: 70  KKLPTQYIGFSPEHKGFAGTISLSSNLITSMIKEVGGQLSEMGFKRLILINGHGGQISLL 129

Query: 125 SIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           +  + E R     + V     WS       +++  E E G+H    ETS+MLAL P LV 
Sbjct: 130 NTAARELRSFSPEMAVFPCFLWSGVNGLSQLLTKTEIENGLHASLAETSLMLALKPELVG 189

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
            +        Q       +     G+    W   D +  GV+G++  A    G+ L    
Sbjct: 190 NERPNEGIKGQIP-----EGWSLEGNAPTAWLTDDFSKSGVIGDSRGANESLGKNLKELL 244

Query: 243 ANCFIQLLNDINSFD 257
            N + +L+ ++   D
Sbjct: 245 INHWFKLIMNLMQSD 259


>gi|78778916|ref|YP_397028.1| creatininase [Prochlorococcus marinus str. MIT 9312]
 gi|78712415|gb|ABB49592.1| creatininase [Prochlorococcus marinus str. MIT 9312]
          Length = 262

 Score =  224 bits (571), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 68/255 (26%), Positives = 114/255 (44%), Gaps = 9/255 (3%)

Query: 7   FTDNSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           F   +        KD    V+ P GA EQHGPHLP+ TD+I    +   +  +    +P+
Sbjct: 10  FEYLNWQEIESIAKDKRSTVIWPFGAVEQHGPHLPLATDSIFVDEIISEVFKLFSSDIPL 69

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P + IG+S EH    GT +L+          +   + +MG ++++++N HGG   L+
Sbjct: 70  KKLPTQYIGFSPEHKGFAGTISLSSYLITSMIKEVGGQLSEMGFKRLILINGHGGQISLL 129

Query: 125 SIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           +  + E R     + V     WS       +++  E E G+H    ETS+MLA+ P LV 
Sbjct: 130 NTAARELRSFAPGMAVFPCFLWSGVNGLSELLTKTEIENGLHASLAETSLMLAIKPELVG 189

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
            +        Q       +     G+    W  KDL+  GV+G++  A    G+ L    
Sbjct: 190 DERPNEGIKGQIP-----EGWSLEGNAPTAWLTKDLSKSGVIGDSRGANESLGKDLKELL 244

Query: 243 ANCFIQLLNDINSFD 257
            N + +L+ ++   D
Sbjct: 245 INHWFKLIMNLMESD 259


>gi|90655489|gb|ABD96329.1| creatininase [uncultured marine type-A Synechococcus GOM 3O6]
          Length = 276

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 72/259 (27%), Positives = 119/259 (45%), Gaps = 4/259 (1%)

Query: 3   PLIIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
               F   + P   +  +     ++ P GA EQHGPHLP+ TD + A  +A+ + + L P
Sbjct: 4   HQRRFDQLAWPEIQERARGDGSTLIWPFGACEQHGPHLPLVTDALFAERIADAVLAELKP 63

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LP+  +P + IG+S EH    GT +L+    I   + + + +  MG R++V+ NAHGG 
Sbjct: 64  ELPIWRLPTQVIGFSPEHQSFPGTLSLSSDLLIALVVQLGEQLAAMGWRRLVLFNAHGGQ 123

Query: 121 SPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
             L+ + + E R R  ++ V     WS       ++   E   G+H G  ETS+ML  AP
Sbjct: 124 IALLQVAARELRQRCPVMAVLPCFLWSGVEGLADLLPADELVNGLHAGLAETSLMLHQAP 183

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV     ++                  G+    W M+DL+  GV+G++  A+ + G+ L
Sbjct: 184 ELVGDQRPKDGLPGLDSCPAPPSGWSLEGAAPSAWLMQDLSRSGVIGDSGTASAELGQAL 243

Query: 239 LSYFANCFIQLLNDINSFD 257
                  +      + + D
Sbjct: 244 EQRLLVHWTARFQALLTSD 262


>gi|239832634|ref|ZP_04680963.1| creatininase [Ochrobactrum intermedium LMG 3301]
 gi|239824901|gb|EEQ96469.1| creatininase [Ochrobactrum intermedium LMG 3301]
          Length = 260

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 134/249 (53%), Positives = 175/249 (70%)

Query: 13  PLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI 72
               +   D IVVLPLGA+EQHGPHLP  TDTIIA G+  R+   LP  L V  +P +P+
Sbjct: 2   TDLREQNSDMIVVLPLGAHEQHGPHLPFETDTIIAEGIVARVSDALPADLNVNFLPAQPV 61

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           GYSIEHM  +GT++L YAEA+  W+ I + +   GIRK+V+LNAHGGNSPL++IV+TE R
Sbjct: 62  GYSIEHMDTEGTQSLAYAEAVNQWIGIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELR 121

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            R  ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NFS+ 
Sbjct: 122 TRLDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMSKARNFSNA 181

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           QS +   F++LRA+G H+FGW M DLNP+GV GNA  AT + GE L++     FI LL D
Sbjct: 182 QSRYAEEFRFLRAYGPHAFGWKMHDLNPEGVAGNAAAATAEAGEKLIANAVAGFIDLLRD 241

Query: 253 INSFDVSIF 261
           ++ FD++ F
Sbjct: 242 VDRFDLARF 250


>gi|304393374|ref|ZP_07375302.1| creatininase [Ahrensia sp. R2A130]
 gi|303294381|gb|EFL88753.1| creatininase [Ahrensia sp. R2A130]
          Length = 243

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 116/242 (47%), Positives = 156/242 (64%), Gaps = 3/242 (1%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
            I ++PLGA+EQHGPHLP  TD +IA+G+ +R  +     L +  MP EP+GYS EHM  
Sbjct: 5   AITIIPLGAHEQHGPHLPFETDALIASGVMQRTLAK-AADLNLHVMPAEPVGYSPEHMRF 63

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
           +G++TL ++EAI  W+ + +     G  +IV +NAHGGN PLV IV  E R R ++L VS
Sbjct: 64  EGSRTLGWSEAIIRWIGLGEQAIADGSDRIVFMNAHGGNVPLVQIVCQELRSRHAVLAVS 123

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
           T W RFT   GI+S  E  +GIHGGEIET++MLAL P LV M  A +F + QS       
Sbjct: 124 TKWDRFTRGYGIVSQSEEALGIHGGEIETAVMLALHPELVDMSKAVDFPNLQSRLTG--P 181

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           +LRA+G HSFGW M DLNP GV GN+  AT + GE LL   ++  + LL+++  FD+S+ 
Sbjct: 182 HLRAYGPHSFGWMMGDLNPDGVAGNSAAATAETGEKLLDIASDGLLALLHEVADFDLSLL 241

Query: 262 DK 263
             
Sbjct: 242 KD 243


>gi|239817718|ref|YP_002946628.1| Creatininase [Variovorax paradoxus S110]
 gi|239804295|gb|ACS21362.1| Creatininase [Variovorax paradoxus S110]
          Length = 287

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 128/259 (49%), Gaps = 8/259 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P       S    A    R++ ++VLP GA EQHGPHLP + D++IA+G+  +    L
Sbjct: 6   IPPHRFLPYLSWTEIAALPDRENTVIVLPCGAIEQHGPHLPCSVDSVIASGVMGKALEKL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +    +P    G S EH++  GT TLT    +     I +++ + G RK++  N HG
Sbjct: 66  PAEVRAFALPTITYGKSEEHLHFPGTMTLTGTTLLSTVTEIGESVYRAGFRKLLFANGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ + + E R+R    VV               IS  E ++ +H G  ET++MLAL
Sbjct: 126 GQPQVLEMAARELRLRHGDFVVVPHGVSRLPNASSRQISEQEKKLSMHAGHSETALMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V M+ A              K L A G  +  W+ +D  P GV+G+   AT ++G+
Sbjct: 186 APDTVHMERAAANFPPPFP----IKLLSADGRPACAWTARDFGPSGVIGDPTSATREQGQ 241

Query: 237 GLLSYFANCFIQLLNDINS 255
            +L   ++ ++Q L ++++
Sbjct: 242 EILDTLSDSWVQALTELHA 260


>gi|72383698|ref|YP_293053.1| creatininase [Prochlorococcus marinus str. NATL2A]
 gi|72003548|gb|AAZ59350.1| creatinine amidohydrolase related enzyme [Prochlorococcus marinus
           str. NATL2A]
          Length = 265

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 75/252 (29%), Positives = 116/252 (46%), Gaps = 4/252 (1%)

Query: 10  NSLPLC--ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
            + P    A +     +V P GA EQHGPHLP+ TDT  A  +  +  + LP  +P+  M
Sbjct: 1   MTWPEASKAASENGSTLVWPFGACEQHGPHLPLITDTFFAENILIKTLNRLPENMPIWMM 60

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P + IG+S EH    GT +L+    I     +   I  MG  ++V  NAHGG   L+  V
Sbjct: 61  PSQSIGFSPEHQAFPGTLSLSADVLISMVTDVGQQIASMGFNRLVFFNAHGGQIGLLQAV 120

Query: 128 STEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
           S + R++   + V     WS       ++   E E G+H    ETS+ML +A  LV+ D 
Sbjct: 121 SRQLRIQCPSIAVLPCFLWSGVPGLDQLLPEKEVEEGLHAALAETSLMLHMARDLVRNDS 180

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
                +   + +   K     G+    W  +DL+  GV+G+A  +  + G  L +   + 
Sbjct: 181 YLEIKNVDKQIVTTPKGWSLEGASPCAWLTEDLSSSGVIGDASSSNSELGAALENALVDH 240

Query: 246 FIQLLNDINSFD 257
           +I L   +   D
Sbjct: 241 WIALFTSLLESD 252


>gi|289208263|ref|YP_003460329.1| creatininase [Thioalkalivibrio sp. K90mix]
 gi|288943894|gb|ADC71593.1| Creatininase [Thioalkalivibrio sp. K90mix]
          Length = 267

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 92/261 (35%), Positives = 138/261 (52%), Gaps = 2/261 (0%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           I + D +    AD AR+D +VVLP+ A EQHG HLP++TD  I  GL +    +LP  L 
Sbjct: 7   IRWQDLTTEAVADHARRDAVVVLPMAAIEQHGAHLPLDTDLRIGLGLLDAAAPLLPSDLE 66

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
              +P   I  S EH +  GT +LT   A+     I  A+   G R++V+ N+HGGN+ +
Sbjct: 67  PLVLPPMAIATSAEHTHFAGTLSLTPETALALLREIGAAVAHAGFRRLVLANSHGGNTAI 126

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGI-ISFPETEIGIHGGEIETSMMLALAPHLVK 182
           + + + + R  + +LV    +    +P  + I   E   G+HGG IET+MM  LAP LV+
Sbjct: 127 MELAALDLRRDYGLLVSKHHYFLQYLPDTLDIPERERRHGLHGGLIETAMMRMLAPTLVQ 186

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           MD A++  S   +     + L   G  +F W   DLNP GVVG A  AT + G+ L+ ++
Sbjct: 187 MDRAQDARSLGEDLEDTTRRLGPTGETAFAWMADDLNPGGVVGAADRATPELGQVLIDHY 246

Query: 243 ANCFIQLLNDINSFDVSIFDK 263
           A    Q + D  +F +    +
Sbjct: 247 AKGLAQAITDTAAFPIERLAR 267


>gi|148242686|ref|YP_001227843.1| creatininase [Synechococcus sp. RCC307]
 gi|147850996|emb|CAK28490.1| Creatininase [Synechococcus sp. RCC307]
          Length = 266

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 79/257 (30%), Positives = 118/257 (45%), Gaps = 10/257 (3%)

Query: 5   IIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
                   P    A +     VVLP+GA+EQHGPHLPM TD + A  + +R+ + LP  L
Sbjct: 2   RRLEHLWWPALQAAAQQPGSTVVLPVGAFEQHGPHLPMGTDLLFAEAVVDRVLAQLPAEL 61

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P+  +P    G+S EH+   GT +L+    +     I  A+ + G R++V+ N HGG   
Sbjct: 62  PLWRLPAVAFGFSPEHLGFPGTVSLSAEALLAQLQGIAAALSEAGFRRLVLFNGHGGQIA 121

Query: 123 LVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           L+ + + + + +F  L V     WS        I  PE   G+H G +ETS+MLAL P L
Sbjct: 122 LLQVAARQLQQQFPSLAVLPWFLWSGPPGVLEQIPEPERSQGLHAGRLETSLMLALHPEL 181

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V                     L   G+    W  + L+  GVVG+   A+  +GE LL 
Sbjct: 182 V------GELPAGEAMASPPAGLSLEGAVPTAWRTRSLSNSGVVGDPAGASAAEGELLLQ 235

Query: 241 YFANCFIQLLNDINSFD 257
                + +L + +   D
Sbjct: 236 GLVGGWCELFDTLMRSD 252


>gi|330015328|ref|ZP_08308145.1| creatininase [Klebsiella sp. MS 92-3]
 gi|328531813|gb|EGF58638.1| creatininase [Klebsiella sp. MS 92-3]
          Length = 293

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 77/259 (29%), Positives = 127/259 (49%), Gaps = 9/259 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +         S    A    + + ++VLP GA EQHGPHLP + D++I++G+A    + L
Sbjct: 6   IPAARFLPFLSWTDVAALPDKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HG
Sbjct: 66  PATIPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTLLEIAESLYRAGFRKLLMINGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I   E R+R    +      ++     +  +S  E  + +H G  ET++MLAL
Sbjct: 126 GQPQILQIACREMRLRHGDFIAIPHDVFNVPNCEKQFLSPHEQRMAMHAGHSETALMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V M+ A      +       K     G  +  W+  D  P GV+G+   AT ++GE
Sbjct: 186 APECVHMERAVANFPPEFPCPTLSK-----GRPAAAWASYDFGPSGVIGDPTPATREQGE 240

Query: 237 GLLSYFANCFIQLLNDINS 255
           GLL   A  + Q + +I+ 
Sbjct: 241 GLLDSLAASWAQAIIEIHR 259


>gi|326388096|ref|ZP_08209699.1| creatinine amidohydrolase family protein [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326207262|gb|EGD58076.1| creatinine amidohydrolase family protein [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 270

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 92/258 (35%), Positives = 139/258 (53%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
              + D + P         + VLP+GA EQHGPHLP+  D+ I   L +R  +  P  L 
Sbjct: 9   ARYWQDMAWPAFTALPASTVAVLPVGAIEQHGPHLPVYVDSCINQELLDRALATAPADLD 68

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V  +P++ +G S EH+   GT +L+ A      L + D++ + G+R++++LN+HGG   +
Sbjct: 69  VVALPLQAVGKSNEHLAFPGTLSLSNATLTALLLDLGDSVARAGVRRLILLNSHGGQPQV 128

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           + +V+ E R+R  ML V+ +W    +P G+ +  E   GIHGGE+ETS+ML L P LV M
Sbjct: 129 LDVVARELRIRHGMLAVNAAWYSMGMPPGLFAPDELHHGIHGGELETSLMLHLRPDLVDM 188

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
             A +F S   +   +F  L   G   FGW  +DLNP G VGNA  A  ++G  L     
Sbjct: 189 TKAADFRSLSQDMEGDFTLLSPEGKFGFGWQTQDLNPAGAVGNAAGADAERGRILAEAAV 248

Query: 244 NCFIQLLNDINSFDVSIF 261
             F +L  ++  F +  F
Sbjct: 249 ARFHELAREVARFPLERF 266


>gi|49474560|ref|YP_032602.1| hypothetical protein BQ10260 [Bartonella quintana str. Toulouse]
 gi|49240064|emb|CAF26494.1| hypothetical protein BQ10260 [Bartonella quintana str. Toulouse]
          Length = 246

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 118/239 (49%), Positives = 165/239 (69%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA+E HG HLP  TD IIA   A+ +      +  +  +PVE IGYS+EHM V 
Sbjct: 8   LALLPLGAHEYHGNHLPFETDWIIAEAFAKALILQTKKQFSIALLPVEKIGYSVEHMDVA 67

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT+T T++ AIE W+ I +   + GI++ ++LNAHGGNSPL+SIV TE R RFSML V+T
Sbjct: 68  GTQTRTFSNAIERWINIGENCYRKGIKRFLLLNAHGGNSPLMSIVITELRRRFSMLAVAT 127

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW+RF +PQG++   +  + IHGG IETS+ML LAP  V M+ AENF ++Q++ + N++Y
Sbjct: 128 SWNRFGLPQGLMKPSQHHLDIHGGFIETSLMLYLAPEKVHMEKAENFHNKQADMIANYQY 187

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           LRA+G H+FGW+M+DLN +G  GNA +AT + GE + S+       LL+DIN F +   
Sbjct: 188 LRAYGPHAFGWTMRDLNLQGAAGNAREATSQAGEAIFSHVLCGLRGLLDDINRFKIDAL 246


>gi|319796040|ref|YP_004157680.1| creatininase [Variovorax paradoxus EPS]
 gi|315598503|gb|ADU39569.1| Creatininase [Variovorax paradoxus EPS]
          Length = 287

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 126/259 (48%), Gaps = 8/259 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           + P       S    A    R++ ++VLP GA EQHGPHLP + D++IA+G+  R    L
Sbjct: 6   IPPHRFLPYLSWTEIAALPDRENTVIVLPCGAIEQHGPHLPCSVDSVIASGVMGRALEKL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +    +P    G S EH++  GT TLT    +     I +++ + G RK++  N HG
Sbjct: 66  PAEVRAFALPTITYGKSEEHLHFPGTMTLTGTTLLSTVTEIGESVYRAGFRKLLFANGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ + + E R+R    V+               IS  E  + +H G  ET++MLAL
Sbjct: 126 GQPQVLEMAARELRLRHGDFVIVPHGVSRLPNASSKQISEQEKRLSMHAGHSETALMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V M+ A              K L A G  +  W+ +D  P GV+G+   AT ++G 
Sbjct: 186 APDTVHMERAAANFPPPFP----IKLLSADGRPACAWTARDFGPSGVIGDPTSATREQGI 241

Query: 237 GLLSYFANCFIQLLNDINS 255
            +L   ++ ++Q L ++++
Sbjct: 242 EILETLSDSWVQALTELHA 260


>gi|157412947|ref|YP_001483813.1| creatininase [Prochlorococcus marinus str. MIT 9215]
 gi|157387522|gb|ABV50227.1| Creatininase [Prochlorococcus marinus str. MIT 9215]
          Length = 262

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 69/255 (27%), Positives = 113/255 (44%), Gaps = 9/255 (3%)

Query: 7   FTDNSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           F   +        K     V+ P GA EQHGPHLP+ TD+I    +   +  + PP +P+
Sbjct: 10  FEYLNWQEIESIAKYKRSTVIWPFGAVEQHGPHLPLATDSIFVDEIISEVFKLFPPDIPI 69

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P + IG+S EH    GT +L+    I     +   + +MG ++++++N HGG   L+
Sbjct: 70  KKLPTQYIGFSPEHKGFAGTISLSSNLIISMIKEVGGQLSEMGFKRLILINGHGGQISLL 129

Query: 125 SIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           +  S E R     + V     WS       +++  E E G+H    ETS+MLAL P LV 
Sbjct: 130 NTASRELRSFAPNIAVFPCFLWSGVDGVSELLTKTEIENGLHASLAETSLMLALKPELVG 189

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
            +        Q       +     G+    W   D +  GV+G++  A    G  L +  
Sbjct: 190 DERPNEIIKGQIP-----EGWSLEGNAPTAWLTDDFSKSGVIGDSRGANANLGNDLKNLL 244

Query: 243 ANCFIQLLNDINSFD 257
              + +L+ ++   D
Sbjct: 245 IGHWYKLIMNLMKSD 259


>gi|238895081|ref|YP_002919816.1| putative creatininase [Klebsiella pneumoniae NTUH-K2044]
 gi|238547398|dbj|BAH63749.1| putative creatininase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 292

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 77/259 (29%), Positives = 127/259 (49%), Gaps = 9/259 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +         S    A    + + ++VLP GA EQHGPHLP + D++I++G+A    + L
Sbjct: 5   IPAARFLPFLSWTDVAALPDKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARL 64

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HG
Sbjct: 65  PATIPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTLLEIAESLYRAGFRKLLMINGHG 124

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I   E R+R    +      ++     +  +S  E  + +H G  ET++MLAL
Sbjct: 125 GQPQILQIACREMRLRHGDFIAIPHDVFNVPNCEKQFLSPHEQRMAMHAGHSETALMLAL 184

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V M+ A      +       K     G  +  W+  D  P GV+G+   AT ++GE
Sbjct: 185 APECVHMERAVANFPPEFPCPTLSK-----GRPAAAWASYDFGPSGVIGDPTPATREQGE 239

Query: 237 GLLSYFANCFIQLLNDINS 255
           GLL   A  + Q + +I+ 
Sbjct: 240 GLLDSLAASWAQAIIEIHR 258


>gi|78212275|ref|YP_381054.1| creatininase [Synechococcus sp. CC9605]
 gi|78196734|gb|ABB34499.1| creatininase [Synechococcus sp. CC9605]
          Length = 280

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 74/262 (28%), Positives = 121/262 (46%), Gaps = 5/262 (1%)

Query: 1   MNPLI-IFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           M+ L   F   + P  + A  +    V+ P GA EQHGP LP++TD + A G+ + +   
Sbjct: 1   MDQLRKRFDQLTWPEASHAACQPGATVIWPFGACEQHGPQLPLSTDAVFADGILDYVLCG 60

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
           L P LP+  +P + IG+S EH    GT +L+    ++    +   +  MG++++V+ NAH
Sbjct: 61  LEPALPIWRLPCQSIGFSPEHKNFPGTISLSAPLLLDLVDQVGTQLAAMGVQRLVLFNAH 120

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
           GG   L+ + + + R R   L V     WS       ++   E   G+H G+ ETS+ML 
Sbjct: 121 GGQIGLLQVAARQLRARCPSLAVLPCFLWSGVEGLADLLPEQELLHGLHAGQAETSLMLQ 180

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           +AP LV      +            +     G+    W   DL+  GV+G+A  A+   G
Sbjct: 181 MAPDLVGSARPVDGRPAPGSAPEPPEGWSLEGAAPCAWLTDDLSATGVIGDARQASADLG 240

Query: 236 EGLLSYFANCFIQLLNDINSFD 257
             L     N + +    + + D
Sbjct: 241 RCLEDRLINHWQKRFQALLTSD 262


>gi|153008705|ref|YP_001369920.1| creatininase [Ochrobactrum anthropi ATCC 49188]
 gi|151560593|gb|ABS14091.1| Creatininase [Ochrobactrum anthropi ATCC 49188]
          Length = 260

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 135/249 (54%), Positives = 176/249 (70%)

Query: 13  PLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPI 72
               D   D IVVLPLGA+EQHGPHLP  TDTIIA G+  R+   LP  L V  +P +P+
Sbjct: 2   TDLRDQNSDMIVVLPLGAHEQHGPHLPFETDTIIAEGIVARVSDALPAELNVNFLPAQPV 61

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           GYSIEHM  +GT++L +AEA+  W+ I + +   GIRK+V+LNAHGGNSPL++IV+TE R
Sbjct: 62  GYSIEHMDTEGTQSLAFAEAVNQWIGIGENLHAGGIRKLVMLNAHGGNSPLMTIVATELR 121

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            R  ML V+TSW+RF +P+G+I+  E  + IHGG IETS+MLAL P LV M  A NFS+ 
Sbjct: 122 TRLDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETSVMLALRPDLVDMSKARNFSNA 181

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           QS +   FK+LRA+G H+FGW M DLNP+GV GNA  AT + GE L++     FI+LL D
Sbjct: 182 QSRYAEEFKFLRAYGPHAFGWKMHDLNPEGVAGNAAAATAEAGERLITNAVTGFIELLRD 241

Query: 253 INSFDVSIF 261
           ++ FD++ F
Sbjct: 242 VDRFDLARF 250


>gi|116075333|ref|ZP_01472593.1| creatininase [Synechococcus sp. RS9916]
 gi|116067530|gb|EAU73284.1| creatininase [Synechococcus sp. RS9916]
          Length = 297

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 75/256 (29%), Positives = 118/256 (46%), Gaps = 5/256 (1%)

Query: 7   FTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
                 P   D  +     VV P GA EQHGPHLP+ TD + A  + +R+ + LP  LP+
Sbjct: 32  LDRLPWPEVVDGLQRPGSTVVWPFGAIEQHGPHLPLATDALFADRMLDRVLAQLPSDLPI 91

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +PV+ +G+S EH    GT +L     I     +   +  +G+R++V+ NAHGG   L+
Sbjct: 92  WRLPVQALGFSPEHAGFPGTLSLPADLLIRLVETVGLQLAALGVRRLVLFNAHGGQIGLL 151

Query: 125 SIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
              + E R +   + V     WS  +  + ++  PE   G+H G  ETS+MLAL P LV 
Sbjct: 152 QAAARELRAQAPGMAVLPCFLWSGVSGLRELLPSPELANGLHAGLAETSLMLALEPSLVG 211

Query: 183 MDLAENFSSRQSEFLR-NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
                +             +     G+    W   DL+  GVVG++  A  + G+ L   
Sbjct: 212 PQRPVDGEHGNPSVAATPPEGWSLEGAAPCAWLTSDLSVSGVVGDSRAANAELGQQLEHR 271

Query: 242 FANCFIQLLNDINSFD 257
             + + +L   + + D
Sbjct: 272 VVDHWQRLFRSLLASD 287


>gi|152970587|ref|YP_001335696.1| putative creatininase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150955436|gb|ABR77466.1| putative creatininase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
          Length = 293

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 77/259 (29%), Positives = 127/259 (49%), Gaps = 9/259 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +         S    A    + + ++VLP GA EQHGPHLP + D++I++G+A    + L
Sbjct: 6   IPAARFLPFLSWTDVAALPDKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HG
Sbjct: 66  PATIPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTLLEIAESLYRAGFRKLMMINGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I   E R+R    +      ++     +  +S  E  + +H G  ET++MLAL
Sbjct: 126 GQPQILQIACREMRLRHGDFIAIPHDVFNVPNCEKQFLSPHEQRMAMHAGHSETALMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V M+ A      +       K     G  +  W+  D  P GV+G+   AT ++GE
Sbjct: 186 APECVHMERAVANFPPEFPCPTLSK-----GRPAAAWASYDFGPSGVIGDPTPATREQGE 240

Query: 237 GLLSYFANCFIQLLNDINS 255
           GLL   A  + Q + +I+ 
Sbjct: 241 GLLDSLAASWAQAIIEIHR 259


>gi|121601642|ref|YP_989369.1| creatininase [Bartonella bacilliformis KC583]
 gi|120613819|gb|ABM44420.1| creatininase [Bartonella bacilliformis KC583]
          Length = 247

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 117/239 (48%), Positives = 163/239 (68%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA+E HG HLP  TD IIA   A+ +      +  +TC+PVE IGYS+EHM + 
Sbjct: 8   LALLPLGAHEYHGDHLPFETDWIIAESFAKALILKTKKQFHITCLPVEKIGYSVEHMDIA 67

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT+TLT+ +AIE W+ I +   + GI+++++LNAHGGNSPL+SIV TE R RFSML V+T
Sbjct: 68  GTQTLTFFDAIERWINIGENCYRKGIKRLLLLNAHGGNSPLMSIVITELRKRFSMLAVAT 127

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW RF +P+G++   +  + IHGG +ETS+ML LAP  V M  A+NF ++Q++ +   KY
Sbjct: 128 SWKRFGLPEGLMEASQHHLDIHGGFLETSLMLYLAPEKVHMKKAKNFHNKQADMIAYHKY 187

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           LRA+G H+FGW M+DLN +G  GNA  AT + GE + S+       LL+DIN F +   
Sbjct: 188 LRAYGPHAFGWIMRDLNAQGAAGNASQATSQAGEAIFSHVLCGLCDLLDDINQFKIDAL 246


>gi|262041751|ref|ZP_06014939.1| creatininase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|259040883|gb|EEW41966.1| creatininase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
          Length = 293

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 77/259 (29%), Positives = 128/259 (49%), Gaps = 9/259 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +         S    A    + + ++VLP GA EQHGPHLP + D++I++G+A    + L
Sbjct: 6   IPAARFLPFLSWTDVAALPDKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HG
Sbjct: 66  PATIPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTLLEIAESLYRAGFRKLLMINGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I   E R+R    +      ++     +  +S  E  + +H G  ET++MLAL
Sbjct: 126 GQPQILQIACREMRLRHGDFIAIPHDVFNVPNCEKQFLSPHEQRMAMHAGHSETALMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V M+ A      +       K     G  +  W+  D  P GV+G+   AT ++GE
Sbjct: 186 APECVHMERAVANFPPEFPCPTLSK-----GRPAAAWASYDFGPSGVIGDPTPATREQGE 240

Query: 237 GLLSYFANCFIQLLNDINS 255
           GLL+  A  + Q + +I+ 
Sbjct: 241 GLLNSLAASWAQAIIEIHR 259


>gi|221069343|ref|ZP_03545448.1| Creatininase [Comamonas testosteroni KF-1]
 gi|220714366|gb|EED69734.1| Creatininase [Comamonas testosteroni KF-1]
          Length = 291

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 96/271 (35%), Positives = 144/271 (53%), Gaps = 7/271 (2%)

Query: 3   PLIIFTDNSLPLCADAR-----KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           P   +   S    A A+      D + VLP+ A EQHGPHLP++ D  +  G+ +   + 
Sbjct: 19  PSRFWAQASAHDFALAQSNGLAADTVAVLPVAAVEQHGPHLPLSVDARLIEGVIDAALAQ 78

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
           LP  LPV  +P + IG+S+EH +  GT +L  A  I  W  +   + + GIRK+++LN H
Sbjct: 79  LPAELPVLFLPPQNIGFSVEHTHYAGTLSLQPATLIALWTELGACVARAGIRKLLLLNGH 138

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISF--PETEIGIHGGEIETSMMLA 175
           GG   ++ IV+ E R+R  +LV S SW           F   E   GIHGGE+ETSM+L 
Sbjct: 139 GGQVSVMDIVARELRIRHGLLVYSASWFGLVDDAANQQFCAHEHRFGIHGGEVETSMLLH 198

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           LAP  V M+ A+NF+S   +    + ++    S   GW+++D NP G VGN+  AT ++G
Sbjct: 199 LAPETVHMERAQNFASSSEQRAGKYHFIGNGRSAKLGWAIEDYNPAGAVGNSAAATAERG 258

Query: 236 EGLLSYFANCFIQLLNDINSFDVSIFDKDVQ 266
             ++   A   + LL +I+   +S      Q
Sbjct: 259 AAMVRSSAQGLVGLLGEIHDLPLSTVGNQPQ 289


>gi|159903075|ref|YP_001550419.1| creatininase [Prochlorococcus marinus str. MIT 9211]
 gi|159888251|gb|ABX08465.1| Creatininase [Prochlorococcus marinus str. MIT 9211]
          Length = 301

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 71/259 (27%), Positives = 120/259 (46%), Gaps = 5/259 (1%)

Query: 3   PLIIFTDNSLPLC--ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
               F   S P    A A+    +V P GA EQHGPHLP+ TD + A  +   +   +P 
Sbjct: 36  DSRHFDYLSSPEASEAAAKDGSTLVWPFGACEQHGPHLPLVTDALFAEEILTEVLDQMPK 95

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             P+  +PV+ IG+S EH+   GT +++    ++    I   +  +GI+++V+ NAHGG 
Sbjct: 96  ETPIWMLPVQKIGFSPEHLGFPGTLSISADLMLQLVSEIGRQLADLGIKRLVLFNAHGGQ 155

Query: 121 SPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
             L+  V+ + R     + V     WS     + +I   E E G+H    ETS+ML++ P
Sbjct: 156 IGLLQAVARQLRAECPSMAVLPCFLWSGIESLKDLIPHREVEEGLHAALAETSLMLSIKP 215

Query: 179 HLVKMDLAENFSSRQSE-FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
            LV +    +      +  +   +     G+    W  KDL+  GV+G++  A    G+ 
Sbjct: 216 ELVGIQRPFDGDENFPKNNISIPEGWSLEGAAPCAWLTKDLSITGVIGDSRGANPDLGDR 275

Query: 238 LLSYFANCFIQLLNDINSF 256
           L +     +  L  ++ + 
Sbjct: 276 LKNALVEHWTSLFINLMNS 294


>gi|124025298|ref|YP_001014414.1| creatininase [Prochlorococcus marinus str. NATL1A]
 gi|123960366|gb|ABM75149.1| Creatininase [Prochlorococcus marinus str. NATL1A]
          Length = 265

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 73/252 (28%), Positives = 114/252 (45%), Gaps = 4/252 (1%)

Query: 10  NSLPLC--ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
            + P    A +     +V P GA EQHGPHLP+ TDT  A  +  +    LP  +P+  M
Sbjct: 1   MTWPEASKAASENGSTLVWPFGACEQHGPHLPLITDTFFAENILIKTLDRLPENMPIWMM 60

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P + IG+S EH    GT +L+    +     +   I  MG  ++V  NAHGG   L+  V
Sbjct: 61  PSQSIGFSPEHQAFPGTLSLSADVLLSMVTDVGQQIASMGFNRLVFFNAHGGQIGLLQAV 120

Query: 128 STEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
           S + R++   + V     WS       ++   E E G+H    ETS+ML +A  LV+ D 
Sbjct: 121 SRQLRIQCPSIAVLPCFLWSGVPELDQLLPEKEVEEGLHAALAETSLMLHMAEDLVRNDS 180

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
                +   + +   K     G+    W  +DL+  GV+G+A  +  + G  L +   + 
Sbjct: 181 YLEIKNVDKQIVTTPKGWSLEGASPCAWLTEDLSSSGVIGDASSSNSELGAALENALVDH 240

Query: 246 FIQLLNDINSFD 257
           +  L   +   D
Sbjct: 241 WKSLFTSLLESD 252


>gi|260435750|ref|ZP_05789720.1| creatininase [Synechococcus sp. WH 8109]
 gi|260413624|gb|EEX06920.1| creatininase [Synechococcus sp. WH 8109]
          Length = 280

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 73/262 (27%), Positives = 119/262 (45%), Gaps = 5/262 (1%)

Query: 1   MNPLI-IFTDNSLPLC--ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           M+ L   F   + P    A ++    V+ P GA EQHGP LP++TD + A G+ + +   
Sbjct: 1   MDQLRKRFDQLTWPEASRAASQPGATVIWPFGACEQHGPQLPLSTDAVFAEGILDSVLRG 60

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
           L P LP+  +P + IG+S EH    GT +L+    ++    +   +  MG++++V+ NAH
Sbjct: 61  LEPALPIWRLPCQAIGFSPEHQNFPGTLSLSAPLLLDLVDQVGTQLAAMGLQRLVLFNAH 120

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
           GG   L+ + + + R     L V     WS       ++   E   G+H G+ ETS+ML 
Sbjct: 121 GGQIGLLQVAARQLRACCPSLAVLPCFLWSGVEGVADLLPEQELAHGLHAGQAETSLMLQ 180

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           +AP LV      +    Q             G+    W   DL+  GV+G+A  A+   G
Sbjct: 181 MAPELVGSARPVDGRPAQGSAQDPPAGWSLEGAAPCAWLTDDLSATGVIGDARQASADLG 240

Query: 236 EGLLSYFANCFIQLLNDINSFD 257
             L       + +    + + D
Sbjct: 241 RCLQDRLIKHWQERFQTLLASD 262


>gi|206576363|ref|YP_002238129.1| creatininase [Klebsiella pneumoniae 342]
 gi|206565421|gb|ACI07197.1| creatininase [Klebsiella pneumoniae 342]
          Length = 293

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 77/259 (29%), Positives = 127/259 (49%), Gaps = 9/259 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +         S    A    + + ++VLP GA EQHGPHLP + D++I++G+A    + L
Sbjct: 6   IPAARFLPFLSWTDVAALPDKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HG
Sbjct: 66  PAAIPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTVLEIAESLYRAGFRKLLMINGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I   E R+R    +      ++     +  +S  E  + +H G  ET++MLAL
Sbjct: 126 GQPQILQIACREMRLRHGDFIAIPHDVFNVPNCEKQFLSPHEQRMAMHAGHSETALMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V M+ A      +       K     G  +  W+  D  P GV+G+   AT ++GE
Sbjct: 186 APECVHMERAAANFPPEFPCPTLSK-----GRPAAAWASYDFGPSGVIGDPTPATREQGE 240

Query: 237 GLLSYFANCFIQLLNDINS 255
           GLL   A  + Q + +I+ 
Sbjct: 241 GLLDSLAASWAQAIIEIHR 259


>gi|110677921|ref|YP_680928.1| creatinine amidohydrolase [Roseobacter denitrificans OCh 114]
 gi|109454037|gb|ABG30242.1| creatinine amidohydrolase [Roseobacter denitrificans OCh 114]
          Length = 259

 Score =  221 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 83/257 (32%), Positives = 123/257 (47%), Gaps = 3/257 (1%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M  +I + D   P      +  I VLP+GA EQHGPHL ++ D+ +   +  R    +  
Sbjct: 1   MVGVIYWEDLRAPDFKSLPERAIAVLPMGASEQHGPHLAVSVDSDLVEAVLART--QVAD 58

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V  +P   +  S EH    GT +LT    +     I  ++ + GI ++ + N HGGN
Sbjct: 59  GCTVLVLPTLRVTKSAEHDRHPGTLSLTGDTLLAVLRDIAASVHRAGIDRLCLFNGHGGN 118

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           + L+ +   + R+   M+ V   W  F   Q         + +HGG+IETS MLA AP  
Sbjct: 119 TALLEVAVRDMRITHDMIAVHCGWFGFAQAQAHFDAQALAMDVHGGDIETSAMLAAAPEK 178

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M  A +F     ++ + +  L    +   GW + DLN  G  GNA  ATV+KGE LLS
Sbjct: 179 VDMAKARDFRPAMQDWPQKWIGLTGQVARP-GWLIDDLNADGACGNAAAATVEKGEALLS 237

Query: 241 YFANCFIQLLNDINSFD 257
             A  F   L ++ +FD
Sbjct: 238 SAARNFSDFLGELAAFD 254


>gi|290509177|ref|ZP_06548548.1| creatininase [Klebsiella sp. 1_1_55]
 gi|289778571|gb|EFD86568.1| creatininase [Klebsiella sp. 1_1_55]
          Length = 293

 Score =  221 bits (564), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 77/259 (29%), Positives = 127/259 (49%), Gaps = 9/259 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +         S    A    + + ++VLP GA EQHGPHLP + D++I++G+A    + L
Sbjct: 6   IPAARFLPFLSWTDVAALPDKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HG
Sbjct: 66  PAAIPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTLLEIAESLYRAGFRKLLMINGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I   E R+R    +      ++     +  +S  E  + +H G  ET++MLAL
Sbjct: 126 GQPQILQIACREMRLRHGDFIAIPHDVFNVPNCEKQFLSPHEQRMTMHAGHSETALMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V M+ A      +       K     G  +  W+  D  P GV+G+   AT ++GE
Sbjct: 186 APECVHMERAVANFPPEFPCPTLSK-----GRPAAAWASYDFGPSGVIGDPTPATREQGE 240

Query: 237 GLLSYFANCFIQLLNDINS 255
           GLL   A  + Q + +I+ 
Sbjct: 241 GLLDSLAASWAQAIIEIHR 259


>gi|299531303|ref|ZP_07044713.1| Creatininase [Comamonas testosteroni S44]
 gi|298720710|gb|EFI61657.1| Creatininase [Comamonas testosteroni S44]
          Length = 291

 Score =  221 bits (564), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 96/271 (35%), Positives = 145/271 (53%), Gaps = 7/271 (2%)

Query: 3   PLIIFTDNSLPLCADAR-----KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           P   +   S    A A+      D + VLP+ A EQHGPHLP++ D  +  G+ +   + 
Sbjct: 19  PSRFWAQASAHDFALAQNNGLAADTVAVLPVAAVEQHGPHLPLSVDASLIEGVIDAALAQ 78

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
           LP  LPV  +P + IG+S+EH +  GT +L  A  I  W  +   + + GIRK+++LN H
Sbjct: 79  LPAELPVLFLPAQNIGFSVEHTHYAGTLSLQPATLIALWTELGACVARAGIRKLLLLNGH 138

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISF--PETEIGIHGGEIETSMMLA 175
           GG   ++ IV+ E R++  +LV S SW           F   E   GIHGGE+ETSMML 
Sbjct: 139 GGQVSVMDIVARELRIKHGLLVYSASWFGLVDDAANQQFCAHEHRFGIHGGEVETSMMLH 198

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           LAP  V M+ A+NF+S        + ++    S   GW+++D NP G VGN+  AT ++G
Sbjct: 199 LAPETVHMERAQNFASSSELRAGKYHFIGNGRSAKLGWAIEDYNPAGAVGNSAAATAERG 258

Query: 236 EGLLSYFANCFIQLLNDINSFDVSIFDKDVQ 266
             ++   A   ++LL++I+   +S      Q
Sbjct: 259 AAMVHSSAEGLVRLLSEIHDLPLSTVGNQPQ 289


>gi|288935107|ref|YP_003439166.1| creatinase [Klebsiella variicola At-22]
 gi|288889816|gb|ADC58134.1| Creatininase [Klebsiella variicola At-22]
          Length = 293

 Score =  221 bits (564), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 77/258 (29%), Positives = 127/258 (49%), Gaps = 9/258 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +         S    A    + + ++VLP GA EQHGPHLP + D++I++G+A    + L
Sbjct: 6   IPAARFLPFLSWTDVAALPDKSNTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +P   +P    G S EH++  GT TL+    +   L I +++ + G RK++++N HG
Sbjct: 66  PAAIPAYAIPPIVYGKSEEHLHFPGTLTLSGDTLLHTLLEIAESLYRAGFRKLLMINGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ I   E R+R    +      ++     +  +S  E  + +H G  ET++MLAL
Sbjct: 126 GQPQILQIACREMRLRHGDFIAIPHDVFNVPNCEKQFLSPHEQRMAMHAGHSETALMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V M+ A      +       K     G  +  W+  D  P GV+G+   AT ++GE
Sbjct: 186 APECVHMERAVANFPPEFPCPTLSK-----GRPAAAWASYDFGPSGVIGDPTPATREQGE 240

Query: 237 GLLSYFANCFIQLLNDIN 254
           GLL   A  + Q + +I+
Sbjct: 241 GLLDSLAASWAQAIIEIH 258


>gi|116072200|ref|ZP_01469467.1| creatininase [Synechococcus sp. BL107]
 gi|116064722|gb|EAU70481.1| creatininase [Synechococcus sp. BL107]
          Length = 281

 Score =  221 bits (563), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 74/258 (28%), Positives = 117/258 (45%), Gaps = 4/258 (1%)

Query: 4   LIIFTDNSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
              F   + P    A K     V+ P GA EQHGP LP+ TD + A  +   +   L   
Sbjct: 13  RRHFDQLAWPEAEKAAKQAGATVIWPFGACEQHGPQLPLATDALFADRILNSVLQHLDGE 72

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
            P+  +P++ IG+S EH    GT +L+    ++    +   +  MG+ ++V+LNAHGG  
Sbjct: 73  WPIWRLPLQSIGFSPEHQPFPGTLSLSAELMLQLVDQVGGQLAAMGVERLVLLNAHGGQI 132

Query: 122 PLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
            L+ + + + R+R   + V     WS       ++   E   G+H G+ ETS+ML +AP 
Sbjct: 133 GLLQVAARQLRLRCPSMGVLPCFLWSGVDGLSSLLPPEELAQGLHAGQAETSLMLHMAPE 192

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV      +     S  L         G+    W   DL+  GV+G+A  A+ + G  L 
Sbjct: 193 LVGPSRPVDGDHGPSSPLAPPDGWSLEGAAPCAWLTSDLSQSGVIGDARLASAELGLELE 252

Query: 240 SYFANCFIQLLNDINSFD 257
               + + QL   + S D
Sbjct: 253 QALISHWTQLFKSLLSSD 270


>gi|222869508|gb|EEF06639.1| predicted protein [Populus trichocarpa]
          Length = 386

 Score =  221 bits (563), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 91/251 (36%), Positives = 138/251 (54%), Gaps = 2/251 (0%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
              + I VLP+ A EQHGPHLP++ D  +  G+ +    +LPP LPV  +P + IG+S+E
Sbjct: 134 LAAETIAVLPVAAVEQHGPHLPLSVDARLLQGVIDAALPLLPPELPVLFLPPQNIGFSVE 193

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           H    GT TL+ A  I  W  +   + + G+R++++LN HGG   ++ IV+ E RMR  +
Sbjct: 194 HQSFAGTLTLSPATVIALWTELGACVARAGVRRLLLLNGHGGQVSVMDIVARELRMRHGL 253

Query: 138 LVVSTSWSRFTI--PQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
           LV S+SW            S  E   GIHGGE+ETSMML LAP  V+M+ A +F S   +
Sbjct: 254 LVYSSSWFGLVDDAANAQFSAHEHRFGIHGGEVETSMMLHLAPETVRMEHARDFHSTSQD 313

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
             +    L    S   GW+++D N  G VGNA  AT ++G  ++   A   ++LL+++ +
Sbjct: 314 RAQRHALLGNGRSAKMGWAIEDYNVCGAVGNAAGATAERGALMVEASARGLVRLLSEMVA 373

Query: 256 FDVSIFDKDVQ 266
                  +  +
Sbjct: 374 LPADTVGRAPE 384


>gi|264676550|ref|YP_003276456.1| creatininase [Comamonas testosteroni CNB-2]
 gi|262207062|gb|ACY31160.1| Creatininase [Comamonas testosteroni CNB-2]
          Length = 291

 Score =  221 bits (563), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 96/271 (35%), Positives = 145/271 (53%), Gaps = 7/271 (2%)

Query: 3   PLIIFTDNSLPLCADAR-----KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           P   +   S    A A+      D + VLP+ A EQHGPHLP++ D  +  G+ +   + 
Sbjct: 19  PSRFWAQASAHDFALAQSNGLAADTVAVLPVAAVEQHGPHLPLSVDASLIEGVIDAALAQ 78

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
           LP  LPV  +P + IG+S+EH +  GT +L  A  I  W  +   + + GIRK+++LN H
Sbjct: 79  LPAELPVLFLPAQNIGFSVEHTHYAGTLSLQPATLIALWTELGACVARAGIRKLLLLNGH 138

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISF--PETEIGIHGGEIETSMMLA 175
           GG   ++ IV+ E R++  +LV S SW           F   E   GIHGGE+ETSMML 
Sbjct: 139 GGQVSVMDIVARELRIKHGLLVYSASWFGLVDDAANQQFCAHEHRFGIHGGEVETSMMLH 198

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           LAP  V M+ A+NF+S        + ++    S   GW+++D NP G VGN+  AT ++G
Sbjct: 199 LAPETVHMERAQNFASSSELRAGKYHFIGNGRSAKLGWAIEDYNPAGAVGNSAAATAERG 258

Query: 236 EGLLSYFANCFIQLLNDINSFDVSIFDKDVQ 266
             ++   A   ++LL++I+   +S      Q
Sbjct: 259 AAMVHSSAEGLVRLLSEIHDLPLSTVGNQPQ 289


>gi|33861088|ref|NP_892649.1| creatininase [Prochlorococcus marinus subsp. pastoris str.
           CCMP1986]
 gi|33639820|emb|CAE18990.1| Creatininase [Prochlorococcus marinus subsp. pastoris str.
           CCMP1986]
          Length = 265

 Score =  221 bits (563), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 71/255 (27%), Positives = 117/255 (45%), Gaps = 9/255 (3%)

Query: 7   FTDNSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           F   S P   +  KD    ++ P GA EQHGPHLP+ TD+I    +   +  ++P   P+
Sbjct: 10  FEYLSWPEVKNISKDIRSTIIWPFGAVEQHGPHLPLGTDSIFVDEIICEVFKLIPSDTPI 69

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P + IG+S EH   DGT +L+          +   +  MG ++++++NAHGG   L+
Sbjct: 70  KKLPTQYIGFSPEHKGFDGTISLSSNLITLLIKEVGIQLADMGFKRLILINAHGGQISLL 129

Query: 125 SIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           +  + E R     L +     W        +++  E E G+H    ETS+M+AL   LV 
Sbjct: 130 NTAARELRSVAPKLSIFPCFLWKGVDGLSELLTKDEIENGLHASLAETSLMMALKSKLVG 189

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
            +        Q       K     G+    W  +DL+  GV+GN+  +  + G  L S  
Sbjct: 190 DERPCEGIKMQIP-----KGWSLEGNAPTAWFTEDLSKSGVIGNSKGSNKELGNSLKSLL 244

Query: 243 ANCFIQLLNDINSFD 257
            N + +L+ ++   D
Sbjct: 245 VNHWFKLIMNLMKSD 259


>gi|254526539|ref|ZP_05138591.1| creatininase [Prochlorococcus marinus str. MIT 9202]
 gi|221537963|gb|EEE40416.1| creatininase [Prochlorococcus marinus str. MIT 9202]
          Length = 262

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 68/255 (26%), Positives = 111/255 (43%), Gaps = 9/255 (3%)

Query: 7   FTDNSLPLCA--DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           F   +          K   V+ P GA EQHGPHLP+ TD+I    +   +  +     P+
Sbjct: 10  FEYLNWEEIECVAKNKRSTVIWPFGAVEQHGPHLPLATDSIFVDEIIGEVLKLFSADFPL 69

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P + IG+S EH    GT +L+          +   + +MG ++++++N HGG   L+
Sbjct: 70  KKLPTQYIGFSPEHKGFAGTISLSSNLITSMIKEVGGQLSEMGFKRLILINGHGGQISLL 129

Query: 125 SIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           +  + E R     + V     WS       +++  E E G+H    ETS+MLAL P LV 
Sbjct: 130 NTAARELRSVVPEMTVFPCFLWSGVDGLSELLTKTEIEYGLHASLAETSLMLALKPELVG 189

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
            +        Q       +     GS    W   DL+  GV+G++  A    G+ L    
Sbjct: 190 DERPNEVIKGQIP-----EGWSLEGSAPTAWLTDDLSKSGVIGDSRGANESLGKNLKELL 244

Query: 243 ANCFIQLLNDINSFD 257
            N + +L+ ++   D
Sbjct: 245 INHWFKLIMNLMQSD 259


>gi|160896038|ref|YP_001561620.1| creatininase [Delftia acidovorans SPH-1]
 gi|160361622|gb|ABX33235.1| Creatininase [Delftia acidovorans SPH-1]
          Length = 287

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 95/271 (35%), Positives = 144/271 (53%), Gaps = 7/271 (2%)

Query: 3   PLIIFTDNSLPLCADARK-----DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           P   + + S    A A+      + I VLP+ A EQHGPHLP++ D  +  G+ +    +
Sbjct: 15  PSRWWAEASARDFAQAQASGLAAETIAVLPVAAVEQHGPHLPLSVDARLLQGVIDAALPL 74

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
           LPP LP   +P + IG+S+EH    GT TL+ A  I  W  +   + + G+R++++LN H
Sbjct: 75  LPPELPALFLPPQNIGFSVEHQSFAGTLTLSPATVIALWTELGACVARAGVRRLLLLNGH 134

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTSWSRFTI--PQGIISFPETEIGIHGGEIETSMMLA 175
           GG   ++ IV+ E RMR  +LV S+SW            S  E   GIHGGE+ETSMML 
Sbjct: 135 GGQVSVMDIVARELRMRHGLLVYSSSWFGLVDDAANAHFSAHEHRFGIHGGEVETSMMLH 194

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           LAP  V+M+ A +F S   +  +    L    S   GW+++D N  G VGNA  AT ++G
Sbjct: 195 LAPESVRMEHARDFHSTSEDRAQRHALLGNGRSAKMGWAIEDYNVCGAVGNAAGATAERG 254

Query: 236 EGLLSYFANCFIQLLNDINSFDVSIFDKDVQ 266
             ++   A   ++LL++I +       +  +
Sbjct: 255 ALMVEASARGLVRLLSEIVALPADTVGRAPE 285


>gi|251800096|ref|YP_003014827.1| creatininase [Paenibacillus sp. JDR-2]
 gi|247547722|gb|ACT04741.1| Creatininase [Paenibacillus sp. JDR-2]
          Length = 268

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 74/263 (28%), Positives = 117/263 (44%), Gaps = 6/263 (2%)

Query: 3   PLIIFTDNSLPLCADARKDWIV-VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
                   +    A   KD ++ VLP+GA EQHGPH+P+ TDT++   +  +    LP  
Sbjct: 11  DRRFLPRLTTKEIAAMNKDDVLLVLPIGAVEQHGPHMPVFTDTLLGEAMLTKAFEHLPED 70

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
             +  +P    G S EH    GT TL+    +     I  ++ + G RK+++ N HGGN+
Sbjct: 71  SSIWLLPSVSYGKSTEHAGHPGTITLSAKTLMAVLEDISSSLARSGFRKLLLFNTHGGNA 130

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            L+ +++ E R+   + V                  E   GIH G++ETS+++A  P  V
Sbjct: 131 DLLGMMAREIRIATGLEVYRLDPGAVGYSDSFTDEAEKACGIHAGDVETSLVMATCPGWV 190

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
             +LA     R  +         +  S SF W M D++  GV G+A  AT  +G  +L  
Sbjct: 191 HAELAPREMPRFPD-----SRYFSFRSRSFAWVMDDISGSGVAGDATKATADRGTAMLET 245

Query: 242 FANCFIQLLNDINSFDVSIFDKD 264
                 + L  I SF ++     
Sbjct: 246 AGPLLAEALLHIASFGMASLKNG 268


>gi|78185203|ref|YP_377638.1| creatininase [Synechococcus sp. CC9902]
 gi|78169497|gb|ABB26594.1| creatininase [Synechococcus sp. CC9902]
          Length = 284

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 73/258 (28%), Positives = 115/258 (44%), Gaps = 4/258 (1%)

Query: 4   LIIFTDNSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
              F   + P    A K     VV P GA EQHGP LP+ TD + A  +   +   L   
Sbjct: 13  KRRFDQLAWPEAEKAAKQAGATVVWPFGACEQHGPQLPLATDALFADRILNSVLEHLDGE 72

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
            P+  +P++ IG+S EH    GT +L+    ++    +   +  MG+ ++V+LNAHGG  
Sbjct: 73  WPIWRLPLQSIGFSPEHQPFPGTLSLSAELMLQLVDQVGGQLAAMGVERLVLLNAHGGQI 132

Query: 122 PLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
            L+ + + + R+R   + V     WS       ++   E   G+H G+ ETS+ML +AP 
Sbjct: 133 GLLQVAARQLRLRCPSMGVLPCFIWSGVDGLSSLLPPEELAHGLHAGQAETSLMLHMAPE 192

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV      + +      L         G+    W   DL+  GV+G+A  A+ + G  L 
Sbjct: 193 LVGPSRPVDGAHGPRSALAPPDGWSLEGAAPCAWLTSDLSQSGVIGDARLASAELGLELE 252

Query: 240 SYFANCFIQLLNDINSFD 257
                 + Q    + S D
Sbjct: 253 QALILHWTQRFKSLLSSD 270


>gi|221070039|ref|ZP_03546144.1| Creatininase [Comamonas testosteroni KF-1]
 gi|220715062|gb|EED70430.1| Creatininase [Comamonas testosteroni KF-1]
          Length = 285

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 76/266 (28%), Positives = 125/266 (46%), Gaps = 8/266 (3%)

Query: 2   NPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
                    S    A    + + ++VLP+GA EQHGPHLP + D  IAAG+     + LP
Sbjct: 7   PADRFLPYLSWTEVAALPDKANTVIVLPVGAMEQHGPHLPCSVDATIAAGVVGAAMAQLP 66

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             +P   M     G S EH++  GT TL+    +     I +++ + G RK++ +N HGG
Sbjct: 67  AAVPAFAMAPIVYGKSEEHLHFPGTVTLSGETLLATINEIGESVYRAGFRKLLFVNGHGG 126

Query: 120 NSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
              ++ I + E R+R    +V  S  W    +    +S  E ++ +H G  ET++MLALA
Sbjct: 127 QPQVLEIAARELRLRHGDFIVVPSFTWRVPHVAGQYLSNLEKKLAMHAGHAETALMLALA 186

Query: 178 PHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
           P  V M+ A                L   G  +  W+ +D  P GV+G+   AT ++G+ 
Sbjct: 187 PQTVHMERAVINYPPVFP----SSLLSPDGRPACAWTARDFGPSGVIGDPTPATAEQGQE 242

Query: 238 LLSYFANCFIQLLNDINSFDVSIFDK 263
           +L   A  +   + +++    +  D+
Sbjct: 243 ILQSLARSWAAAIAELHELQWASRDE 268


>gi|123965830|ref|YP_001010911.1| creatininase [Prochlorococcus marinus str. MIT 9515]
 gi|123200196|gb|ABM71804.1| Creatininase [Prochlorococcus marinus str. MIT 9515]
          Length = 262

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 70/255 (27%), Positives = 117/255 (45%), Gaps = 9/255 (3%)

Query: 7   FTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           F   S P   +    K   ++ P GA EQHGPHLP+ TD+I    +   +  ++P   P+
Sbjct: 10  FEYLSWPEVKNISKEKRSTIIWPFGAVEQHGPHLPLATDSIFVDEIICEVLKLIPSETPI 69

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P + IG+S EH   DGT +L+          +   +  MG +++V++NAHGG   L+
Sbjct: 70  KKLPTQYIGFSPEHKGFDGTISLSSNLITLMIKEVGSQLADMGFKRLVLINAHGGQISLL 129

Query: 125 SIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           +  + E R     L V     WS       +++  E E G+H    ETS+M+AL   LV 
Sbjct: 130 NTAARELRSIAPKLSVFPCFLWSGVDGLSELLTKKEIENGLHASLAETSLMMALKSDLVG 189

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
            +       +Q       +     G+    W   DL+  GV+G++  +  + G  L +  
Sbjct: 190 EERPFEEIEKQIP-----EGWSLEGNAPTAWFTDDLSKSGVIGDSRGSNKELGITLKTLL 244

Query: 243 ANCFIQLLNDINSFD 257
            N +  ++N++   D
Sbjct: 245 TNHWYNMINNLMQSD 259


>gi|49475992|ref|YP_034033.1| hypothetical protein BH12970 [Bartonella henselae str. Houston-1]
 gi|49238800|emb|CAF28071.1| hypothetical protein BH12970 [Bartonella henselae str. Houston-1]
          Length = 246

 Score =  218 bits (555), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 117/239 (48%), Positives = 165/239 (69%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           + +LPLGA+E HG HLP  TD IIA   A+ +      +  +  +PVE IGYSIEHM V 
Sbjct: 8   LALLPLGAHEYHGDHLPFETDWIIAEAFAKALTVKTKKQFHIALLPVEKIGYSIEHMDVS 67

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT+TLT++EAIE W+ I +   + GI++ ++LNAHGGNSPL+SIV TE R RFSML V+T
Sbjct: 68  GTQTLTFSEAIERWINIGEDCYRKGIKRFLLLNAHGGNSPLMSIVITELRKRFSMLAVAT 127

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
           SW+RF +P G++   +  + IHGG IETS+ML LAP  V M+ A+NF ++Q++ + N++Y
Sbjct: 128 SWTRFGLPHGLMHPSQHHLDIHGGFIETSLMLYLAPEKVHMEKAKNFYNKQADMIANYQY 187

Query: 203 LRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           LRA+G H+FGW+M+DLN +G  G A +AT + G+ + S+       LL+DIN F +   
Sbjct: 188 LRAYGPHAFGWTMRDLNLQGAAGKAREATSQAGKAIFSHVLGGLRGLLDDINRFKIDAL 246


>gi|113953826|ref|YP_731194.1| creatininase [Synechococcus sp. CC9311]
 gi|113881177|gb|ABI46135.1| creatininase [Synechococcus sp. CC9311]
          Length = 275

 Score =  218 bits (555), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 74/259 (28%), Positives = 119/259 (45%), Gaps = 5/259 (1%)

Query: 4   LIIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
                  S P    A +     VV P+GA+EQHGPHLP+ TD + +  +   + S L P 
Sbjct: 6   TRRLDKLSWPEAEKALQHSSSTVVWPMGAFEQHGPHLPLATDALFSERILSSVLSELAPN 65

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
            P+  +P + IG+S EH    GT +L+     +  L +   +   G++++V+ NAHGG  
Sbjct: 66  APIWSLPSQSIGFSPEHSGFPGTLSLSSGLLTQLILEVGKQLCTQGVKRLVLFNAHGGQI 125

Query: 122 PLVSIVSTEARMRFSMLVVS--TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
            L+   + E R++   + +     WS       +I   E   G+H  + ETS+MLAL P 
Sbjct: 126 GLLQAAARELRVQSPSMAILPCFMWSGVPGLDALIPGDELTGGLHAAQAETSLMLALEPE 185

Query: 180 LVKMDLAENFSSRQS-EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
           LV      +   RQ              G+    W   DL+  GV+G++  A+++ GE L
Sbjct: 186 LVGEARPVDGDHRQPSSLATPPPGWSLEGAAPTAWLTTDLSNSGVIGDSRAASIECGEAL 245

Query: 239 LSYFANCFIQLLNDINSFD 257
            S     ++ L   + + D
Sbjct: 246 ESCLVRHWVHLFGSLLASD 264


>gi|87123921|ref|ZP_01079771.1| creatininase [Synechococcus sp. RS9917]
 gi|86168490|gb|EAQ69747.1| creatininase [Synechococcus sp. RS9917]
          Length = 277

 Score =  217 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 76/263 (28%), Positives = 120/263 (45%), Gaps = 6/263 (2%)

Query: 1   MN-PLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           M  P       + P       R+   +V P GA EQHGP LP+ TD + A  +   +   
Sbjct: 1   MPKPQRRLDRLAWPEVRTGLLREGATLVWPFGACEQHGPQLPLATDALFAERILAAVLER 60

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
           LP  LPV  +PV+PIG+S EH+   GT +L+    +     +   +   G++++V+LNAH
Sbjct: 61  LPDALPVWSLPVQPIGFSPEHLGFAGTLSLSAELLMRLVEEVGCQLADAGVQRLVLLNAH 120

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
           GG   L+   +   R     L V     W+       +I  PE + G+H G  ETS+ML 
Sbjct: 121 GGQIALLQTAARSLRASRPALAVLPCFLWAGVDGIGDLIPAPELQTGLHAGLAETSLMLQ 180

Query: 176 LAPHLVKMDLAENFSSRQSEFL-RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKK 234
           LAP LV  +   +   ++ +            G   + W  +DL+  GV+G++  A+   
Sbjct: 181 LAPDLVGSERPVDGEHQRVDAAVTPPAGWSLEGDAPWAWMSRDLSDSGVIGDSRGASRLL 240

Query: 235 GEGLLSYFANCFIQLLNDINSFD 257
           G  L +   N +   L  + + D
Sbjct: 241 GAALETALVNHWCDRLERLLASD 263


>gi|319407527|emb|CBI81175.1| creatinine amidohydrolase [Bartonella sp. 1-1C]
          Length = 247

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 117/233 (50%), Positives = 158/233 (67%)

Query: 29  GAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLT 88
           GA+E HG HLP  TD IIA   A+ +      +  +T +PVE IGYS+EHM V GT+TLT
Sbjct: 14  GAHEYHGNHLPFETDWIIAESFAKALTLETKEQFQITLLPVEKIGYSVEHMNVIGTQTLT 73

Query: 89  YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFT 148
           ++ AIE W+ I +     GIR+ +ILNAHGGN+PL++IV TE R RFSML V+TSWSRF 
Sbjct: 74  FSGAIERWINIGEHCYHKGIRRFLILNAHGGNAPLMNIVITELRKRFSMLAVATSWSRFG 133

Query: 149 IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGS 208
           +P+G++   +  + IHGG IETS+ML LAP  V M+  ENF ++Q+E ++N++YLRA+G 
Sbjct: 134 LPKGLMDPSQIHLDIHGGFIETSLMLYLAPEKVHMEKTENFHNKQAEMIQNYQYLRAYGP 193

Query: 209 HSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           H+FGW M DLN +GV GNA  AT + GE + S+       LL+DI  F +   
Sbjct: 194 HAFGWMMHDLNEQGVAGNASQATAQAGEAIFSHVLCGLRALLDDIKKFKIDAL 246


>gi|90655435|gb|ABD96276.1| creatininase [uncultured marine type-A Synechococcus GOM 3M9]
          Length = 273

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 80/262 (30%), Positives = 123/262 (46%), Gaps = 10/262 (3%)

Query: 1   MNPL-IIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           M P    F   S P    A  +    VV P GA EQHGP LP+ TD + A  + + +   
Sbjct: 3   MPPRDCRFDHLSWPAATAAMQQPGATVVWPFGACEQHGPQLPLATDALFAERILDAVLLG 62

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
           L P LP+  +PV+ IG+S EH    GT +L     I     + + +   G+R++V+ NAH
Sbjct: 63  LDPLLPIWRLPVQAIGFSPEHASFPGTLSLPADLLIALVDRVGEQLADQGVRRLVLFNAH 122

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
           GG   L+ + + + R+R   + V     WS      G+IS  E E G+H  E ETS+ML 
Sbjct: 123 GGQIALLQVAARQLRVRCPQMAVLPCFLWSGVDGLSGLISEAELEQGLHAAEAETSLMLR 182

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           LAP LV  +   +     +            G+    W  +DL+  GV+G++  A+V+ G
Sbjct: 183 LAPELVGPERPVDGLPPAAPG-----DWSLEGAAPCAWLARDLSASGVIGDSRSASVELG 237

Query: 236 EGLLSYFANCFIQLLNDINSFD 257
             L       +++    + + D
Sbjct: 238 GRLEERLVEHWLRQFKALLASD 259


>gi|319404535|emb|CBI78139.1| creatinine amidohydrolase [Bartonella rochalimae ATCC BAA-1498]
          Length = 247

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 116/233 (49%), Positives = 158/233 (67%)

Query: 29  GAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLT 88
           GA+E HG HLP  TD IIA   A+ +      +  +T +PVE IGYS+EHM V GT+TLT
Sbjct: 14  GAHEYHGNHLPFETDWIIAESFAKALTLETKEQFQITLLPVEKIGYSVEHMNVIGTQTLT 73

Query: 89  YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFT 148
           ++ AIE W+ I +     GIR+ +ILNAHGGN+PL++IV TE R RFSML V+TSWSRF 
Sbjct: 74  FSGAIERWINIGEHCYHKGIRRFLILNAHGGNAPLMNIVITELRKRFSMLAVATSWSRFG 133

Query: 149 IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGS 208
           +P+G++   +  + IHGG IETS+ML LAP  V M+  ENF ++Q+E ++N++YLRA+G 
Sbjct: 134 LPEGLMDPSQIHLDIHGGFIETSLMLYLAPEKVHMEKTENFHNKQAEMIQNYQYLRAYGP 193

Query: 209 HSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIF 261
           H+FGW M DLN +GV GNA  AT + G+ + S+       LL+DI  F +   
Sbjct: 194 HAFGWMMHDLNEQGVAGNASQATAQAGKAIFSHVLCGLRALLDDIKKFKIDAL 246


>gi|92113298|ref|YP_573226.1| creatininase [Chromohalobacter salexigens DSM 3043]
 gi|91796388|gb|ABE58527.1| Creatininase [Chromohalobacter salexigens DSM 3043]
          Length = 277

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 87/257 (33%), Positives = 134/257 (52%), Gaps = 1/257 (0%)

Query: 7   FTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
           +   S P  A     + + +LPLGA EQHG HLP++TD  IA GL    ++ +   + + 
Sbjct: 16  WASLSSPELAARVTPESVALLPLGAVEQHGAHLPLSTDVDIADGLVAAARAHVARDIELL 75

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
            +P   +G S+EH    GT +L    AI H + I  ++ + GIR++V+ N+HGGN  +V 
Sbjct: 76  VLPTVAVGASMEHGDFAGTLSLAPETAIAHLVEIGASVARAGIRRLVLFNSHGGNKAVVD 135

Query: 126 IVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
           + +   R R  +LVV  ++ RF  P   +   E   G+HGG +ET+MM+ LAPH V+   
Sbjct: 136 LAALTLRERHGLLVVKANYFRFAPPDDALPAEELRHGLHGGALETAMMMHLAPHKVRHAH 195

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
                S  +   +    L   G   F W  +DL+P GVVG+A  AT   GE L+++FA  
Sbjct: 196 LGEAVSLGARQEQTGHGLLPEGDAGFAWLAQDLHPDGVVGDARLATPALGERLVAHFAAR 255

Query: 246 FIQLLNDINSFDVSIFD 262
              ++     FD++   
Sbjct: 256 LAAVVEAAACFDLTQLG 272


>gi|237653126|ref|YP_002889440.1| creatininase [Thauera sp. MZ1T]
 gi|237624373|gb|ACR01063.1| Creatininase [Thauera sp. MZ1T]
          Length = 275

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 88/261 (33%), Positives = 130/261 (49%), Gaps = 1/261 (0%)

Query: 2   NPLIIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
             L  + D +    A  AR D + +LPL A EQHG HLP++TD  IA GL E +   L  
Sbjct: 5   PALPWWQDLTPSRIAGLARADAVALLPLAAIEQHGEHLPLSTDLDIALGLLEAVVPKLRA 64

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LP+  +P   +G S+EH    GT  L    A+   + I   + + G+R++V+ N HGGN
Sbjct: 65  GLPLCVLPPVAVGCSLEHTGFAGTLALDAKTALASVVQIGACVARAGLRRLVLFNTHGGN 124

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
             LV + + E R    MLVV     RF  P   +   E   G+HGG +ET++M+ LAPH 
Sbjct: 125 KALVDLAALELRAAQRMLVVRAHSFRFPPPPAALPADELRDGLHGGALETALMMHLAPHK 184

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+ D  + F S         + L   G   F W  +DL+P G  G+   A    G  L+ 
Sbjct: 185 VRRDAVDRFESLGVRMAAAGRLLGPEGEAGFAWMAQDLHPSGACGDPRLADAALGARLVE 244

Query: 241 YFANCFIQLLNDINSFDVSIF 261
           +FA+   +++ + + FD+   
Sbjct: 245 HFASRLARIVEEAHDFDLEAL 265


>gi|326319116|ref|YP_004236788.1| Creatininase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323375952|gb|ADX48221.1| Creatininase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 307

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 93/274 (33%), Positives = 139/274 (50%), Gaps = 9/274 (3%)

Query: 1   MN-PLIIFTDNSLPLCADARK-----DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI 54
           M  P   + + S    ++AR        + VLP+ A EQHGPHLP++ D  +  G+ +  
Sbjct: 32  MPYPSRFWAELSTRDFSEARASGLAARTVAVLPVAAIEQHGPHLPLSVDAALLRGVIDAA 91

Query: 55  KSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVIL 114
             +LPP LPV  +P + +G S EH    GT TL+ +  I  W  +   + + G++K+++ 
Sbjct: 92  LPLLPPDLPVLFLPPQDVGLSTEHTAFPGTLTLSPSTVIALWSELGACVARAGVKKLLLF 151

Query: 115 NAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQ---GIISFPETEIGIHGGEIETS 171
           N HGG   ++ IV+ E R R  +LV S SW    +P+   G+ S  E   GIH G+IETS
Sbjct: 152 NGHGGQVSVMDIVARELRQRHGLLVYSASWFSLPLPEAVQGLFSAEEHRFGIHAGQIETS 211

Query: 172 MMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDAT 231
           MML LAP+ V+M  A  F S   +    +  L    S   GW+++D +P G VG+A  AT
Sbjct: 212 MMLHLAPNTVRMAHAGRFRSTSQDRAERYAILGNGRSAKMGWAIEDYHPSGAVGDAAGAT 271

Query: 232 VKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDV 265
             KG  ++   A     LL +I+           
Sbjct: 272 AGKGRAVVEAAAAQLAALLGEIHDLPDGTLAGAP 305


>gi|318041060|ref|ZP_07973016.1| creatininase [Synechococcus sp. CB0101]
          Length = 275

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 74/254 (29%), Positives = 113/254 (44%), Gaps = 8/254 (3%)

Query: 4   LIIFTDNSLPLC--ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
                  + P    A ++    VV P GA+EQHGP LP+ TD + A  L +R+   LP  
Sbjct: 9   TRRLEQLAWPQLVQAASQPGSTVVWPFGAFEQHGPQLPLGTDALFADRLLDRVLEGLPEA 68

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           LP+  +PV+ +G+S EH+   GT +L     I     I   +   G +++V+ N HGG  
Sbjct: 69  LPIWRLPVQNLGFSPEHLGFQGTLSLPAELLIRQIEVIGAQLADAGFQRLVLFNGHGGQI 128

Query: 122 PLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
            L+ + + + R +   L V     WS       ++  PE   G+H G  ETS+ML LAP 
Sbjct: 129 ALLQVGARQLRAQRPELAVLPCFLWSGPDGIGELLEEPERSQGLHAGLAETSLMLQLAPE 188

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV  +   +                  G+    W   DL+  GVVG++  A+ + G  L 
Sbjct: 189 LVGPERPVDGLLS----EAPPPGWSLEGAVPEAWLTTDLSRTGVVGDSRGASAELGAALE 244

Query: 240 SYFANCFIQLLNDI 253
                 +  LL  +
Sbjct: 245 ERLVAGWRGLLEAL 258


>gi|87302522|ref|ZP_01085339.1| creatininase [Synechococcus sp. WH 5701]
 gi|87282866|gb|EAQ74823.1| creatininase [Synechococcus sp. WH 5701]
          Length = 264

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 74/260 (28%), Positives = 114/260 (43%), Gaps = 8/260 (3%)

Query: 2   NPLIIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
                    S     +A       V+ P GA EQHGPHLP+ TD I A  + + +   LP
Sbjct: 4   PAKHALEGLSWIAAQEAASRPGSTVIWPFGAVEQHGPHLPLGTDAIFAERVLQAVLERLP 63

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             LP+  +P+  +G+S EH    GT +L     ++  +A+   + + G +++V+ NAHGG
Sbjct: 64  AELPIWRLPLFQLGFSPEHGAFPGTLSLPAEVLLQVVMAVGADLARAGFQRLVLFNAHGG 123

Query: 120 NSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
              L+ + + + R     L V     WS       ++  PE   G+H    ETS+ML LA
Sbjct: 124 QIALLQVAARQLRAAHPRLAVMPCFLWSGPPGVAALLPEPERSEGLHAALAETSLMLHLA 183

Query: 178 PHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
           P LV            +            G+    W   DL+  GVVG+A  A    G+ 
Sbjct: 184 PELVGPQRPREGQPDPAPPAG----WSLEGAVPTAWLTADLSASGVVGDARGADAALGKA 239

Query: 238 LLSYFANCFIQLLNDINSFD 257
           L +   + ++ LL D+ S  
Sbjct: 240 LCTALVDGWVTLLGDLLSSP 259


>gi|15890482|ref|NP_356154.1| creatinine amidohydrolase [Agrobacterium tumefaciens str. C58]
 gi|15158717|gb|AAK88939.1| creatinine amidohydrolase [Agrobacterium tumefaciens str. C58]
          Length = 266

 Score =  214 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 141/241 (58%), Positives = 182/241 (75%)

Query: 21  DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80
             I VLPLGA+EQHGPHLP  TDT+IAAG+  R+ ++LP  LPV+ +PVEP+GYSIEHM 
Sbjct: 22  GAISVLPLGAHEQHGPHLPFETDTLIAAGIVSRLAAVLPAHLPVSFLPVEPVGYSIEHMD 81

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           V GTKTL Y EAIE WL I +A  + G+RK V+LNAHGGNSPL++IV+TEAR RF ML V
Sbjct: 82  VPGTKTLCYDEAIERWLGIAEAEYEKGVRKFVMLNAHGGNSPLMTIVATEARARFGMLAV 141

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
           +TSW+RF +P  I+   +  + IHGG+IETS+MLAL P  V M+ A NF SRQS+F + F
Sbjct: 142 ATSWTRFGVPADIVKPQDKAVDIHGGDIETSVMLALHPERVVMEKAANFPSRQSDFSQRF 201

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
            +LRA+G H+FGW M DLNP GV GNA  A+  KGE L+S+  N  ++LL D+++FD+++
Sbjct: 202 SHLRAYGPHAFGWLMSDLNPDGVAGNAAAASAGKGERLISHAVNGLLELLEDVHAFDITL 261

Query: 261 F 261
           F
Sbjct: 262 F 262


>gi|194477335|ref|YP_002049514.1| creatininase [Paulinella chromatophora]
 gi|171192342|gb|ACB43304.1| creatininase [Paulinella chromatophora]
          Length = 268

 Score =  212 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 70/264 (26%), Positives = 119/264 (45%), Gaps = 7/264 (2%)

Query: 5   IIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
                 S P   +A  +    V+ P GA+EQHGPHLP+ TD+  A  + E I + +    
Sbjct: 4   RRLEWMSWPEIQEAASQPGSTVIWPFGAFEQHGPHLPVCTDSCFAEMVLESIMARISSDR 63

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P+  +P++ IG+S EH    GT +++    +     +   + K G +++++ NAHGG   
Sbjct: 64  PIWRLPLQTIGFSPEHEEFPGTLSISAELVLMLVEQVGRQLAKAGFKRLILFNAHGGQIG 123

Query: 123 LVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           L+ + + + R R+  L V     WS       ++  PE   G+H G  ETS+ML L  + 
Sbjct: 124 LLQVAARQLRARYPSLGVLPCFLWSGPEGLIPLLPEPERHEGLHAGLAETSLMLYLQQNK 183

Query: 181 VKMDLAENF-SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           V      +   +  +  L+        G+    W   DL+  GV+G++ D+    GE L 
Sbjct: 184 VGKSRPWDGIKNCPNPPLQPPIGWTLEGNVPNAWLSSDLSFTGVIGDSRDSNSVLGEQLF 243

Query: 240 SYFANCFIQLLNDINSFDVSIFDK 263
           +   N +      +   D S   +
Sbjct: 244 TLLVNGWSARFESL--LDSSWPPQ 265


>gi|296133756|ref|YP_003641003.1| Creatininase [Thermincola sp. JR]
 gi|296032334|gb|ADG83102.1| Creatininase [Thermincola potens JR]
          Length = 264

 Score =  212 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 67/265 (25%), Positives = 115/265 (43%), Gaps = 5/265 (1%)

Query: 1   MNPLIIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLA-ERIKSIL 58
           M   I +   +    A+  ++D +VVLP+GAYEQHGPHL +NTDT I   +  E +    
Sbjct: 1   MENKIYWGSYTSNELANLIKEDPVVVLPVGAYEQHGPHLTLNTDTDIVLEITKEAVGKAC 60

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P   +P   +G S  HM   GT T+  +        I+ ++ + G++K +++N HG
Sbjct: 61  STGIPCALLPPLWLGISEHHMSFSGTITMRQSTLTALVFDILKSLARHGVKKFLVVNGHG 120

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTSWSR-FTIPQGIISFPETEIGIHGGEIETSMMLALA 177
           GN   +     E      +  V  ++          +   E     HG E+ETS+ + +A
Sbjct: 121 GNMAALRYAIDEVGAHCEVEPVLVTYWHLVADLVARLRKSEFGGISHGCELETSLKMHIA 180

Query: 178 PHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
           P  V+ DL      + +E+      + A    +     + L+  G VG+   AT   GE 
Sbjct: 181 PEDVRKDLLRANVVKGNEYWS--PEMFASNRVAMYKPYRQLSEYGHVGDPTKATPDFGEA 238

Query: 238 LLSYFANCFIQLLNDINSFDVSIFD 262
           +         +L+  +   D+   +
Sbjct: 239 VFKAVVAELAKLITMMQKGDLENEN 263


>gi|254430633|ref|ZP_05044336.1| creatininase [Cyanobium sp. PCC 7001]
 gi|197625086|gb|EDY37645.1| creatininase [Cyanobium sp. PCC 7001]
          Length = 295

 Score =  212 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 64/255 (25%), Positives = 114/255 (44%), Gaps = 8/255 (3%)

Query: 3   PLIIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           P         P    A +     V+ P GA EQHGP LP+ TD + A  +   +   LP 
Sbjct: 13  PHRDLMALPWPQVQAAAEQPGSTVIWPWGALEQHGPQLPLGTDALFADRVVNAVLERLPQ 72

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             P+  +P++ +G+S EH    GT +L+ A+ I+  +A+   +   G  ++++LNAHGG 
Sbjct: 73  ERPIWRLPLQSLGFSPEHQGFCGTLSLSAAQVIDLVMAVGSQLAGAGFSRLLLLNAHGGQ 132

Query: 121 SPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
             L+   + + R     + V     WS       ++   E   G+H    ETS+ML LA 
Sbjct: 133 IGLLQAAARQLRASAPQMAVLPCFLWSGPEGVADLLPASERAHGLHAALAETSLMLHLAA 192

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            +V  +   +  +  +      +     G+    W   DL+  GV+G++  A+ + G  L
Sbjct: 193 EMVLPERPCDGLAGPAP----PEGWSLEGAAPCAWLSSDLSRSGVIGDSTAASAELGARL 248

Query: 239 LSYFANCFIQLLNDI 253
                + +++  + +
Sbjct: 249 FERLVDGWVRRCDSL 263


>gi|88807701|ref|ZP_01123213.1| creatininase [Synechococcus sp. WH 7805]
 gi|88788915|gb|EAR20070.1| creatininase [Synechococcus sp. WH 7805]
          Length = 281

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 71/258 (27%), Positives = 113/258 (43%), Gaps = 7/258 (2%)

Query: 4   LIIFTDNSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
                    P  A   K     +V P GA EQHGP LP+ TD + A  +  R+   LP +
Sbjct: 9   SRRLDFLHWPDAASGLKAHRSTLVWPFGALEQHGPQLPLATDALFAEQILNRVLESLPAQ 68

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
            P+  +P + IG S EH    GT +L+    I   + + + +    ++++V+ NAHGG  
Sbjct: 69  WPIWSLPPQSIGLSPEHRGFPGTLSLSADLLIRLVVEVGEQLADQEVKRLVLFNAHGGQI 128

Query: 122 PLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
            L+   + E  +R   + V     WS     + +I   E + G+H G  ETS+MLALAP 
Sbjct: 129 GLLQTAARELAVRAPSMAVLPCFLWSGVPGLEALIPRQELQNGLHAGLAETSLMLALAPD 188

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV ++   +     +            G+    W   D++  GVVG++  A    G+ L 
Sbjct: 189 LVGVERPCDGLQFSTP---PPDGWSLEGAAPCAWFTADISHSGVVGDSRGADAFLGQRLR 245

Query: 240 SYFANCFIQLLNDINSFD 257
                 +  L   + + D
Sbjct: 246 EVLIEHWTGLFKSLMTSD 263


>gi|221198868|ref|ZP_03571913.1| creatininase [Burkholderia multivorans CGD2M]
 gi|221205128|ref|ZP_03578144.1| creatininase [Burkholderia multivorans CGD2]
 gi|221174919|gb|EEE07350.1| creatininase [Burkholderia multivorans CGD2]
 gi|221181319|gb|EEE13721.1| creatininase [Burkholderia multivorans CGD2M]
          Length = 282

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 72/257 (28%), Positives = 124/257 (48%), Gaps = 8/257 (3%)

Query: 2   NPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
            P       +         R++ ++VLP GA EQHGPHLP   D+I+AAG+     + + 
Sbjct: 7   PPERFLPYLTWTDIDALPDRENTVIVLPAGAIEQHGPHLPCAVDSIVAAGVVGHALARVD 66

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
           P++P   +P    G S EH++  GT TLT    +   + I +++ + G RK+VI+NAHGG
Sbjct: 67  PQVPAYALPPITYGKSDEHLHFPGTVTLTGELLLGTAIEIGESVYRAGFRKLVIVNAHGG 126

Query: 120 NSPLVSIVSTEARMRFSMLV-VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
               + + + E R+R    V +  S          +S  E  + +H G  E+++++ALAP
Sbjct: 127 QPQPLEMAARELRLRHGDFVIIVRSAWSVPHEAHFMSDAERRLSMHAGHGESALLMALAP 186

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
             V ++ A                L +    +  W  +D  P GV+G+   AT ++GE L
Sbjct: 187 DTVFIERAVANMPEPFP----CPTLSSGRPAA-AWCARDFGPSGVIGDPRGATREQGELL 241

Query: 239 LSYFANCFIQLLNDINS 255
           L   +  + + + +++ 
Sbjct: 242 LEQLSTSWAKAIGEVHR 258


>gi|319443188|ref|ZP_07992344.1| putative creatinine amidohydrolase (creatininase) [Corynebacterium
           variabile DSM 44702]
          Length = 259

 Score =  211 bits (537), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 70/257 (27%), Positives = 114/257 (44%), Gaps = 8/257 (3%)

Query: 2   NPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIK-SILP 59
                + D +            + V+P+GA E HGPHLPM+TD ++A  +A  +    + 
Sbjct: 3   TASRRWADLTTAEVGRVITAGSLAVVPVGAVEPHGPHLPMSTDLVMAEAVASAVVSRAVD 62

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
               +  +P   +  S EH  + GT  L  +      + +  ++   G+R+++ +N HGG
Sbjct: 63  AGHDLWLLPALSVTKSDEHAALPGTLWLKASTLFATLVDLGRSLAAAGVRRVLFVNGHGG 122

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           NS L+ +   E R RF +     S              E  +GIH G  ETSMML +AP 
Sbjct: 123 NSALLEVALRELRRRFDLRTFLVSSPPTP------GETECGMGIHAGWSETSMMLHVAPE 176

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV MD A     + +  +    ++    +  FGW   D +  GVVG+   A+   GE L 
Sbjct: 177 LVDMDAAAELGPKVASSVAACDHVGFGKTVKFGWLSTDFDASGVVGDPTGASASAGERLF 236

Query: 240 SYFANCFIQLLNDINSF 256
             +    +  L ++ +F
Sbjct: 237 EDYVTSVLDALPEVLTF 253


>gi|148238989|ref|YP_001224376.1| creatininase [Synechococcus sp. WH 7803]
 gi|147847528|emb|CAK23079.1| Creatininase [Synechococcus sp. WH 7803]
          Length = 281

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 72/259 (27%), Positives = 112/259 (43%), Gaps = 7/259 (2%)

Query: 3   PLIIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
                     P  A   ++    +V P GA EQHGP LP+ TD + A  +   +   LP 
Sbjct: 8   SSRRLDHLHWPEAASRLREDRSTLVWPFGALEQHGPQLPLATDALFAERILSLVLESLPD 67

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             P+  +P + IG S EH    GT +L+    I   + + + +   G++++V+ NAHGG 
Sbjct: 68  AWPIWALPPQSIGLSPEHRGFPGTLSLSADLLIRLVVEVGEQMADQGVKRLVLFNAHGGQ 127

Query: 121 SPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
             L+   + E   R   + V     WS     + +I   E + G+H G  ETS+MLALAP
Sbjct: 128 IGLLQTAARELAARAPSMAVLPCFLWSGVPGLKDLIPSMELQNGLHAGLAETSLMLALAP 187

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV  +   +                  G+  + W   D++  GVVG+   A    GE L
Sbjct: 188 ELVGPERPCDGLDSAIPIPE---GWSLEGAAPYAWFTADISSSGVVGDTRGADDSLGERL 244

Query: 239 LSYFANCFIQLLNDINSFD 257
            +     +I L + +   D
Sbjct: 245 KTTLMAHWISLFSSLMRSD 263


>gi|255080566|ref|XP_002503863.1| predicted protein [Micromonas sp. RCC299]
 gi|226519130|gb|ACO65121.1| predicted protein [Micromonas sp. RCC299]
          Length = 850

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 82/257 (31%), Positives = 128/257 (49%), Gaps = 5/257 (1%)

Query: 4   LIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
             ++++ +    A A   D + VLPLGA E HGPHLP+  D++  A L  R   ++   +
Sbjct: 572 SRLWSEWTTEDFATADLSDAVAVLPLGATEAHGPHLPLGVDSMHNAALLARALELVRHDV 631

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            V  +P   IG S EH    GT  +    A + W  I   + + GIRK+++ N+HGGN  
Sbjct: 632 RVLALPPLDIGVSCEHGGFAGTVGIAPETAAKQWEEIGACVARAGIRKLILYNSHGGNHA 691

Query: 123 LVSIVSTEARMRFSMLVVST---SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           L  +V+   R+R  M+       +         +    E   GIHGG +ETS+M+ L P 
Sbjct: 692 LAEVVARRLRLRHRMIAALALNLAMDDDGCAGALFPTDELRFGIHGGSLETSVMMHLRPE 751

Query: 180 LVKMDLAENFSSRQSEF-LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
           LV    A +F+S  ++   +  +          GW+ +DLNP GVVG+A DAT  KG  L
Sbjct: 752 LVDASKAAHFASSAAQMGGKTLQRHALGFGVKTGWASQDLNPHGVVGDASDATDSKGAKL 811

Query: 239 LSYFANCFIQLLNDINS 255
           +   A    +L+ ++++
Sbjct: 812 VESSARGLARLIEEMHA 828


>gi|291561898|emb|CBL40701.1| Uncharacterized protein, putative amidase [butyrate-producing
           bacterium SS3/4]
          Length = 264

 Score =  209 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 84/260 (32%), Positives = 120/260 (46%), Gaps = 8/260 (3%)

Query: 5   IIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP---P 60
             + + +        KD  +V++P+GA EQHG   P+ TD IIA G A RIK  L    P
Sbjct: 3   RYYNELTRLEMEQVDKDETVVMIPVGALEQHGNQCPLGTDEIIAEGTARRIKEALDREIP 62

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             P+   P+ P+G S EH+   G+ TL           I   +   G RKI ILN HGGN
Sbjct: 63  DYPMLIFPLIPVGLSTEHVNFCGSVTLKPDTFYHVLYDICKGLAHHGFRKIAILNCHGGN 122

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIIS--FPETEIGIHGGEIETSMMLALAP 178
           SP++ ++S E R    + V   +   F   Q +     P      HGGE+ETSM+LA  P
Sbjct: 123 SPIIQVLSREVRSELGIAVFIINCGAFFGNQAVKDTVTPGNIWDFHGGEMETSMVLAERP 182

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRA--HGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
             VK++ +E    R+    + F        G  S  W  +D  P G+ G+   AT +KG 
Sbjct: 183 ETVKLETSEAGIPRKFMGNKTFTVYGPITLGWVSEEWETEDGKPIGIGGDPSGATAEKGS 242

Query: 237 GLLSYFANCFIQLLNDINSF 256
            +   F    +  L +I  +
Sbjct: 243 QIYDSFVESILSGLKEIRKW 262


>gi|322370445|ref|ZP_08045003.1| creatininase [Haladaptatus paucihalophilus DX253]
 gi|320549862|gb|EFW91518.1| creatininase [Haladaptatus paucihalophilus DX253]
          Length = 264

 Score =  208 bits (529), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 76/256 (29%), Positives = 118/256 (46%), Gaps = 9/256 (3%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   D + P   D   ++ + V+PLG+ EQHGPHLP+ TD +IA  LA            
Sbjct: 1   MYLADQTWPELGDYVAEESVAVVPLGSTEQHGPHLPLATDHLIAEALAREAADRAG---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
             C P   +G S  HM   GT ++   +  ++  +    +   GI +IV +NAHGGN   
Sbjct: 57  YLCTPTINVGVSTHHMQFHGTMSVDPPQFRDYVESFSRNLTYHGIDRIVYVNAHGGNMQH 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V    R   +   V   W   +IP+ +    E   G HGG  ET+M++ +AP LV+ 
Sbjct: 117 LREVGRRLREDEAAFAVEWMWDE-SIPELVSDIFEHN-GPHGGPKETAMIMHIAPELVRE 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D  E         L +      HG+ ++ +   D +  GV G+  DAT +KGE +     
Sbjct: 175 DKLEAARDGGVVNLLDGN-PTIHGARNY-YDAIDNSENGVFGDQTDATPEKGEEIFEAAT 232

Query: 244 NCFIQLLNDINSFDVS 259
              +QLL+ ++    S
Sbjct: 233 EQLVQLLDWLDDARFS 248


>gi|300717288|ref|YP_003742091.1| Creatininase [Erwinia billingiae Eb661]
 gi|299063124|emb|CAX60244.1| Creatininase [Erwinia billingiae Eb661]
          Length = 293

 Score =  208 bits (529), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 76/261 (29%), Positives = 131/261 (50%), Gaps = 9/261 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +         S P  A    + + ++VLP GA EQHGPHLP + D++I++G+A    + L
Sbjct: 6   IPAARFLPFLSWPAIAALPDKANTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +P   +P    G S EH+   GT TLT    ++  L I +++ + G RK++++N HG
Sbjct: 66  PKAIPAFAIPPITYGKSDEHLNFPGTLTLTGDTLLQTILEIAESVYRAGFRKLLMINGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ + S E R+R   +++     +    +    +S  E ++ +H G  ET++MLAL
Sbjct: 126 GQPQVLQMASREMRLRHGDMIMIPHDVFRVPNVENQYLSAQEQKMAMHAGHSETAVMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V M+ A      +         L +    +  W+  D  P GV+G+   ATV++G 
Sbjct: 186 APECVHMEHAVVNYPPEFP----CPTLSSSRPAA-AWASYDFGPSGVIGDPTQATVEQGH 240

Query: 237 GLLSYFANCFIQLLNDINSFD 257
            +L   A  + Q + +I+  +
Sbjct: 241 AILDSLAASWAQAITEIHQME 261


>gi|313126737|ref|YP_004037007.1| hypothetical protein Hbor_19960 [Halogeometricum borinquense DSM
           11551]
 gi|312293102|gb|ADQ67562.1| uncharacterized protein, putative amidase [Halogeometricum
           borinquense DSM 11551]
          Length = 265

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 74/252 (29%), Positives = 116/252 (46%), Gaps = 8/252 (3%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   D + P   D    + + V+PLG+ EQHGPHLP+ TD +IA  LA         R  
Sbjct: 1   MYVADRTWPELGDYVAAESLAVVPLGSTEQHGPHLPLATDHLIAEALAREAA----DRTD 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V C P   +G S  H    GT  +   +  ++  ++   +   GI ++V +NAHGGN+  
Sbjct: 57  VLCTPTVNVGVSPHHRQFHGTMWVDAPQFRDYVESMTRNLAYHGIDRVVYVNAHGGNAQH 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V    R   +M  +   W   +IP  +    E   G HGG  ET+M++ +AP LV+ 
Sbjct: 117 LREVGRRLRDDGTMYAIEWMWDE-SIPDLVNEVFEHN-GPHGGPKETAMIMHIAPELVRE 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D  E+        L +      HG+ +F +   + +  GV G+  DAT + GE L     
Sbjct: 175 DRLEDARDGGLVDLDDSDRYMKHGARTF-YDAIENSENGVFGDQTDATPETGERLFEAAT 233

Query: 244 NCFIQLLNDINS 255
              + L+  +N 
Sbjct: 234 EQLVHLIEWLND 245


>gi|270262664|ref|ZP_06190935.1| putative creatininase [Serratia odorifera 4Rx13]
 gi|270043348|gb|EFA16441.1| putative creatininase [Serratia odorifera 4Rx13]
          Length = 293

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 72/258 (27%), Positives = 127/258 (49%), Gaps = 9/258 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +         S    A    + + ++VLP GA EQHGPHLP + D++I++G+A    + L
Sbjct: 6   IPAERFLPFLSWTAIAALPDKANTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P   +P    G S EH+   GT TLT    ++  L I +++ + G RK++++N HG
Sbjct: 66  SKDIPAYGIPPITYGKSDEHLNFPGTLTLTGDTLLQTVLEIAESLYRAGFRKLLMINGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ + S E R+R   +++     +    +    +S  E ++ +H G  ET++MLAL
Sbjct: 126 GQPQVLQMASREMRLRHGDMIMIPHDVFRVPNVENQFLSAQEQKMAMHAGHSETAVMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V ++ A      +         L +    +  W+  D  P GV+G+   AT ++G 
Sbjct: 186 APECVHIEHAVANYPPEFP----CPTLSSSRPAA-AWASYDFGPSGVIGDPTGATAEQGH 240

Query: 237 GLLSYFANCFIQLLNDIN 254
            +L   A  + Q + +I+
Sbjct: 241 AILDSLAASWAQAITEIH 258


>gi|269928761|ref|YP_003321082.1| Creatininase [Sphaerobacter thermophilus DSM 20745]
 gi|269788118|gb|ACZ40260.1| Creatininase [Sphaerobacter thermophilus DSM 20745]
          Length = 274

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 70/276 (25%), Positives = 121/276 (43%), Gaps = 11/276 (3%)

Query: 1   MNPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M   + +   + P   +  R+D +VV+P  A E+HG HLP++TD +IA+ +A +    L 
Sbjct: 1   MVNRVRYEKRTWPEIQEFVRRDAVVVIPTAAVEEHGHHLPLDTDVLIASHIATQAA--LR 58

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
              P   MP   IGY   HM   GT    +   I + L +  ++   G R++++LN HG 
Sbjct: 59  ASHPCLVMPTIWIGYEGHHMDFPGTIDADWDLFIRYGLTVTRSLAHHGFRRMIVLNGHGS 118

Query: 120 NSPLVSIVSTEARMRFSM-LVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALA 177
           N PL+ +++ +  +     L  + SW   +  Q +     E+E+  H  E+ETS  LA+ 
Sbjct: 119 NRPLIEVIARQTVIERPDTLCAAISWWELSDAQRVFNEMRESEVTSHACELETSAYLAIE 178

Query: 178 PHLVKMDLAENFSSR------QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDAT 231
           P  V+MD A             S+ +                    ++  G  G+   AT
Sbjct: 179 PESVQMDKAVRDMHYDMSTHVWSDLMGRKPDPAFKNPVKMMEIWSTMSETGTRGDLTTAT 238

Query: 232 VKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDVQK 267
            +KG  +L      F  L++++ S  +       ++
Sbjct: 239 AEKGRLVLEAAIAEFAALIDELGSRPIKEPRDHHER 274


>gi|304397341|ref|ZP_07379219.1| Creatininase [Pantoea sp. aB]
 gi|304354959|gb|EFM19328.1| Creatininase [Pantoea sp. aB]
          Length = 293

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 74/258 (28%), Positives = 128/258 (49%), Gaps = 9/258 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +         S    A    + + ++VLP GA EQHGPHLP + D++I++G+A    + L
Sbjct: 6   IPAERFLPFLSWTAIAALPDKANTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +P   +P    G S EH+   GT TLT    ++  L I +++ + G RK++++N HG
Sbjct: 66  PEEIPAFAIPPITYGKSDEHLNFPGTLTLTGDTLLQTVLEIAESLYRAGFRKLLMINGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ + S E R+R   +++     +    +    +S  E ++ +H G  ET++MLAL
Sbjct: 126 GQPQVLQMASREMRLRHGDMIMIPHDVFRVPNVENQFLSAQEQKMAMHAGHSETAVMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V M+ A                L +    +  W+  D  P GV+G+ + AT ++G 
Sbjct: 186 APECVHMEHAVANYPPAFP----CPTLSSGRPVA-AWASYDFGPSGVIGDPIGATAEQGH 240

Query: 237 GLLSYFANCFIQLLNDIN 254
            +L   A  + Q + +I+
Sbjct: 241 AILDSLAASWAQAITEIH 258


>gi|322832605|ref|YP_004212632.1| Creatininase [Rahnella sp. Y9602]
 gi|321167806|gb|ADW73505.1| Creatininase [Rahnella sp. Y9602]
          Length = 293

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 73/259 (28%), Positives = 128/259 (49%), Gaps = 9/259 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +         S    A    + + ++VLP GA EQHGPHLP + D++I++G+A    + L
Sbjct: 6   IPAARFLPFLSWTAIAALPDKANTVIVLPTGAIEQHGPHLPCSVDSVISSGVAGHALARL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +P   +P    G S EH+   GT TLT    ++  L I +++ + G RK++++N HG
Sbjct: 66  PEAIPAYAIPPITYGKSDEHLNFPGTLTLTGDTLLQTILEIAESLYRAGFRKLLMINGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTS--WSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G   ++ + S E R+R   +++     +    +    +S  E ++ +H G  ET++MLAL
Sbjct: 126 GQPQVLQMASREMRLRHGDMIMIPHDVFRVPNVENQFLSAQEQKMAMHAGHSETAVMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V ++ A      +         L +    +  W+  D  P GV+G+   AT ++G 
Sbjct: 186 APECVHIEHAVANYPPEFP----CPTLSSGRPAA-AWASYDFGPSGVIGDPTGATAEQGH 240

Query: 237 GLLSYFANCFIQLLNDINS 255
            +L   A  + Q + +I+ 
Sbjct: 241 AILDSLAASWAQAITEIHH 259


>gi|301062815|ref|ZP_07203413.1| creatininase [delta proteobacterium NaphS2]
 gi|300443077|gb|EFK07244.1| creatininase [delta proteobacterium NaphS2]
          Length = 778

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 68/263 (25%), Positives = 115/263 (43%), Gaps = 10/263 (3%)

Query: 6   IFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +  + + P      ++  + +LP+GA EQHGPHLP++ D   A  LA+ +     P  P 
Sbjct: 523 LLGELTWPEAKRRFKEVDVALLPVGAIEQHGPHLPLDCDAYDADYLAKAVAEYCDPPRP- 581

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P+   G S  H    GT ++      +    I  +  + GI K+VI+N HGGNSP +
Sbjct: 582 LVLPLVSYGVSYHHEDFSGTLSVNPETLSQMVYDIGMSAVRHGITKLVIINGHGGNSPAL 641

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
              +          + +   +  +    I +  ET   +H GEIETS  +A  PH+V+  
Sbjct: 642 HFAAQMINR--DAHIFTCVDTGESSDPDIYAMAETPNDVHAGEIETSTTMATRPHMVRSG 699

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
               F  R S    +F   R+ G ++       ++  GV+G+    +V KGE +      
Sbjct: 700 KIRKFVPRFSSRYLDFTSRRSVGWYAH---TSKISSSGVMGDPTKGSVLKGERIWKVMIE 756

Query: 245 CFIQLLNDINSFDVSIFDKDVQK 267
                + ++    +   D+  QK
Sbjct: 757 NLAAFVQELQRLSL---DEIHQK 776


>gi|110667759|ref|YP_657570.1| creatinine amidohydrolase [Haloquadratum walsbyi DSM 16790]
 gi|109625506|emb|CAJ51933.1| creatinine amidohydrolase [Haloquadratum walsbyi DSM 16790]
          Length = 256

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 67/252 (26%), Positives = 112/252 (44%), Gaps = 9/252 (3%)

Query: 5   IIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   + + P   +   ++ + V+PLG+ EQHGPHLP++TD +IA   A            
Sbjct: 1   MRVAEQTWPELDSYISEESLAVVPLGSTEQHGPHLPLSTDHLIAEAFAREATDRTG---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
             C P   IG S  H    GT  +      ++  ++   +   GI +++ +NAHGGN   
Sbjct: 57  YLCTPPINIGVSPHHRQFHGTMWVDAPVFRDYVESLTRNLAYHGIDRVIYVNAHGGNVEH 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V    R   ++  +   W   +IP+ + +  E + G HGG  ET+M+  L P LV  
Sbjct: 117 LREVGRRLRDDETLYAIEWMW-NESIPELVDTLFE-QNGPHGGPKETAMIQYLQPELVST 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D   +          +    R  GS +F +   D    GV+G+  DAT +KGE +     
Sbjct: 175 DRLADARDEGLIEFTDDNTRRF-GSRTF-YDAIDNTNNGVLGDQTDATPEKGEKMFESAT 232

Query: 244 NCFIQLLNDINS 255
              ++L   ++ 
Sbjct: 233 EQLVKLCRWLDR 244


>gi|121596139|ref|YP_988035.1| creatininase [Acidovorax sp. JS42]
 gi|120608219|gb|ABM43959.1| Creatininase [Acidovorax sp. JS42]
          Length = 289

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 95/262 (36%), Positives = 139/262 (53%), Gaps = 7/262 (2%)

Query: 3   PLIIFTDNSLPLCADARK-----DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           P   + D S    A A+        + VLP+ A EQHGPHLP++ D  + AG+ +    +
Sbjct: 21  PSRFWADLSARDFAQAQASGLAAQTVAVLPVAAVEQHGPHLPLSVDATLLAGVIDAALPL 80

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
           L   LPV  +P + +G S EH+   GT TL+ A  I  W  +   I + G++K+++LN H
Sbjct: 81  LSADLPVLLLPPQNVGLSTEHLSYPGTLTLSPATLIALWTELGACIARAGVKKLLLLNGH 140

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQ--GIISFPETEIGIHGGEIETSMMLA 175
           GGN   + IV+ E R R  +LV  +SW            +  E   GIHGGEIETSMML 
Sbjct: 141 GGNVAAMDIVARELRQRHGLLVYGSSWFNLVDEANNARFAAQEHRFGIHGGEIETSMMLH 200

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           LAP  V+M+ A++F S   +    +  L    S   GW+++D NP G VGNA  AT  +G
Sbjct: 201 LAPATVRMEHAQHFHSTSQDRAARYGLLGNGKSAKMGWAIEDYNPAGAVGNAAAATATQG 260

Query: 236 EGLLSYFANCFIQLLNDINSFD 257
           + ++   A    QLL ++++  
Sbjct: 261 QAMVQAAARGLAQLLGELHALP 282


>gi|317046649|ref|YP_004114297.1| Creatininase [Pantoea sp. At-9b]
 gi|316948266|gb|ADU67741.1| Creatininase [Pantoea sp. At-9b]
          Length = 292

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 72/259 (27%), Positives = 126/259 (48%), Gaps = 9/259 (3%)

Query: 1   MNPLIIFTDNSLPLCA--DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +         S    A  D + + ++VLP GA EQHGPHLP   D++I++G+     + L
Sbjct: 6   IPANRFLPYLSWTDIATLDDKANTVIVLPTGAIEQHGPHLPCAVDSVISSGVVGHALARL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +P   +P    G S EH++  GT TLT    +   L I +++ + G RK +++N HG
Sbjct: 66  PAAIPAYAIPPITYGKSDEHLHFPGTLTLTGETLLHTILEIGESLYRAGFRKFLMVNGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G    + +   E R+R   +++    ++      +  +   E ++ +H G  ET++MLAL
Sbjct: 126 GQPQPLQMAMRELRLRHGDMIIIMQDTFKVPNCAESFMDEQERQMAMHAGHAETALMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V+MD A                L +    +  W+  D  P GV+G+ + +T  +GE
Sbjct: 186 APDTVQMDKAVANYPPAFP----CPTLSSTRPMA-AWASYDFGPSGVIGDPLPSTKAQGE 240

Query: 237 GLLSYFANCFIQLLNDINS 255
            +L   A  + Q++ +++ 
Sbjct: 241 AILESLAISWAQVITEVHQ 259


>gi|121607369|ref|YP_995176.1| creatininase [Verminephrobacter eiseniae EF01-2]
 gi|121552009|gb|ABM56158.1| Creatininase [Verminephrobacter eiseniae EF01-2]
          Length = 282

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 115/226 (50%), Gaps = 8/226 (3%)

Query: 3   PLIIFTDNSLPLCADARK-----DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           P   + + S    A  +        + VLP+ A EQHGPHLP++ D  +  G+ +     
Sbjct: 9   PSRFWAELSTRAFAQLKASGQAAQTVAVLPVAAIEQHGPHLPLSVDATLLQGVIDAALPQ 68

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
           LP  LPV  +P + +G S EH+   GT TL+ A  I  W  I + + + G+RK+++ N H
Sbjct: 69  LPAGLPVLFLPPQNLGLSPEHLRFSGTLTLSPATVIALWTEIGECVARAGVRKLLLFNGH 128

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGI---ISFPETEIGIHGGEIETSMML 174
           GG   ++ IV+ E R R  ++V   SW    +P  +    S  E   GIH GEIETSMML
Sbjct: 129 GGQVSVMDIVARELRTRCDLIVYGASWFSLPLPDAVAGQFSAQEHRFGIHAGEIETSMML 188

Query: 175 ALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNP 220
            L+P  V+M+ A +F S        +  L    +   GW M+D +P
Sbjct: 189 HLSPATVQMEQARDFRSSAQHRAGQYAILGNGRTAKLGWQMQDYHP 234


>gi|160940015|ref|ZP_02087360.1| hypothetical protein CLOBOL_04904 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436595|gb|EDP14362.1| hypothetical protein CLOBOL_04904 [Clostridium bolteae ATCC
           BAA-613]
          Length = 281

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 83/266 (31%), Positives = 125/266 (46%), Gaps = 17/266 (6%)

Query: 5   IIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL----- 58
             + D +        KD  IV++PLGA EQHG   P+ TD IIA  + + I+  L     
Sbjct: 17  RNYRDLTRLEMEQVNKDETIVLIPLGALEQHGNQAPLGTDDIIAEAMTDYIRRELEGEPS 76

Query: 59  --PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNA 116
                 P+   PV P+G S EH    G+ TL           I  ++   G +K+  L  
Sbjct: 77  SEDSDFPMLVFPVIPVGLSTEHRNFCGSITLKPDTYYHMLYDISTSLVHHGFKKLAFLVC 136

Query: 117 HGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETE-IGIHGGEIETSMMLA 175
           HGGN+P+V ++S E R  F +     S   F+ P    +  E      HGGE+ETSM++A
Sbjct: 137 HGGNAPIVQVLSRELRSEFGISPFILSSGAFSHPDVTATISEGNIWDFHGGEMETSMVMA 196

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDL-----NPKGVVGNAMDA 230
           + P LVK+D +E          ++ + LR +G+ S GW  +D       P G+ G+   A
Sbjct: 197 VDPSLVKLDTSEAGIPIA---FKDNQALRPYGNVSIGWVSEDWKTADGKPIGIGGDPSGA 253

Query: 231 TVKKGEGLLSYFANCFIQLLNDINSF 256
           T +KG  +L   A   +  L +I ++
Sbjct: 254 TAEKGRIILETSAKVLVPGLREIRAW 279


>gi|257052901|ref|YP_003130734.1| Creatininase [Halorhabdus utahensis DSM 12940]
 gi|256691664|gb|ACV12001.1| Creatininase [Halorhabdus utahensis DSM 12940]
          Length = 242

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 63/253 (24%), Positives = 107/253 (42%), Gaps = 15/253 (5%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   +++    A+A +  + +LP+G+ EQHGPH P+ TD IIA  +A+      P     
Sbjct: 1   MRLAESTWAQ-AEAIETDLAILPVGSTEQHGPHAPLGTDAIIAEAVADAGVEAYPGD--A 57

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P   +G S EH    G+  ++           + ++   G  ++VI+N HGGN   +
Sbjct: 58  VVAPPITVGVSEEHRAFPGSLWVSEDTFRATVRETVASLAHHGWDRVVIVNGHGGNVNPL 117

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             V            V  +W     P  I          H G +ETS++  +AP L+  +
Sbjct: 118 REVCARISRHDDAYAVPFTWFEAVDPGDI-------SMGHAGPMETSVLEEVAPDLIDEE 170

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             E      +E    +      G  +  + +++  P GVVG+   A  ++GE LL    +
Sbjct: 171 KMETAREEAAERWGEW-----TGGVNLAYDVEEFAPNGVVGDPTVADAERGEKLLRSARD 225

Query: 245 CFIQLLNDINSFD 257
             + LL D+   D
Sbjct: 226 ELVTLLEDVAERD 238


>gi|222112294|ref|YP_002554558.1| creatininase [Acidovorax ebreus TPSY]
 gi|221731738|gb|ACM34558.1| Creatininase [Acidovorax ebreus TPSY]
          Length = 275

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 94/261 (36%), Positives = 139/261 (53%), Gaps = 7/261 (2%)

Query: 4   LIIFTDNSLPLCADARKD-----WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
              + + S    A A+        + VLP+ A EQHGPHLP++ D  + AG+ +    +L
Sbjct: 8   SRFWAELSARDFAQAQATGLAAQTVAVLPVAAVEQHGPHLPLSVDATLLAGVIDAALPLL 67

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  LPV  +P + +G S EH+   GT TL+ A  I  W  +   I + G++K+++LN HG
Sbjct: 68  PADLPVLLLPAQNVGLSTEHLSYPGTLTLSPATLIALWTELGACIARAGVKKLLLLNGHG 127

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQ--GIISFPETEIGIHGGEIETSMMLAL 176
           GN   + IV+ E R R  +LV  +SW            +  E   GIHGGEIETSMML L
Sbjct: 128 GNVAAMDIVARELRQRHGLLVYGSSWFNLVDEATNARFAAQEHRFGIHGGEIETSMMLHL 187

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V+M+ A++F S   +    +  L    S   GW+++D NP G VGNA  AT  +G+
Sbjct: 188 APATVRMEHAQHFPSTSQDRAARYGLLGNGKSAKMGWAIEDYNPAGAVGNAAAATAAQGQ 247

Query: 237 GLLSYFANCFIQLLNDINSFD 257
            ++   A    QLL ++++  
Sbjct: 248 AMVQAAARGLAQLLGELHALP 268


>gi|329297689|ref|ZP_08255025.1| Creatininase [Plautia stali symbiont]
          Length = 292

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 69/259 (26%), Positives = 124/259 (47%), Gaps = 9/259 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +         S    A    + + ++VLP GA EQHGPHLP   D++I++G+     + L
Sbjct: 6   IPANRFLPYLSWTDIATLDNKANTVIVLPTGAIEQHGPHLPCAVDSVISSGVVGHALARL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           P  +P   +P    G S EH++  GT TLT    +   L I +++ + G RK +++N HG
Sbjct: 66  PANIPAYAIPPITYGKSDEHLHFPGTLTLTGETLLHTILEIGESLYRAGFRKFLMVNGHG 125

Query: 119 GNSPLVSIVSTEARMRFSMLVVST--SWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           G    + + + E R+R   +++    ++      +  +   E ++ +H G  ET++MLAL
Sbjct: 126 GQPQPLQMAARELRLRHGDIIIIMQDTFKVPNCAESFMDDKEHQMAMHAGHAETALMLAL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           AP  V+M  A                L      +  W+  D  P GV+G+ + +T ++G 
Sbjct: 186 APDTVQMSKAVANYPPAFP----CPTLSTSKPMA-AWASYDFGPSGVIGDPLPSTPEQGA 240

Query: 237 GLLSYFANCFIQLLNDINS 255
            +L   A  + Q++ +++ 
Sbjct: 241 AILDSLAESWAQVITEVHQ 259


>gi|16554502|ref|NP_444226.1| putative amidase [Halobacterium sp. NRC-1]
          Length = 275

 Score =  202 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 67/254 (26%), Positives = 109/254 (42%), Gaps = 9/254 (3%)

Query: 3   PLIIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
             +   D + P   D    + + ++PLG+ EQHGPHLP +TD  IA   A  +       
Sbjct: 16  QRVYLADEAWPELGDYFDAESLALVPLGSTEQHGPHLPESTDHRIAEAFARTVADRTG-- 73

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
             V C P   +G S  H    GT  +      ++  +    +   GI ++V +NAHGGN 
Sbjct: 74  --VLCTPPVNVGVSPHHRQFPGTMWVEPPVFRDYVASFTRNLAFHGIDRVVFVNAHGGNV 131

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +  V    R   ++  V   W        ++     + G HGG  ET++M  L    V
Sbjct: 132 SHLREVGRRLRDEGTLYAVEWMWDESIP--ELVDEVFDQNGPHGGPKETALMQYLDGEHV 189

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
             D  E+        + +   ++ HGS +F +   D    GV+G+  DAT + GE L   
Sbjct: 190 HDDRLEDARDGGVASVADADTIK-HGSRTF-YDAIDNTDNGVLGDQTDATAETGERLFEA 247

Query: 242 FANCFIQLLNDINS 255
            ++  +QL   +++
Sbjct: 248 ASDQLVQLCEWLDA 261


>gi|15612789|ref|NP_241092.1| creatinine amidohydrolase [Bacillus halodurans C-125]
 gi|10172838|dbj|BAB03945.1| creatinine amidohydrolase [Bacillus halodurans C-125]
          Length = 249

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 60/252 (23%), Positives = 107/252 (42%), Gaps = 20/252 (7%)

Query: 8   TDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
            +NS  +     +  I +LP+GA E HGPHLP+ TD ++A  L+  +   +        +
Sbjct: 5   AENSFEVKQKISEKQIAILPIGAIEAHGPHLPLETDNLLAERLSILVAKRVG----AFVL 60

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P  P G         G+ T++    +   + + +++   G     ++N H GNS  +   
Sbjct: 61  PTLPYGQVWSLKNFPGSITVSNESLVNMLVDLGESLYNQGFSIFSMVNGHLGNSVALKEA 120

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI----HGGEIETSMMLALAPHLVKM 183
           + +   R+  L V   +    + + + S  ET        H  EIETS+ML LAP  V M
Sbjct: 121 ARKLYERYPDLQVL-YFFYPGMSEVVSSIRETPSSHNTYFHACEIETSLMLYLAPEYVDM 179

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           + A                     +    W  ++     V+G+A  AT +KGE ++S   
Sbjct: 180 ERAICDIPVIPLSAD---------ATPTPW--EEFTDTAVLGDATLATKEKGEKVISVVL 228

Query: 244 NCFIQLLNDINS 255
           +  +Q++ ++  
Sbjct: 229 DNIVQVIEEVRR 240


>gi|315231099|ref|YP_004071535.1| creatinine amidohydrolase [Thermococcus barophilus MP]
 gi|315184127|gb|ADT84312.1| creatinine amidohydrolase [Thermococcus barophilus MP]
          Length = 236

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 62/251 (24%), Positives = 107/251 (42%), Gaps = 19/251 (7%)

Query: 5   IIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI-KSILPPRL 62
           +   + +     + +K    V+LP+G+ E HG HLP+ TD      +A+R+   +     
Sbjct: 1   MYMENLTWDEFNEIKKKIDTVILPIGSVEAHGKHLPLGTDVFAPVEIAKRVEAKLREKGK 60

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            +   P    G+S       GT  +       +   ++    + G RKI++LN HGGN  
Sbjct: 61  EILIAPPIWYGHSFVLDVFPGTINVKADTLRRYVRDVMAEFAEEGFRKIILLNGHGGNYY 120

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            +   + E   R+++ V   +W      + I+S   ++   H GE ETS++LA+ P LVK
Sbjct: 121 PLVEAAEEVARRYNVEVWLINWW-IDFREDILSICSSQ--GHAGEDETSVILAIKPELVK 177

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMK-DLNPKGVVGNAMDATVKKGEGLLSY 241
           M+ AE                R          +  +L P GV  +   AT +KGE +L  
Sbjct: 178 MEKAEGEK-------------RTSKVRKIRKDIALELFPNGVNDDPRGATKEKGEAILEV 224

Query: 242 FANCFIQLLND 252
            +    + + +
Sbjct: 225 ISKKIARFILE 235


>gi|223938711|ref|ZP_03630600.1| Creatininase [bacterium Ellin514]
 gi|223892562|gb|EEF59034.1| Creatininase [bacterium Ellin514]
          Length = 307

 Score =  201 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 62/256 (24%), Positives = 106/256 (41%), Gaps = 12/256 (4%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   + + P      +D IV+ P+ A EQH  HLP  TD+I+  G+A R+++ LP    +
Sbjct: 61  MKLAELAWPEVEHLDRDIIVIYPIAALEQHSRHLPFFTDSILCDGVASRLEAALPNE--I 118

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +PV+ +G S  H+ + G+ T      +      +  + + G R++ ILN HGGN    
Sbjct: 119 LLLPVQWLGASAHHLGMPGSLTAQSDTYLNILCEPLRCLLQHGFRRVFILNGHGGNIDGF 178

Query: 125 SIVSTEARMRFSM--LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            +   +  + F    L  ++ W         I   E +   H  E ETSMM+ L P LV+
Sbjct: 179 HLALRQLALEFPDSVLAGASYWDLADKEIAAILQGERKNVGHACEFETSMMMYLRPELVR 238

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
                +   + +          A          K     G  G A  AT  KG+  +   
Sbjct: 239 TSEIADDKVKNTS--------EALKGIYIPLDFKRHTRHGGSGQATLATAAKGKQFMDAI 290

Query: 243 ANCFIQLLNDINSFDV 258
               ++++  I +  +
Sbjct: 291 VPKSVEIIKAIKARPI 306


>gi|260222498|emb|CBA32121.1| hypothetical protein Csp_D30540 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 908

 Score =  201 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 90/248 (36%), Positives = 127/248 (51%), Gaps = 7/248 (2%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I VLP+ A EQHGPHLP+  D+ +  G+       + P +P   +P + +G+S EH    
Sbjct: 659 IAVLPVAATEQHGPHLPLQVDSALVDGVIAHALPHIGPDVPALFLPTQAVGFSPEHAQFS 718

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
           GT TL     I  W  I + +   G++++V+ N+HGG   L+ +V+ + R R  MLV S 
Sbjct: 719 GTLTLKAETVIRLWTEIGECVAASGVKRLVLFNSHGGQVGLMDVVARDLRARLGMLVYSV 778

Query: 143 SWSRFT-------IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
           +W               + S  E   GIH G+IETSMMLAL P LV MD A+NF+S   +
Sbjct: 779 NWFGLPLMAADGSDVNALFSAHEHRFGIHAGDIETSMMLALRPDLVDMDEADNFASTSED 838

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
             + F  L    S   GW M+D NP G VGNA  AT  KG  +L+       +LL +I +
Sbjct: 839 RAKAFPILGNGKSAKLGWQMQDYNPAGAVGNAAAATPDKGHAVLAAAGLALARLLGEIRA 898

Query: 256 FDVSIFDK 263
                  +
Sbjct: 899 LPGDTLKQ 906


>gi|284164199|ref|YP_003402478.1| creatininase [Haloterrigena turkmenica DSM 5511]
 gi|284013854|gb|ADB59805.1| Creatininase [Haloterrigena turkmenica DSM 5511]
          Length = 263

 Score =  201 bits (512), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 76/262 (29%), Positives = 115/262 (43%), Gaps = 10/262 (3%)

Query: 5   IIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   + S P   D   D  + V+PLG+ EQHGPHLP  TD +IA  LA            
Sbjct: 1   MYLANRSWPELGDYVADESLAVVPLGSTEQHGPHLPEGTDHMIAEALAREATDRTG---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
             C P  PIG S  H    GT  +      ++  ++   +   GI +IV +NAHGGN   
Sbjct: 57  YLCTPPIPIGVSSHHRQFPGTMWVEAPVFRDYVESLSRNLTYHGIDRIVYVNAHGGNVAH 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V        +   +   W   +IP+ I    ET  G HGG  ET+M++ +A  LV  
Sbjct: 117 LREVGRRLHDDGTAYAIEWMWDE-SIPELIEEVFETP-GPHGGPKETAMIMHIANELVHA 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D  E      + F  ++   R HG+ +F +   + +P G+ G+  DAT + GE L     
Sbjct: 175 DRLEEARDGGAVF--DYDAERVHGATTF-YDCIENSPNGIFGDQTDATPEIGEELFEAAT 231

Query: 244 NCFIQLLNDINSFDVSIFDKDV 265
           +  + LL  ++         + 
Sbjct: 232 DQLVALLEWLDDRPFEELMPEP 253


>gi|169236430|ref|YP_001689630.1| creatininase [Halobacterium salinarum R1]
 gi|167727496|emb|CAP14284.1| creatininase [Halobacterium salinarum R1]
          Length = 258

 Score =  201 bits (511), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 67/252 (26%), Positives = 109/252 (43%), Gaps = 9/252 (3%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   D + P   D    + + ++PLG+ EQHGPHLP +TD  IA   A  +         
Sbjct: 1   MYLADEAWPELGDYFDAESLALVPLGSTEQHGPHLPESTDHRIAEAFARTVADRTG---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V C P   +G S  H    GT  +      ++  +    +   GI ++V +NAHGGN   
Sbjct: 57  VLCTPPVNVGVSPHHRQFPGTMWVEPPVFRDYVASFTRNLAFHGIDRVVFVNAHGGNVSH 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V    R   ++  V   W        ++     + G HGG  ET++M  L    V  
Sbjct: 117 LREVGRRLRDEGTLYAVEWMWDESIP--ELVDEVFDQNGPHGGPKETALMQYLDGEHVHD 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D  E+        + +   ++ HGS +F +   D    GV+G+  DAT + GE L    +
Sbjct: 175 DRLEDARDGGVASVADADTIK-HGSRTF-YDAIDNTDNGVLGDQTDATAETGERLFEAAS 232

Query: 244 NCFIQLLNDINS 255
           +  +QL   +++
Sbjct: 233 DQLVQLCEWLDA 244


>gi|269795037|ref|YP_003314492.1| hypothetical protein Sked_17310 [Sanguibacter keddieii DSM 10542]
 gi|269097222|gb|ACZ21658.1| uncharacterized protein, putative amidase [Sanguibacter keddieii
           DSM 10542]
          Length = 266

 Score =  201 bits (511), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 72/263 (27%), Positives = 113/263 (42%), Gaps = 8/263 (3%)

Query: 2   NPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTI--IAAGLAERIKSILP 59
                F D +           + VLPLGA EQHG HLP++TD +   +   A        
Sbjct: 7   PDAPRFIDLTYQQVGALPPSTVAVLPLGAIEQHGAHLPVSTDHLVASSVAEAAVATVAES 66

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
                  +P      S EH +  GT  L +   +   + I  ++    + +++ +N HGG
Sbjct: 67  GAAHALLLPGLAYTKSDEHHWAPGTIWLGWETLMATLVDIGRSLAVSPVERLMFVNGHGG 126

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISF---PETEIGIHGGEIETSMMLAL 176
           NS L  +   E   RF +       S      G ++    PE   G+HGG  ETSM+L L
Sbjct: 127 NSALGQVACRELHRRFGLKTFFAHSSMPRDQGGGLAPDVDPENGFGVHGGRGETSMVLHL 186

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P LV MDLA     +  E +  ++++    + SFGW+  D  P GV+G+   AT   G+
Sbjct: 187 RPDLVHMDLATR---QVPERMAQYEHIGFGKAVSFGWTSDDFGPGGVIGDPTGATADHGK 243

Query: 237 GLLSYFANCFIQLLNDINSFDVS 259
            L     +     + + + F++ 
Sbjct: 244 VLFEGAVSKVAAAIVEASVFEIG 266


>gi|292655389|ref|YP_003535286.1| creatininase [Haloferax volcanii DS2]
 gi|291371925|gb|ADE04152.1| creatininase [Haloferax volcanii DS2]
          Length = 264

 Score =  200 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 69/256 (26%), Positives = 117/256 (45%), Gaps = 9/256 (3%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   D + P   D   +  + V+PLG+ EQHGPHLP+ TD +IA  LA            
Sbjct: 1   MYIADQTWPELGDYVAESSLAVVPLGSTEQHGPHLPLATDHLIAEALAREAADRTG---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
             C P   +G S  H    GT  +   +  ++  ++   +   GI ++V +NAHGGN   
Sbjct: 57  YLCTPTVNVGVSPHHRQFHGTMWVDPPQFRDYVESLTRNLAYHGIDRVVFVNAHGGNVQH 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V    R   +M  +   W        +++      G HGG  ETSM++ +A  LV+ 
Sbjct: 117 LREVGRRLRDDGTMYAIEWMWDESIP--DLVTDLFDHPGPHGGPKETSMIMHIARDLVRE 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
              ++        L +  +LR HG+ +F +   + +  GV G+  DA+ + GE L    A
Sbjct: 175 GELDSARDGGVVDLGD-DHLREHGARTF-YDAIENSGNGVFGDQTDASPEAGEELFEAAA 232

Query: 244 NCFIQLLNDINSFDVS 259
           +  ++LL+ ++   + 
Sbjct: 233 DQLVRLLSWLDDQPID 248


>gi|326331115|ref|ZP_08197412.1| creatininase [Nocardioidaceae bacterium Broad-1]
 gi|325951081|gb|EGD43124.1| creatininase [Nocardioidaceae bacterium Broad-1]
          Length = 261

 Score =  200 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 77/255 (30%), Positives = 114/255 (44%), Gaps = 6/255 (2%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTII--AAGLAERIKSILPPRL 62
             F D + P  A+   D + VL LGA EQHGPHLP++TD +I   A  A           
Sbjct: 6   PRFADLTAPEIAELPPDTVAVLGLGAIEQHGPHLPVSTDYVIAAEAASAAVAAVAEAGSA 65

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            V  +       S EH +  GT  L++   +   + I  ++   GI +++ +N HGGNS 
Sbjct: 66  SVVLLEPLAYTKSDEHSWSPGTIWLSWDTLMRVLVDIGRSLSASGITRLLFVNGHGGNSA 125

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIIS-FPETEIGIHGGEIETSMMLALAPHLV 181
           L  + S E R +F +       S      G  S   E  +GIHGG  ETSMML L P LV
Sbjct: 126 LGQVASRELRKQFGLATFFAHLSVPPDQGGTSSRADELGLGIHGGHGETSMMLHLRPELV 185

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
             +  E    +  E L  ++++      SFGW   D    G +G+   AT + G+     
Sbjct: 186 HQERGER---KVPEQLAGYRHIGFGKPVSFGWLSDDFGTDGYLGDPTTATAEDGKARFEA 242

Query: 242 FANCFIQLLNDINSF 256
                 +++ + + F
Sbjct: 243 GVATLAEVIVEASRF 257


>gi|149174398|ref|ZP_01853025.1| creatinine amidohydrolase [Planctomyces maris DSM 8797]
 gi|148846943|gb|EDL61279.1| creatinine amidohydrolase [Planctomyces maris DSM 8797]
          Length = 250

 Score =  200 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 61/261 (23%), Positives = 111/261 (42%), Gaps = 14/261 (5%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           + + + +     +  R++ +V+LP+ A EQHGPH+P  TD II   +AE+++  L  +  
Sbjct: 1   MKYAEMTAVELKNISREETLVILPIAAVEQHGPHMPTGTDDIICTAVAEKVEERLKEK-- 58

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +  +P   +G S  H+    T T            I +++ K G R+++ILN HGGN   
Sbjct: 59  IVLLPTLWLGASQHHLRWGATLTSRVENYETLLCEICESLLKDGFRRVMILNGHGGNIGP 118

Query: 124 VSIVSTEARMRFSM--LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           + I     ++ F    L+ ++ WS        +   + +   H  E ETS+++ L P LV
Sbjct: 119 MQIALRRLQVDFPNCQLLAASYWSIAEEEIASVMQGDCKTVGHACEAETSLIMYLRPELV 178

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           +    ENF     + +                 M      G  G    A+ +KG+ + S 
Sbjct: 179 RSARVENFDDYAPDVVD---------GVYVCRDMFQRTSAGATGRPDLASAEKGDKMFSQ 229

Query: 242 FANCFIQLLNDINSFDVSIFD 262
                  ++  +    +S + 
Sbjct: 230 IVKRVSDVIGHLTEEPLSNYP 250


>gi|310816505|ref|YP_003964469.1| creatininase subfamily [Ketogulonicigenium vulgare Y25]
 gi|308755240|gb|ADO43169.1| creatininase subfamily [Ketogulonicigenium vulgare Y25]
          Length = 261

 Score =  199 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 87/256 (33%), Positives = 138/256 (53%), Gaps = 1/256 (0%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           P   ++D        +  D + +LP+GA EQHGPHLP+NTD+++A  +A R+ +      
Sbjct: 2   PHQYWSDLRATDFNASLHDAVALLPVGATEQHGPHLPLNTDSLLAEEMA-RLSAAHAASA 60

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            V  +P   +  S EH++  GT TL  A  +     I  ++ + GIR++V +NAHGGN P
Sbjct: 61  TVLILPTIAVAKSDEHIHFPGTLTLDGATLLAVLEQIGASVARAGIRRLVCINAHGGNVP 120

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           ++ ++    R++  ML V+  W     P+G +S  E   GIHGG +ET+ ML   P LV 
Sbjct: 121 VLQMLVRSLRIKHDMLAVTAGWIGMGFPEGAVSPREQAEGIHGGLVETAAMLHFRPDLVD 180

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           M  A++F    S        LR  G+ + GW  +DL+P G  G+A  AT   G  L+++ 
Sbjct: 181 MTQAQHFVPASSAVAAQNTVLRMMGNVTTGWCAEDLHPAGAAGDAASATAALGAELVTHS 240

Query: 243 ANCFIQLLNDINSFDV 258
           A  F +LL+++ +  +
Sbjct: 241 AQRFGKLLDEVAAHPL 256


>gi|239834637|ref|ZP_04682965.1| Hypothetical protein OINT_2001494 [Ochrobactrum intermedium LMG
           3301]
 gi|239822700|gb|EEQ94269.1| Hypothetical protein OINT_2001494 [Ochrobactrum intermedium LMG
           3301]
          Length = 286

 Score =  199 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 68/255 (26%), Positives = 114/255 (44%), Gaps = 9/255 (3%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           M   + +   + P   +   +   + +LP+G+ EQHGPHLP+ TDT  A+  A R   ++
Sbjct: 13  MTKEVEWARMTAPDLREIAGKPGALAILPVGSLEQHGPHLPVITDTTSASAAAIRAARLV 72

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +PV  +P + +G S  H+   GT TL Y         I  +++ +G  +++I+N HG
Sbjct: 73  AEEIPVAVLPGQWLGMSEHHLPFGGTITLDYDTFSRVIRCIARSLKTLGFSRLLIVNGHG 132

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           GN   +S+   E  + F+M +V+T+       +    F       H  E E S+MLA+  
Sbjct: 133 GNIDPLSVAVRELAVEFAMPIVATTPWMLAGDEARKIFEVDNGPHHACEGEASVMLAIVG 192

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNP-KGVVGNAMDATVKKGEG 237
             V+ D        Q   +            S  +S  +  P  G  G+   AT +KGE 
Sbjct: 193 DAVRTDKFGQAFGNQQHPVDVPAD------VSRFYSFAERAPVTGTWGDPRSATAEKGER 246

Query: 238 LLSYFANCFIQLLND 252
            L   A   ++L+ +
Sbjct: 247 FLDLHARELVKLIRN 261


>gi|319791446|ref|YP_004153086.1| creatininase [Variovorax paradoxus EPS]
 gi|315593909|gb|ADU34975.1| Creatininase [Variovorax paradoxus EPS]
          Length = 275

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 81/219 (36%), Positives = 114/219 (52%), Gaps = 3/219 (1%)

Query: 4   LIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
              ++  +    A       + VLPLGA EQHGPHLP+  D+++A G+      +LP  L
Sbjct: 9   PRFWSQLTTRDFAGLDMAATVAVLPLGATEQHGPHLPLGVDSVLADGIVAASLPLLPAAL 68

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           PV  +P + IG S EH    GT TL+    I  W  I   + + G++K+V+ NAHGG+  
Sbjct: 69  PVLFLPTQQIGLSPEHARFAGTLTLSAETLIRMWREIGAGVARAGVKKLVLFNAHGGHVG 128

Query: 123 LVSIVSTEARMRFSMLVVSTSWSR--FTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
            + IV+ E R    ++V S SW            S  E   G+H GEIETSMMLAL P L
Sbjct: 129 AMDIVARELRAAHGLIVYSVSWFNLPLGDAGAQFSTQEHRFGVHAGEIETSMMLALTPRL 188

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLN 219
           V+M  A++F S   +   ++  L    S   GW+M+D N
Sbjct: 189 VRMGEAKDFRSTSEKRAADYAILGNGKSAKLGWAMEDYN 227


>gi|289581905|ref|YP_003480371.1| creatininase [Natrialba magadii ATCC 43099]
 gi|289531458|gb|ADD05809.1| Creatininase [Natrialba magadii ATCC 43099]
          Length = 245

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 58/252 (23%), Positives = 104/252 (41%), Gaps = 15/252 (5%)

Query: 11  SLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVE 70
           +     +   D + V+P+G+ EQHGPH P+  D + A  +A+           V   P  
Sbjct: 7   TWTDVGELEAD-LAVVPVGSTEQHGPHAPLGADVLTAEAVADAGLERTDRD--VLRAPAI 63

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
           PIG + EH    GT  ++      +    + ++   G+ ++V++N HGGN   +  V   
Sbjct: 64  PIGVAEEHRQFPGTMWVSPDTFRSYVSEAVQSLAHHGVERVVLVNGHGGNVDALREVGAR 123

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
                    V  +W              +    HGG +ET+++  + P LV+ D  E   
Sbjct: 124 LTRDGDAYTVPFTWFNAVG-------EHSADMGHGGPLETALLRHVEPELVREDRIEEAR 176

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
              ++    +         +  +     +  GVVG+  +   ++GE LL   A   ++LL
Sbjct: 177 DGAADGWGEWTSY-----VNLAYDSAQFSENGVVGDPAEGDAERGEKLLELAAESLVRLL 231

Query: 251 NDINSFDVSIFD 262
           + +   DVS+ D
Sbjct: 232 DAVAERDVSVAD 243


>gi|239624807|ref|ZP_04667838.1| creatinine amidohydrolase family protein [Clostridiales bacterium
           1_7_47_FAA]
 gi|239521193|gb|EEQ61059.1| creatinine amidohydrolase family protein [Clostridiales bacterium
           1_7_47FAA]
          Length = 263

 Score =  199 bits (505), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 76/261 (29%), Positives = 122/261 (46%), Gaps = 13/261 (4%)

Query: 6   IFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAER---IKSILPPR 61
            +++ +        +++ IV++PLGA EQHG   P+ TD IIA  + E          P 
Sbjct: 4   RYSELTRLEMEQIDKEETIVLIPLGALEQHGNQAPLGTDDIIAQAMTEYLTQALEAEDPD 63

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
            P+   PV P+G S EH    G+ TL           I  ++   G +K+ +L  HGGN+
Sbjct: 64  FPMLIFPVIPVGLSTEHKNFCGSITLKPDTYYHLLYDICASLAHHGFKKLALLICHGGNA 123

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETE-IGIHGGEIETSMMLALAPHL 180
           P+  ++S E R    +     S   F+ P    +  E      HGGE+ETSM++A+ P L
Sbjct: 124 PIAQVLSRELRSELGISPFLLSSGAFSHPDVKATVSEGNIWDFHGGEMETSMVMAVDPSL 183

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDL-----NPKGVVGNAMDATVKKG 235
           VK++ +E          ++ + L+ +G  S GW  +D       P G+ G+   AT +KG
Sbjct: 184 VKLETSEAGIPAA---FKDNQALQPYGPVSIGWVSEDWKTEDGKPIGIGGDPSGATAEKG 240

Query: 236 EGLLSYFANCFIQLLNDINSF 256
             +L   A   +  L +I  +
Sbjct: 241 RIILKTSAEALVPGLLEIKKW 261


>gi|55377138|ref|YP_134988.1| creatinine amidohydrolase [Haloarcula marismortui ATCC 43049]
 gi|55229863|gb|AAV45282.1| creatinine amidohydrolase [Haloarcula marismortui ATCC 43049]
          Length = 256

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 64/252 (25%), Positives = 108/252 (42%), Gaps = 9/252 (3%)

Query: 5   IIFTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   D + P   D  + + + ++PLG+ EQHGPHLP+ TD +I    A            
Sbjct: 1   MYLADETWPDLDDYFETESLALVPLGSTEQHGPHLPLATDHLIGEAFAREAADRTG---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
             C P   +G S  H   +GT  +      ++  +    +   GI +++ +NAHGGN   
Sbjct: 57  YLCTPTINVGVSPHHRQFNGTMWVDAPVFRDYVESFTRNLAYHGIDRVIYVNAHGGNIEH 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V    R    +  +   W   +IP  +    E + G HGG  ET+M+  L   LV  
Sbjct: 117 LREVGRRLRDDEVLYAIEWMWDE-SIPDLVDDLFE-QNGPHGGPKETAMIQHLRSELVHD 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D  E+        +   +    +GS +F +   D    GV+G+  DAT +KG  +     
Sbjct: 175 DRLEDARDGGIPSVEAAET-NKYGSRTF-YDAADNTDNGVLGDQTDATAEKGAEMFEAAT 232

Query: 244 NCFIQLLNDINS 255
              ++L   +++
Sbjct: 233 EQLVRLCEWLDA 244


>gi|269837530|ref|YP_003319758.1| Creatininase [Sphaerobacter thermophilus DSM 20745]
 gi|269786793|gb|ACZ38936.1| Creatininase [Sphaerobacter thermophilus DSM 20745]
          Length = 260

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 66/252 (26%), Positives = 112/252 (44%), Gaps = 6/252 (2%)

Query: 7   FTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
             D S P   D R    +V+LP+G+ EQHGP+L +  D   +     R  + + PR  V 
Sbjct: 10  LADLSWPEIRDIRNQVELVLLPVGSNEQHGPNLAVKMDIAASTEFCRRASARMAPR--VA 67

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
             P  P G S  HM   GT TL+    ++  + +I ++   G  + +I+N HGGN P + 
Sbjct: 68  VAPPVPWGVSFHHMNFPGTITLSTETFVQVLVEVIASLHHHGFERFLIVNGHGGNIPAMG 127

Query: 126 IVSTEARMRFSM-LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           +    AR    +  V + S+  F  P+       +E+  H  E+E +  + L P +VK D
Sbjct: 128 VAVVRAREELDVPFVGACSYFSFPDPEIAKRHVTSEVTGHACEVEVATAMELVPDVVKRD 187

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
                    +E  R F+      + S  +    +   G +G+A  AT + G  L+    +
Sbjct: 188 ALAPG--ELTELAREFRREAQKYNVSIPYRFDQITRNGALGDATKATPEFGRELVESALD 245

Query: 245 CFIQLLNDINSF 256
            F++   ++ + 
Sbjct: 246 NFVRFCENLIAA 257


>gi|221636263|ref|YP_002524139.1| creatinine amidohydrolase [Thermomicrobium roseum DSM 5159]
 gi|221157498|gb|ACM06616.1| creatinine amidohydrolase [Thermomicrobium roseum DSM 5159]
          Length = 266

 Score =  198 bits (503), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 60/248 (24%), Positives = 107/248 (43%), Gaps = 8/248 (3%)

Query: 7   FTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
             + + P    A  +  +VV+P+G+ EQHGPH    TD+  A   + R+   + P   V 
Sbjct: 9   LWEMTWPELEAAMGEIRLVVIPVGSTEQHGPHATFATDSARAYEFSVRLAERMYPE--VL 66

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
             PV P G S  HM   GT TL+    ++    +++++ + G  + + +N HGGN P + 
Sbjct: 67  VAPVMPFGVSPHHMAFPGTITLSAETFMQVLYEVVESLAEHGFERFLFVNGHGGNRPALE 126

Query: 126 IVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
           ++    R    +L    S +              E+  H  E ETS +L LAP  V+ + 
Sbjct: 127 LLVQRLRRELDVLAAWVSITELANDVVQRGKV-AEVIGHACESETSQLLYLAPWAVREEA 185

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
                       + + +    G     +S  ++   G +G+A  A+V+ GE ++    N 
Sbjct: 186 LAPGEL----LEQAYPHASWWGPVHVAYSFDEITANGALGDARAASVEFGEQIVETALNR 241

Query: 246 FIQLLNDI 253
            ++ +   
Sbjct: 242 LVEFVEAF 249


>gi|284035547|ref|YP_003385477.1| Creatininase [Spirosoma linguale DSM 74]
 gi|283814840|gb|ADB36678.1| Creatininase [Spirosoma linguale DSM 74]
          Length = 264

 Score =  198 bits (503), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 72/261 (27%), Positives = 113/261 (43%), Gaps = 8/261 (3%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           + F++ S P   ++ KD ++VLP+ A EQHGPHL ++TDT I   LA   +  LP    V
Sbjct: 1   MTFSELSYPQI-NSHKDKVLVLPIAAMEQHGPHLSVSTDTDIVTRLAVEAEKALPN--LV 57

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P  P G S  H+   GT +L      +    +++++   G ++IV+LN HGGN   V
Sbjct: 58  LLCPTLPYGSSHHHLSFGGTMSLDPELYTQVISCLVESLILSGHQRIVLLNGHGGNITPV 117

Query: 125 SIVSTEARMRFSM-----LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
                    RF       L ++T W             E+    H  E ETS+ML L P 
Sbjct: 118 KQALAVLSRRFDASHKPTLALATYWELAGSVFAGEPPMESPALSHACEYETSLMLHLFPE 177

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            V MD AE     +      ++    +   +     + ++  G  G     T +KG+ L 
Sbjct: 178 KVWMDRAERARRPERNGYIGWEDDEPYRGVTVFKQTEFISGNGSSGEPQRGTPEKGKHLF 237

Query: 240 SYFANCFIQLLNDINSFDVSI 260
            +     +Q L    ++ +S 
Sbjct: 238 GHAVAALVQFLESFRTWPLSE 258


>gi|239813746|ref|YP_002942656.1| Creatininase [Variovorax paradoxus S110]
 gi|239800323|gb|ACS17390.1| Creatininase [Variovorax paradoxus S110]
          Length = 275

 Score =  198 bits (503), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 81/218 (37%), Positives = 111/218 (50%), Gaps = 3/218 (1%)

Query: 4   LIIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
              ++  +    A       + VLPLGA EQHGPHLP+  DT++A G+      +LP  L
Sbjct: 9   PRYWSQLTTRDFAALDVAATVAVLPLGATEQHGPHLPLGVDTVLADGIVAASLPLLPAAL 68

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           PV  +P + IG S EH    GT TL+    I  W  I   +   G++K+V+ NAHGG+  
Sbjct: 69  PVLFLPTQQIGLSPEHARFAGTLTLSAETLIRMWKEIGAGVAHAGVKKLVLFNAHGGHVG 128

Query: 123 LVSIVSTEARMRFSMLVVSTSWSR--FTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
            + IV+ E R    ++V S SW               E   G+H GEIETSMMLALAP  
Sbjct: 129 AMDIVARELRAAHGLIVYSVSWFNLPLGDAGAQFGAGEHRFGVHAGEIETSMMLALAPQQ 188

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDL 218
           V+M  A+NF S   +   ++  L    S   GW+M+D 
Sbjct: 189 VRMAEAKNFRSTSEQRAADYAILGNGKSAKLGWAMEDY 226


>gi|292654680|ref|YP_003534577.1| creatininase [Haloferax volcanii DS2]
 gi|291371142|gb|ADE03369.1| creatininase [Haloferax volcanii DS2]
          Length = 240

 Score =  197 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 55/255 (21%), Positives = 102/255 (40%), Gaps = 15/255 (5%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +  ++ +    AD     + +LP+G+ EQHGPH P+ TD + A  +AE           V
Sbjct: 1   MRLSEATWTEVADL-DGDLALLPVGSTEQHGPHAPLGTDALNAESVAEVGADAFDGE--V 57

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P  P+  + EH   DGT  ++      +    I+++   G  ++V++N HGGN   +
Sbjct: 58  VVGPTIPVSVAEEHRAFDGTLWVSPDTFRAYVRETIESLAHHGFDRVVVVNGHGGNIDAL 117

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           + +         +  V+ +W              +    HGG +ET+++    P LV+ D
Sbjct: 118 AELCRRVSRTGDVYAVAFTWFDAVG-------DHSSDMGHGGPLETALLRHTHPELVRED 170

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             +      ++    +         +      +    GVVG+       +G  L S  A+
Sbjct: 171 RIDEARDGGADRWGEWVS-----GVNLAHDSDEFTDNGVVGDPAKGDADRGAELESLAAD 225

Query: 245 CFIQLLNDINSFDVS 259
               LL+ + S  + 
Sbjct: 226 SLASLLDAVESRKLD 240


>gi|307595255|ref|YP_003901572.1| creatininase [Vulcanisaeta distributa DSM 14429]
 gi|307550456|gb|ADN50521.1| Creatininase [Vulcanisaeta distributa DSM 14429]
          Length = 245

 Score =  197 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 59/250 (23%), Positives = 107/250 (42%), Gaps = 15/250 (6%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           + + + + P      K  + +LP G  E HGPHLP+ TD ++A  +AE           V
Sbjct: 1   MRWWELTWPEFEKVDK-TVALLPTGIVEAHGPHLPLGTDALMATYIAEEAAKR----TNV 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P    G +       GT +++       +  I   + + GIR ++++N HGGN+  +
Sbjct: 56  LLLPTVWYGNTYVLDKFPGTISISNETLYMLYRDIFREVARNGIRYLIVINGHGGNADAL 115

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           ++ + +     +++++  +W      +      ET  G H  E ETS + A  P LVK  
Sbjct: 116 NMAAKDVAKETNLVIIIINWWIDLAKEARKKVLETPEG-HAAEDETSEVWAAYPDLVKWV 174

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             +  +    E        R +G   +     +     V G    A+ +KG+ +L    N
Sbjct: 175 PRDGSADEWVEA-----RFRVYGKEVYA---MEYTKA-VQGYPSRASQEKGKAILEAAVN 225

Query: 245 CFIQLLNDIN 254
             +QL+ND+ 
Sbjct: 226 EVVQLINDLR 235


>gi|325969517|ref|YP_004245709.1| creatininase [Vulcanisaeta moutnovskia 768-28]
 gi|323708720|gb|ADY02207.1| Creatininase [Vulcanisaeta moutnovskia 768-28]
          Length = 245

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 57/250 (22%), Positives = 102/250 (40%), Gaps = 15/250 (6%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           + + + +        K  + +LP G  E HGPHLP+ TD ++A  +AE           V
Sbjct: 1   MRWWELTWLDFEKVDK-TVAILPTGIVEAHGPHLPLGTDALMATYIAEEAAKR----TNV 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P    G +       GT +++       +  I   + + G+R ++++N HGGN   +
Sbjct: 56  LLLPTVWYGNTYVLDKFPGTISISNETLYMLYRDIFREVARNGVRYLIVINGHGGNVDAL 115

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           S+ + +     ++++V  +W      +      ET  G H  E ETS + A  P LVK  
Sbjct: 116 SMAAKDVAKETNLVIVIINWWIDLAKEVRKKVLETPEG-HAAEDETSEVWAAYPDLVK-- 172

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
                 S        F+              ++     V G    A+ +KG+ +L    +
Sbjct: 173 WVPRDGSADEWVEARFRIYGKEIY------AQEYTKA-VQGYPSKASPEKGKAILEAAIS 225

Query: 245 CFIQLLNDIN 254
             +QL+ND+ 
Sbjct: 226 EVVQLINDLR 235


>gi|168701038|ref|ZP_02733315.1| Creatininase [Gemmata obscuriglobus UQM 2246]
          Length = 253

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 65/261 (24%), Positives = 105/261 (40%), Gaps = 15/261 (5%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   D + P  A   K   ++LP+ A EQHG H+P+ TD+++   +  R   + P     
Sbjct: 1   MDLADLTWPAVAALPKTTPIILPIAALEQHGKHMPVFTDSMLLGEVVRRT-KLAPVATKC 59

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P++ +G S  H+   GT + +    ++    + +   + G  +I  +N HGGN    
Sbjct: 60  LFAPLQWLGNSHHHLDFPGTLSASPRVYLDLLKDLAECFIRHGFTRIAFVNGHGGNVTPY 119

Query: 125 SIVSTEARMRFSMLVVST-----SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
                E + ++             W     P   I         H  E ETSM+L L P 
Sbjct: 120 QQALFELKQQYRDRRDLLLLALTYWDAAGNPADTIPGLVQARMGHACEWETSMVLRLRPE 179

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV  D+A          +    + R        W M D +  G VG    AT +KGE L 
Sbjct: 180 LVIGDVAA---------VPEVPHGREFAPGYRAWVMPDRSEPGHVGAPSAATAEKGEALF 230

Query: 240 SYFANCFIQLLNDINSFDVSI 260
           ++FA   +  L  + ++D S 
Sbjct: 231 AHFAAGVVAYLERVVNWDGSW 251


>gi|76801704|ref|YP_326712.1| hypothetical protein NP2120A [Natronomonas pharaonis DSM 2160]
 gi|76557569|emb|CAI49151.1| conserved hypothetical protein [Natronomonas pharaonis DSM 2160]
          Length = 263

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 66/258 (25%), Positives = 104/258 (40%), Gaps = 10/258 (3%)

Query: 5   IIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   D S P          + ++P+G+ EQHGPHLP++TD +IA GLA            
Sbjct: 1   MYLGDVSWPEAGTHLDATDVALVPVGSTEQHGPHLPLSTDHVIAEGLAREAADRAG---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V C P   +G S  H    GT ++      ++  ++  ++   GI +IV +NAHGGN   
Sbjct: 57  VVCTPTITVGVSPHHRQFHGTMSVEAPVFRDYVESLSRSLVYQGIDRIVYVNAHGGNVEH 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V        +   V   W   +IP  +    E + G H G  ETSM+  LA   V+ 
Sbjct: 117 LREVGRRLHEDGAAYAVEWMWDE-SIPDLVDDLFE-QNGPHAGPKETSMVWYLA-DNVRE 173

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D   +        L + +    +      +   + +  G  G+  DAT  KGE L    +
Sbjct: 174 DELADARDGGCPALEDIRT--TYNGARLFYDAIENSDNGAFGDPTDATAAKGERLFEAAS 231

Query: 244 NCFIQLLNDINSFDVSIF 261
                L   + +      
Sbjct: 232 EQLADLAEWLAAQPWETL 249


>gi|289706068|ref|ZP_06502441.1| creatininase [Micrococcus luteus SK58]
 gi|289557270|gb|EFD50588.1| creatininase [Micrococcus luteus SK58]
          Length = 251

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 62/252 (24%), Positives = 115/252 (45%), Gaps = 3/252 (1%)

Query: 5   IIFTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           + + + + P      +   + VLP+GA EQHG  LP+ TDT+ A G+ +R+    P    
Sbjct: 1   MKYAELTSPEVQQLVEAGAVPVLPIGALEQHGRALPVGTDTLRAEGVVDRLAQRCPEG-S 59

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V  +P  P G S  H  + GT T+      +  +++ +++   G + ++I+  HGGN P 
Sbjct: 60  VVTLPPLPYGVSPHHTRLPGTVTVPARLYCDLLISLAESLADAGWQSLLIVTGHGGNRPA 119

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +++   E   R      + +           +   TE+  H GE ET+ +LAL P LV+ 
Sbjct: 120 LTLAQQELLSRRPDFRFAWAPVTGLAANATRALDTTEVSGHSGEAETAQVLALRPDLVRS 179

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           +  +  ++R  E     +  R     S   +    +P GV+G+    T + GE +L+   
Sbjct: 180 EDLKPGATRLDELAPAPRLSRVTSP-SLAVTFDQYHPTGVLGDPTAVTAEDGEAILAEVL 238

Query: 244 NCFIQLLNDINS 255
           +   + +  + +
Sbjct: 239 DRLEEYVQSLRA 250


>gi|300709806|ref|YP_003735620.1| creatinine amidohydrolase [Halalkalicoccus jeotgali B3]
 gi|299123489|gb|ADJ13828.1| creatinine amidohydrolase [Halalkalicoccus jeotgali B3]
          Length = 255

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 64/262 (24%), Positives = 102/262 (38%), Gaps = 10/262 (3%)

Query: 5   IIFTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     + P      + + + ++PLG+ EQHGPHLP  TD IIA  LA            
Sbjct: 1   MELAAQTWPELGSYFETESLALVPLGSTEQHGPHLPEGTDHIIAESLARAAADRTG---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
             C P   +G S  H    GT  +      ++  +++  +   GI ++V +NAHGGN   
Sbjct: 57  YLCTPTVNVGVSPHHRQFHGTMWVDAPVFRDYVESLVSNLTYHGIDRVVFVNAHGGNITH 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V      R     +   W        ++S    + G HGG  ET+M+  LA  LV+ 
Sbjct: 117 LREVGRRLHDREEAYAIEWMWDESIP--TLVSELFEQNGPHGGPKETAMIQHLAGELVRE 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D  E+       F  +  +          +   D +  GV G+  DAT +KG+ L     
Sbjct: 175 DRLEDAHEGGVVFPTDDSHRN---GARTFYDCIDNSANGVFGDQTDATAEKGKRLFEAAT 231

Query: 244 NCFIQLLNDINSFDVSIFDKDV 265
               +L   ++           
Sbjct: 232 EQLCELCEWLDEQPFEDLVAKP 253


>gi|289582751|ref|YP_003481217.1| creatininase [Natrialba magadii ATCC 43099]
 gi|289532304|gb|ADD06655.1| Creatininase [Natrialba magadii ATCC 43099]
          Length = 273

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 75/261 (28%), Positives = 112/261 (42%), Gaps = 12/261 (4%)

Query: 4   LIIFTDNSLPLCADARK---DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
            +    ++ P  AD  +   + + V+PLG+ EQHGPHLP  TD +IA  LA         
Sbjct: 5   RMYLPAHTWPDLADYIESESESLAVVPLGSTEQHGPHLPEGTDHMIAEALARAATEQTG- 63

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
                C P   IG S  H    GT  +      ++   +   +   GI +IV +NAHGGN
Sbjct: 64  ---YLCTPPISIGVSSHHRQFHGTMWVDAPVFRDYVENLSRNLTYHGIDRIVYVNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
              +  V        +   +   W   +IP  I    ET  G HGG  ET+M++ +A  L
Sbjct: 121 VAHLREVGRRLHQDETAYAIEWMWDE-SIPNLIEEVFETP-GPHGGPKETAMIMHIANEL 178

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+ D  E       +F  +    R HG+ +F +   + +P GV G+  DAT + GE L  
Sbjct: 179 VREDRLEEARDGGVDF--DGDAARVHGATTF-YDAIENSPNGVFGDQTDATPEVGEQLFD 235

Query: 241 YFANCFIQLLNDINSFDVSIF 261
                 + LL  ++       
Sbjct: 236 AATEQLVALLEWLDEQPFEAL 256


>gi|76800861|ref|YP_325869.1| hypothetical protein NP0414A [Natronomonas pharaonis DSM 2160]
 gi|76556726|emb|CAI48298.1| conserved hypothetical protein [Natronomonas pharaonis DSM 2160]
          Length = 242

 Score =  195 bits (495), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 98/257 (38%), Gaps = 17/257 (6%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP--RL 62
           +  ++ +     DA    + VLP+G+ EQHGPH P+  D + A  +AE            
Sbjct: 1   MHLSEATWTDIRDAT-TDLAVLPVGSTEQHGPHAPLGVDWLTAEAIAEAGVDRYADTHGE 59

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
                P  P+G + EH   DGT  ++      +    + ++   G  ++VI+N HGGN  
Sbjct: 60  KPLVGPTIPVGVAEEHRDFDGTLWVSPDTFRSYVGETVASLASHGFERVVIVNGHGGNVD 119

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            ++ V            V  +W        +          HGG  ET++M  L P LV+
Sbjct: 120 ALNEVCARLTRDGDAYAVQYTWFDAVDFASL---------GHGGPAETAVMRHLHPELVR 170

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
            D  +  +   ++    +         +           G VG+  +     GE L    
Sbjct: 171 EDRTDTAAEGAADSWGEWVS-----GTNLAVDSSSFTESGAVGDPREGDADLGEELFEKA 225

Query: 243 ANCFIQLLNDINSFDVS 259
           A   ++LL+ +    ++
Sbjct: 226 AAALVELLDAVERRSLA 242


>gi|292653840|ref|YP_003533738.1| creatininase [Haloferax volcanii DS2]
 gi|291369998|gb|ADE02226.1| creatininase [Haloferax volcanii DS2]
          Length = 266

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 66/252 (26%), Positives = 110/252 (43%), Gaps = 4/252 (1%)

Query: 7   FTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   +     +  A+   I+V+P+G+ EQHG HLP+ TD+++   + +         LPV
Sbjct: 13  WAGLTAAEVREVGAKPGSILVIPVGSIEQHGEHLPVVTDSLLVEAMVDSAVEQT-DGLPV 71

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P    G+S  H+   GT +L +         I     +     ++ +N HGGN PL+
Sbjct: 72  VVSPTVWSGFSPHHLTFGGTLSLDFETIRATLEDIAHTGLQNDFDAVLFVNGHGGNGPLI 131

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQ-GIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
             V +   +     V+ T++      +   +   ET    HGGE ETS+MLA+ P LV  
Sbjct: 132 GSVVSTVGVETDAEVLGTTYFELATDRIEALRDTETGGMAHGGEFETSLMLAVRPDLVGD 191

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
               N       +  + + L   GS S   S    +  G +G   +A+ +KGE + S  A
Sbjct: 192 SSTRNGEPLNESYRWSGQDLLDGGSVSVYRSFDTYSETGAIGLPEEASAEKGERIRSIIA 251

Query: 244 NCFIQLLNDINS 255
                LL+ ++ 
Sbjct: 252 EELASLLDAVHE 263


>gi|153814200|ref|ZP_01966868.1| hypothetical protein RUMTOR_00409 [Ruminococcus torques ATCC 27756]
 gi|317499996|ref|ZP_07958232.1| hypothetical protein HMPREF1026_00174 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331087773|ref|ZP_08336699.1| hypothetical protein HMPREF1025_00282 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145848596|gb|EDK25514.1| hypothetical protein RUMTOR_00409 [Ruminococcus torques ATCC 27756]
 gi|316898713|gb|EFV20748.1| hypothetical protein HMPREF1026_00174 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330409754|gb|EGG89190.1| hypothetical protein HMPREF1025_00282 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 247

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 58/246 (23%), Positives = 100/246 (40%), Gaps = 17/246 (6%)

Query: 9   DNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           D +     +  R+  +V++P+G+ EQHG HLP+ TD  +A  LAE+              
Sbjct: 7   DMTWREVQERLREFPVVIVPIGSTEQHGYHLPIGTDVYLAEALAEKTAEKTG----ALVY 62

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P    GYS       GT T+      E    ++ ++ + G++ ++ +N H  N  ++   
Sbjct: 63  PSIHFGYSWSWRDRIGTVTIRQDILREILKDVVRSVERYGVKILIFMNGHEANRSVIKYA 122

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI-HGGEIETSMMLALAPHLVKMDLA 186
             E +    + V+   +              T  G+ H  E ETS+MLA+ P  V M+ A
Sbjct: 123 IREIQDETDVKVLGMFYPGMEEIYDKYMETPTWGGMFHACEFETSLMLAVKPETVHMERA 182

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                 +                    S+ +L+  G  GN + AT +KGE +L  F    
Sbjct: 183 VQEYPVRPTTYGMDNT-----------SIGELSVSGTYGNPVPATEEKGEMMLEQFTENI 231

Query: 247 IQLLND 252
             ++ +
Sbjct: 232 SAVIEE 237


>gi|218283133|ref|ZP_03489212.1| hypothetical protein EUBIFOR_01798 [Eubacterium biforme DSM 3989]
 gi|218216082|gb|EEC89620.1| hypothetical protein EUBIFOR_01798 [Eubacterium biforme DSM 3989]
          Length = 253

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 71/255 (27%), Positives = 122/255 (47%), Gaps = 12/255 (4%)

Query: 7   FTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL-PPRLPV 64
           + + +        R++ IV++PLGA EQHG   P+ TDT+IA  + + I+  L    + +
Sbjct: 5   YQELTRLEMEQVDRENTIVLIPLGALEQHGNQAPLGTDTLIAGAMCDYIEKELKDEDINL 64

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              PV P+G S EH    G+ T            I +++   G +K+  L  HGGN+P+ 
Sbjct: 65  VLFPVIPVGLSTEHKDFCGSITFKPMTYYHMLYDICESLAHHGFKKLAFLVCHGGNTPIA 124

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETE-IGIHGGEIETSMMLALAPHLVKM 183
           +++S E R  F +     +   F  P    +  +      HGGE+ETSM++A+   LVK+
Sbjct: 125 NLISREVRSDFKVYPFVLNSGAFDHPDVKATISKGNTFDFHGGEMETSMVMAIDESLVKL 184

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           + +E    + +    +  +L +       W  ++  P G+ GN   AT +KGE +L+  A
Sbjct: 185 ETSEKGILKNTAMKAHLSWLASD------WVTEEGKPIGIGGNPSGATKEKGEIILTISA 238

Query: 244 NCFIQ---LLNDINS 255
              ++   L+ D   
Sbjct: 239 KEIVKDLILIRDFKE 253


>gi|257051635|ref|YP_003129468.1| Creatininase [Halorhabdus utahensis DSM 12940]
 gi|256690398|gb|ACV10735.1| Creatininase [Halorhabdus utahensis DSM 12940]
          Length = 260

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 63/256 (24%), Positives = 104/256 (40%), Gaps = 9/256 (3%)

Query: 5   IIFTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   D + P  +   + + I ++PLG+ EQHGPHLP  TD +IA   A            
Sbjct: 1   MYLADAAWPDLSSYFESESIALIPLGSTEQHGPHLPEGTDHLIAEAFATEAADRTG---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               P   IG S  H    GT ++      ++  +   ++   GI +++ +NAHGGN   
Sbjct: 57  FLRTPPVRIGVSPHHQQFPGTMSVDPPAFRDYVESFTRSLTNHGIDRVIYVNAHGGNITH 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V    R   ++  V   W      Q    F     G HGG  ET+++  L P LV  
Sbjct: 117 LREVGRRLREDGTVFAVEWMWDESIPEQVNDVFDH--NGPHGGPKETALIQHLHPDLVHE 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
              E+          +    R HG+ +F +   + +  GV G+  +AT + G  L    +
Sbjct: 175 GRLEDARDGGR-VEVSQDVGRVHGARTF-YDSIENSENGVFGDQTEATAEIGAELFDAAS 232

Query: 244 NCFIQLLNDINSFDVS 259
           +  + L   ++     
Sbjct: 233 DELVALAEWLDEQPFE 248


>gi|160937890|ref|ZP_02085248.1| hypothetical protein CLOBOL_02784 [Clostridium bolteae ATCC
           BAA-613]
 gi|158439116|gb|EDP16870.1| hypothetical protein CLOBOL_02784 [Clostridium bolteae ATCC
           BAA-613]
          Length = 275

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 64/258 (24%), Positives = 104/258 (40%), Gaps = 6/258 (2%)

Query: 1   MNPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M     + + +       A ++ +V++PLGA EQHGPHLP  TD+++A    +     L 
Sbjct: 21  MKHPYRWDNLNREELRKLAEENTLVLIPLGATEQHGPHLPAGTDSMLAEAACDIAAKKLD 80

Query: 60  P-RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
                    P   I  S+ H    GT +L     +++  +I   I   G R I  +N HG
Sbjct: 81  EMGRHAVIAPTVTISNSLHHGSYPGTLSLDPRLYMDYLTSIARGIVSHGFRNICCVNGHG 140

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           GN     +   +   R+ + +    +                   H  E+ETS+MLAL  
Sbjct: 141 GNGTPTDMAVMDIVTRYGIHISWVPYYVGCNGDFEAILDTQSNIFHADEVETSLMLALDE 200

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV     E   ++     +   + R     +F    +     G++GN+  AT +KGE L
Sbjct: 201 SLVDPCYKE---AKGGNVQKGTPHGRPGRPFTF-LPFETRTETGILGNSYAATREKGEQL 256

Query: 239 LSYFANCFIQLLNDINSF 256
               A+  +Q L D   +
Sbjct: 257 WEAVASHLVQALLDPELW 274


>gi|332531629|ref|ZP_08407526.1| creatininase [Hylemonella gracilis ATCC 19624]
 gi|332038992|gb|EGI75421.1| creatininase [Hylemonella gracilis ATCC 19624]
          Length = 256

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 93/253 (36%), Positives = 130/253 (51%), Gaps = 4/253 (1%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
              R   I VLPLGA EQHGPHLP++ D  +  G+       L   LPV  +P + +G+S
Sbjct: 3   EAQRARVIAVLPLGATEQHGPHLPLSVDHDLVNGVVAASLPHLG-DLPVLFLPTQDVGFS 61

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            EH    GT TL  +  I  W A+ +++ + G+RK+V+LNAHGG   L+ +V+ + R R 
Sbjct: 62  PEHQAYPGTLTLPASLVIGLWTALGESVARAGVRKLVLLNAHGGQVGLLDVVARDLRARL 121

Query: 136 SMLVVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            +LV S +     +P    G+ S  E   GIH G+IET+MMLAL P  V+M  A  F S 
Sbjct: 122 GVLVYSVNTFNLPLPPEVDGLFSAQEHRYGIHAGQIETAMMLALTPQRVRMAQARRFDSA 181

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
                  F  L    S    W M+D NP G VG+A  AT ++G  LL         LL++
Sbjct: 182 SQARAARFPILGNGRSAKLAWQMQDYNPAGAVGDAAAATAEQGHALLEAQGRALAALLDE 241

Query: 253 INSFDVSIFDKDV 265
           I+    +   +  
Sbjct: 242 IDRLPANTLVEGP 254


>gi|322372116|ref|ZP_08046658.1| Creatininase [Haladaptatus paucihalophilus DX253]
 gi|320548538|gb|EFW90210.1| Creatininase [Haladaptatus paucihalophilus DX253]
          Length = 266

 Score =  192 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 65/255 (25%), Positives = 115/255 (45%), Gaps = 5/255 (1%)

Query: 3   PLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
             + +   +     D  A    ++V+P+G+ EQHG HLP++TDT++A  +A R       
Sbjct: 8   SAVAWAAKTRREIRDVGAADGSVLVVPVGSIEQHGHHLPVSTDTLLADAVAHRGAERAAD 67

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            +P+   P    G+S  H+ + GT +L   + ++    + D   + G   +  +N HGGN
Sbjct: 68  DVPILVTPPVWSGFSPHHLSLGGTISLELDDLLDALADVADTALENGFDGLCFVNGHGGN 127

Query: 121 SPLVSIVSTEARMRFSML-VVSTSWSRFTIP-QGIISFPETEIGIHGGEIETSMMLALAP 178
           +  ++   +        + V   ++ +   P    I   ET    HGGE ETS+ML L P
Sbjct: 128 AAAINNAVSIVGKSHPDVEVAGLTYFQLAEPFVDEIRESETGGMSHGGEFETSLMLHLHP 187

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV+M+ A +       + R  K L   G  +     ++ +  G +G+   A  +KGE L
Sbjct: 188 ELVRMEDA-DAEYLDEPYDRGTKDLLVGGPLATYRPFEEYSDTGAIGDPKLANAEKGEKL 246

Query: 239 LSYFANCFIQLLNDI 253
           L    +    +  ++
Sbjct: 247 LDRLTDELADVFRNV 261


>gi|269121094|ref|YP_003309271.1| creatininase [Sebaldella termitidis ATCC 33386]
 gi|268614972|gb|ACZ09340.1| Creatininase [Sebaldella termitidis ATCC 33386]
          Length = 243

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 58/252 (23%), Positives = 100/252 (39%), Gaps = 21/252 (8%)

Query: 5   IIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           + + + +     +  +   + +LPLGA E HGPHLP+ TD  ++  +AE     L   + 
Sbjct: 1   MKYQEQNSKEIKEIIEKVKVAILPLGAVEAHGPHLPLGTDNYLSEKIAE----KLSENVE 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               P  P G         G+ +L+    I     I  ++ K G +   I+N H GN   
Sbjct: 57  CLVFPTLPYGQVWSLEEFPGSVSLSNETLINMLYEIGKSMYKNGFKIFGIINGHLGNGTA 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI----HGGEIETSMMLALAPH 179
           +     +    FS    + ++      + I    ET+       H  E+ETS ML LA  
Sbjct: 117 IKEAQRKLFSEFSDF-KTFNFFYTGTDKVIQEVRETQKLHKNYFHADELETSYMLYLADE 175

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            V+M  A N +    E++               W+  +     V+G+A  AT +KG+ ++
Sbjct: 176 YVEMSKAINGNPDYPEYIDI---------TPVRWT--EFTDTAVMGDATLATKEKGKKIV 224

Query: 240 SYFANCFIQLLN 251
                    ++ 
Sbjct: 225 DTAVKNMSDIIK 236


>gi|323485314|ref|ZP_08090663.1| hypothetical protein HMPREF9474_02414 [Clostridium symbiosum
           WAL-14163]
 gi|323694073|ref|ZP_08108253.1| creatinine amidohydrolase [Clostridium symbiosum WAL-14673]
 gi|323401350|gb|EGA93699.1| hypothetical protein HMPREF9474_02414 [Clostridium symbiosum
           WAL-14163]
 gi|323501875|gb|EGB17757.1| creatinine amidohydrolase [Clostridium symbiosum WAL-14673]
          Length = 264

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 79/263 (30%), Positives = 125/263 (47%), Gaps = 14/263 (5%)

Query: 5   IIFTDNS-LPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP---- 59
             + D +   +    +++ IV++PLGA EQHG   P+ TD IIA  + + I+  L     
Sbjct: 3   RNYRDLTRWEMEQIDKEETIVLIPLGALEQHGSQAPLGTDDIIAEAMTKEIQKALEEEGE 62

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
              P+   PV P+G S EH    G+ T+           I  ++   G +K+  L  HGG
Sbjct: 63  DDFPMLVFPVIPVGLSTEHKNFCGSITVKPDTYYHMLYDISISLAHHGFKKLAFLICHGG 122

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETE-IGIHGGEIETSMMLALAP 178
           N+P+V ++S E R    +     +   FT P    +  E      HGGE+ETSM++A+  
Sbjct: 123 NAPIVQVLSRELRSELGISPFILTSGAFTHPDVTATISEGNIWDFHGGEMETSMVMAVDE 182

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDL-----NPKGVVGNAMDATVK 233
            LVK++L+E       E   + K L+ +G+ S GW  +D       P G+ G+   AT +
Sbjct: 183 SLVKLELSEAGIPSAFE---HNKALKPYGNVSIGWVSEDWKTKDGKPIGIGGDPSGATAE 239

Query: 234 KGEGLLSYFANCFIQLLNDINSF 256
           KG  +L   A   +  L +I  +
Sbjct: 240 KGRIILETSARVLVPGLKEIREW 262


>gi|110667713|ref|YP_657524.1| hypothetical protein HQ1759A [Haloquadratum walsbyi DSM 16790]
 gi|109625460|emb|CAJ51887.1| conserved hypothetical protein [Haloquadratum walsbyi DSM 16790]
          Length = 243

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 62/255 (24%), Positives = 106/255 (41%), Gaps = 15/255 (5%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   D +         + + +LP+G+ EQHGPH P+ TDT  A  +A+           V
Sbjct: 1   MHIEDETWTDLETTDTN-LGLLPIGSTEQHGPHAPLGTDTFDAEVIAQNAAEEYSD--SV 57

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P  P+G + EH    GT         ++   I+ ++   G   +VI+N HGGN P +
Sbjct: 58  IVAPSVPVGIAEEHREFTGTLWTDEMTFRQYVRDIVRSLASHGWDHVVIVNGHGGNIPAL 117

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             V+ +     +   V  +W              T    H G IETS++    P  V  D
Sbjct: 118 EAVTAQIIRHDNAYAVPFTWFEAIG-------EHTSSMGHAGPIETSLLERTRPESVHTD 170

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
              + ++  S+   +++     GS +      +    GVVG+  +A+ + G  LL+   +
Sbjct: 171 RLTDAAAGASDRWGDWQ-----GSVNLAVDSTEFTENGVVGDPREASAELGAELLTAATD 225

Query: 245 CFIQLLNDINSFDVS 259
               LL+ + S D +
Sbjct: 226 ELCSLLDAVRSHDAA 240


>gi|145591227|ref|YP_001153229.1| creatininase [Pyrobaculum arsenaticum DSM 13514]
 gi|145282995|gb|ABP50577.1| Creatininase [Pyrobaculum arsenaticum DSM 13514]
          Length = 242

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 61/251 (24%), Positives = 103/251 (41%), Gaps = 17/251 (6%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           + + + + P      K  + VLP+G  E HGPHLP+ TD ++A  +AE+          V
Sbjct: 1   MRWAELTWPDFERVDKK-VAVLPVGVIEAHGPHLPLGTDALMALYVAEKAAEEAG----V 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P    G +       GT +++       +  +   + + G+R +V++N HGGN   +
Sbjct: 56  LLLPPIWYGSTYVLEKFPGTISISGETLYRLYKEVFMEVARNGVRYLVVVNGHGGNIDAL 115

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
            + + +      + +V  +W      +      ET  G H  E ETS ++A  PHLVK  
Sbjct: 116 KMAAKDVAKSTYLNIVLVNWWIDLAKEARRKVLETPEG-HAAEDETSEVMAAYPHLVKE- 173

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
                  R ++     KY     +         +  K V G    A+ +KGE +L     
Sbjct: 174 -----IPRDADEWAEAKY-----AVYGARVYAMMYKKAVQGYPSRASREKGEAILKAAVE 223

Query: 245 CFIQLLNDINS 255
               LL D+  
Sbjct: 224 ELKSLLEDLKK 234


>gi|313122468|ref|YP_004038355.1| uncharacterized protein, amidase [Halogeometricum borinquense DSM
           11551]
 gi|312296812|gb|ADQ69408.1| uncharacterized protein, putative amidase [Halogeometricum
           borinquense DSM 11551]
          Length = 269

 Score =  191 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 62/238 (26%), Positives = 100/238 (42%), Gaps = 3/238 (1%)

Query: 20  KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHM 79
              ++V+P+G+ EQHG HLP+ TDT++A  +A      +   +P+   P    GYS  H+
Sbjct: 29  DGSVLVVPVGSIEQHGAHLPVATDTLLAERVATASAKRIVADVPILVAPSVRPGYSPHHL 88

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
            V GT +  +   ++    + +     G   +V +N HGGN+ L+    +E         
Sbjct: 89  PVGGTLSAGFETLLDLLRDMAETGLDNGFDALVFVNGHGGNTSLIDAAVSEIGREHPDRE 148

Query: 140 VSTSWSRFTIPQGIISFPETEIGI--HGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
           +        +     +  E+++G   HGGE ETSMML L P LV  D           + 
Sbjct: 149 ILGLTYFELVADLAATVRESDLGGMAHGGEFETSMMLHLFPELVDTDEMPAEY-WDEHYE 207

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           +    L   G  S   S  + +  G +G+   A    G  L          LL D++ 
Sbjct: 208 QGGADLVVGGPLSVYRSFDEYSESGAIGDPSVADENTGRQLFDGAVTALSDLLTDVHE 265


>gi|222479810|ref|YP_002566047.1| Creatininase [Halorubrum lacusprofundi ATCC 49239]
 gi|222452712|gb|ACM56977.1| Creatininase [Halorubrum lacusprofundi ATCC 49239]
          Length = 257

 Score =  191 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 69/258 (26%), Positives = 114/258 (44%), Gaps = 9/258 (3%)

Query: 5   IIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   D++ P   +A  D  + ++PLG+ EQHGPHLP+ TD +IA    E + S       
Sbjct: 1   MYLADHTWPELGEALSDESVALVPLGSTEQHGPHLPLATDHLIA----EALASAAAEETG 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               P   +G S  H    GT  +   E  ++       +   GI ++V +NAHGGN   
Sbjct: 57  AVRTPTVTVGVSPHHRQFPGTMWVDPPEFRDYVEGFTRNLAYHGIDRVVFVNAHGGNVQH 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V        +   +   W   +IP+ +    E   G H G  ET+M+  +AP LVK 
Sbjct: 117 LREVGRRLHEDETAYAIEWMWDE-SIPELVDDLFEHN-GPHAGPKETAMITHIAPELVKT 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D  E+        L     +  HG+ ++ +   D +  G  G+  D T +K E L    +
Sbjct: 175 DRLEDARDDGLVHLDESDAV-VHGARTY-YDAVDNSANGAFGDPTDVTPEKAERLFEAAS 232

Query: 244 NCFIQLLNDINSFDVSIF 261
           +  +QL+  +++ D +  
Sbjct: 233 DQLVQLVEWLDARDRAEL 250


>gi|300783911|ref|YP_003764202.1| creatinine amidohydrolase [Amycolatopsis mediterranei U32]
 gi|299793425|gb|ADJ43800.1| creatinine amidohydrolase [Amycolatopsis mediterranei U32]
          Length = 263

 Score =  191 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 83/257 (32%), Positives = 118/257 (45%), Gaps = 6/257 (2%)

Query: 4   LIIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIK-SILPPR 61
               T+ + P  A    ++ IVVLP GA E HGPHLP++TD +IA  +A+      +   
Sbjct: 2   NRAITELAGPSLANRIGQESIVVLPTGAIEHHGPHLPLSTDALIAEAVADAAVERAVAAG 61

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           + V  +P      S EH +  GT  L         + I  A+  MG   +V +N HGGN 
Sbjct: 62  VDVWQLPTLTYTKSDEHSWAPGTVWLDTETLFRTVVEIGRAVELMGAGTLVFVNGHGGNV 121

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            L+ +   E R RF +          T P       E ++GIHGG  ETS++L L P LV
Sbjct: 122 ALLQVALREIRKRFGLKTFLMPSLARTDPPAGEGLDERDLGIHGGAAETSLVLHLRPDLV 181

Query: 182 KMDLAENFSSRQSEFLRNFKYLRA-HGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
            +  AE       E L +F+++       SFGW   D    GVVG+   AT   GE L  
Sbjct: 182 DLSRAER---WVPEHLADFRHIGFNTRPVSFGWLSNDFGTPGVVGDPTQATPAYGEVLWE 238

Query: 241 YFANCFIQLLNDINSFD 257
              +  ++ L +I  F+
Sbjct: 239 ASVHQAVESLLEITRFE 255


>gi|261420299|ref|YP_003253981.1| creatininase [Geobacillus sp. Y412MC61]
 gi|319767108|ref|YP_004132609.1| creatininase [Geobacillus sp. Y412MC52]
 gi|261376756|gb|ACX79499.1| Creatininase [Geobacillus sp. Y412MC61]
 gi|317111974|gb|ADU94466.1| Creatininase [Geobacillus sp. Y412MC52]
          Length = 243

 Score =  191 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 61/239 (25%), Positives = 95/239 (39%), Gaps = 20/239 (8%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
              K  I ++P+GA E HGPHLP+ TDTI+A  LA R+   +        +PV P G   
Sbjct: 14  KITKSSIAIMPIGAVEAHGPHLPLCTDTILAERLACRLAEKVE----GFVLPVIPYGQVW 69

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
                 G+ +++    I   + I  ++ K G R   ++N H GN   +   +     +F 
Sbjct: 70  SLRDFPGSISISNETLIRLLVEIGTSLYKQGFRIWAMVNGHLGNQTALKEAARILYDQFP 129

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGI----HGGEIETSMMLALAPHLVKMDLAENFSSR 192
               +  +    + + +    ETE       H  EIETS+ML LA   V M  A      
Sbjct: 130 NF-KTFYFFYPGMNKVVNEIRETEAIHSVYFHACEIETSIMLYLAEEYVDMSKAICDIPN 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
             E                    K      V+G+A  AT +KG+ ++    +    +L 
Sbjct: 189 IDEEADVSPT-----------PWKSFTQTAVLGDATKATKEKGKIIVETALDKMAYMLR 236


>gi|253578650|ref|ZP_04855921.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849593|gb|EES77552.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 253

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 60/262 (22%), Positives = 113/262 (43%), Gaps = 17/262 (6%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     +     +A  KD I+V+P+G+ EQHG    + TD ++ + LA+ +         
Sbjct: 1   MYLAKMTTAQAKEAFEKDPIIVIPVGSTEQHGTQGALGTDFMVPSYLADHV----EDVDN 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G    H+  +G+  + Y         I+D++ + G ++ V+LN HGGN+P 
Sbjct: 57  VIVAPTVPYGVCPYHLSFEGSINIGYEGLYMVLHGIMDSLMQHGAKRFVVLNGHGGNTPS 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +   + E   +  +      WS                G HG  +ETS M+A+AP  V +
Sbjct: 117 IDRAALEVYHKGGVCASVDWWSLVAQLDKKFD------GGHGDVLETSAMMAIAPESVHL 170

Query: 184 DLAENFSSRQSEFLRNFKYLRA----HGSHSFGWSMKDLNPKGVVG--NAMDATVKKGEG 237
           +L++  +++         Y++A     G        K++ P G  G  +  D++ + G+ 
Sbjct: 171 ELSKPINAQDPSENMKAAYIQAVNFKGGIVRLVRDTKEIAPSGWFGPFDPKDSSAELGQE 230

Query: 238 LLSYFANCFIQLLNDINSFDVS 259
            L    +     L ++   ++S
Sbjct: 231 ALDLAVSYIRDFLEEMKQIELS 252


>gi|296532243|ref|ZP_06894988.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296267428|gb|EFH13308.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 270

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 70/253 (27%), Positives = 117/253 (46%), Gaps = 11/253 (4%)

Query: 6   IFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
            +   + P     A +D +V+LP+ + EQHGPHLP+ TD++I    A    + L   LPV
Sbjct: 8   RWERLTAPELRALAARDALVLLPVASLEQHGPHLPVWTDSLIGHA-ACLRAAALASDLPV 66

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P   +G S  H+   GT +L Y         +  +++  G  ++ ++N+HGGN   +
Sbjct: 67  VVLPPMWLGLSEHHLPFGGTISLDYDAMHRVLRGVCRSLKAQGFGRLFLVNSHGGNIDPL 126

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           ++ + E    F+M VV+ +  R  +P             H  E ETS+++ LAP LV+  
Sbjct: 127 AVAARELCAEFAMPVVAGTVFRLDMPGIAALLDTQPGVQHACEAETSLVMHLAPELVRRK 186

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPK-GVVGNAMDATVKKGEGLLSYFA 243
              N  S  +       +          WS  +  P  GV+G+   AT +KGE LL+  A
Sbjct: 187 EIANALSGPAVPAPEGLH--------RFWSFAERAPDTGVIGDPRAATAEKGEKLLAVMA 238

Query: 244 NCFIQLLNDINSF 256
              +  + D  ++
Sbjct: 239 ASLVAAMRDPVAW 251


>gi|78486140|ref|YP_392065.1| creatininase [Thiomicrospira crunogena XCL-2]
 gi|78364426|gb|ABB42391.1| Creatinine amidohydrolase [Thiomicrospira crunogena XCL-2]
          Length = 255

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 68/264 (25%), Positives = 102/264 (38%), Gaps = 22/264 (8%)

Query: 7   FTDNSLPLCADARKDWI--VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   +    +      +   +LP+GA EQHGPHL    D+ IA  LAE++      +  V
Sbjct: 4   WHQMTWEEISRLVSSGVDSALLPVGATEQHGPHLGCGMDSEIANQLAEKV----SGQTDV 59

Query: 65  TCMPVEPIGYSIEHM-YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
             +P  P G SI H     GT  L     I+    I D +   G +++ ILN+H  N   
Sbjct: 60  ALLPTLPYGCSIGHSERWPGTIALQPKTLIDVVKEIGDWVHASGFKRLFILNSHVSNFAP 119

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +       R      +V+   S     +      E     H  E ETS+M+ALAP LV+ 
Sbjct: 120 LRCALEMLRAEHDGFMVALVNSSTVSERVKARHFEDAEDWHANEAETSLMMALAPQLVRD 179

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D  ++               R  G   F   +   +  GV G    ATV+KG  L  +  
Sbjct: 180 DKLQDSDDPD----------RTEGCV-FSHPVNRTSMNGVTGCPSLATVEKGHELFDWMV 228

Query: 244 NCFIQLLN----DINSFDVSIFDK 263
                ++     + +      FDK
Sbjct: 229 EDLSCVVKKGMSETSPLPYGYFDK 252


>gi|257387008|ref|YP_003176781.1| creatininase [Halomicrobium mukohataei DSM 12286]
 gi|257169315|gb|ACV47074.1| Creatininase [Halomicrobium mukohataei DSM 12286]
          Length = 267

 Score =  190 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 61/252 (24%), Positives = 98/252 (38%), Gaps = 3/252 (1%)

Query: 7   FTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +         +       ++V+P+G+ EQHG HLP+ TDTI+   +           +PV
Sbjct: 13  WAGKPYAEIREVADSDGSVLVVPVGSIEQHGHHLPVATDTILVDAVVHGGTEQAGADVPV 72

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P    G+S  H+   GT +L           +     + G   +  +N HGGN+ LV
Sbjct: 73  LVTPTVWTGFSPHHLSFGGTLSLELDHLRAVLEDVALTGIQNGFDAVCFVNGHGGNAALV 132

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQ-GIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
             V +         V+ T++      + G +   E     HGGE ETS+ML L P LV  
Sbjct: 133 DAVVSTVGTETDAEVLGTTYFTLATDEVGALRDSEDGGMAHGGEYETSLMLHLRPDLVAD 192

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
                 +     +  +   L   G  S   S  + +  G +G    A+ +KG  +     
Sbjct: 193 AAKREGTLWDEHYEWSGGDLLDGGPVSVYRSFDEYSESGAIGAPELASAEKGARIYDAVT 252

Query: 244 NCFIQLLNDINS 255
           +    LL  I+ 
Sbjct: 253 SELAALLVAIHE 264


>gi|159040706|ref|YP_001539958.1| creatininase [Caldivirga maquilingensis IC-167]
 gi|157919541|gb|ABW00968.1| Creatininase [Caldivirga maquilingensis IC-167]
          Length = 245

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 64/251 (25%), Positives = 107/251 (42%), Gaps = 15/251 (5%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           + + + + P      K  I +LP G  E HGPHLP+ TD ++A  +AE            
Sbjct: 1   MRWWELTWPDFEKVDK-TIAILPTGIVEAHGPHLPLGTDALMATYIAEEAARR----TNA 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P    G +       GT +++       +  I   + + G++ +V++N HGGN   +
Sbjct: 56  LLLPTVWYGNTYVLDKFPGTISISNEVLYMLYREIFREVVRNGVKYLVVVNGHGGNVDAL 115

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           S+ S +     +++++  +W      +      ET  G H  E ETS + A  PHLVK  
Sbjct: 116 SMASKDVAKETNLVIILVNWWIDLGREARRKVLETPEG-HAAEDETSEVWAAYPHLVK-- 172

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
                 S        F   R +G  ++     +     V G    A+V+KG+ +L    N
Sbjct: 173 WIPRDGSADEWVEVKF---RVYGKDAYAL---EYTKA-VQGYPSRASVEKGKVILESAIN 225

Query: 245 CFIQLLNDINS 255
              QL+ND+ S
Sbjct: 226 ELTQLINDLRS 236


>gi|218461974|ref|ZP_03502065.1| Creatininase [Rhizobium etli Kim 5]
          Length = 199

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 117/197 (59%), Positives = 145/197 (73%), Gaps = 1/197 (0%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P   F D S P  A  R+  I VLPLGA+EQHGPHLP  TDT+IA G+A R+K+ LP 
Sbjct: 2   MTPSPRFED-SDPASAAGRRCPIAVLPLGAHEQHGPHLPFETDTLIAEGIAGRLKAALPA 60

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPVT +P E +GYSIEHM V+GTKTLT+ EA+  WL I + + K  IRK+V+LNAHGGN
Sbjct: 61  GLPVTFLPAESVGYSIEHMDVEGTKTLTFDEAVHRWLGIAEGLAKQNIRKLVMLNAHGGN 120

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPL++IV+TEAR+RF+ML V+TSW+RF +P G+I   E  IGIHGG+IETS+MLAL P  
Sbjct: 121 SPLMTIVATEARVRFAMLAVATSWTRFGLPDGVIPPVEKAIGIHGGDIETSVMLALHPDR 180

Query: 181 VKMDLAENFSSRQSEFL 197
           V M  A +F SRQ+E  
Sbjct: 181 VDMAKAADFPSRQTELP 197


>gi|295136135|ref|YP_003586811.1| creatinine amidohydrolase [Zunongwangia profunda SM-A87]
 gi|294984150|gb|ADF54615.1| creatinine amidohydrolase [Zunongwangia profunda SM-A87]
          Length = 253

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 67/263 (25%), Positives = 106/263 (40%), Gaps = 14/263 (5%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLA-ERIKSILP 59
           M P I   + +     D     I +LP GA E H  HLP  TD I A G+A E  +    
Sbjct: 1   MKPYI-LAETNWKNVKD-EHYEIAILPWGATEAHNYHLPYATDNIEAHGVAKETCRKAWE 58

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
               V  +P  P G +   M +     L  +        +   + + GI K+VI N+HGG
Sbjct: 59  QGAKVLLLPTIPFGVNTGQMDIPFCMNLNPSTQYAILKDVAQVLHRSGINKLVIFNSHGG 118

Query: 120 NSPLVSIVSTEARMRFS-MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           N      +  E  + F  +   + +W +    +     P    G H GE+ETS+++ LAP
Sbjct: 119 N--HFKQMIRELSIEFPTIFTCTLNWFQALDAKAYFDDP----GDHAGELETSVVMHLAP 172

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV         S ++  ++  +     G  S     + +     VGN  +AT KKG+  
Sbjct: 173 DLVLPLEEAGDGSAKNYKIKGLR----EGWVSSQRQWRAVTKDTGVGNPKNATAKKGQKF 228

Query: 239 LSYFANCFIQLLNDINSFDVSIF 261
           +          L +++  DV+  
Sbjct: 229 IEAVTKKIADFLVELHHADVNNL 251


>gi|242398842|ref|YP_002994266.1| putative amidase [Thermococcus sibiricus MM 739]
 gi|242265235|gb|ACS89917.1| putative amidase [Thermococcus sibiricus MM 739]
          Length = 242

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 62/253 (24%), Positives = 107/253 (42%), Gaps = 19/253 (7%)

Query: 4   LIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR- 61
            +   + +       +     ++LP+G+ E HG HLP+ TD      ++ R++  L  R 
Sbjct: 5   PMKMEELTWEDFEKIKTRVKGLILPVGSVEAHGKHLPLGTDVFAPLEISRRVEEKLKDRG 64

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           + +   P    G+S       GT  +      ++   I++   K G  K++ILN HGGN 
Sbjct: 65  IDILIAPPIWYGHSFVLNVYPGTINVKSGTFQKYVQEILEEFAKEGFEKVIILNGHGGNI 124

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +   + E   ++ + VV  +W      +            H GE ETS++LA+ P LV
Sbjct: 125 YPLIGAAEEVVEKYDVEVVLINWWMDFKEEISRI---CSSQGHAGEDETSVILAINPELV 181

Query: 182 KMDLA-ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           KM+ A     +R    ++    L             D+ P GV  N  +AT +KGE +L 
Sbjct: 182 KMEKAIGERRTRPVRIIKKDIGL-------------DIFPNGVNDNPHNATAEKGEEILE 228

Query: 241 YFANCFIQLLNDI 253
             +     +L ++
Sbjct: 229 VVSEKITNILVEL 241


>gi|325001927|ref|ZP_08123039.1| creatinine amidohydrolase [Pseudonocardia sp. P1]
          Length = 254

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 110/246 (44%), Gaps = 3/246 (1%)

Query: 6   IFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
              + +    A A  D  +V++P GA+EQHGP LP+ TD + A  + +R+   L  R   
Sbjct: 5   RLAEMTTTEAAAAVVDSPVVLVPAGAFEQHGPGLPLATDLVRAEAVTDRVAQRLGGR--A 62

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P  P+G S  H+   GT +L+ A         +D + + G R+I+++  HGGN   +
Sbjct: 63  VIGPSLPVGVSPHHLAFAGTVSLSTATFAAVLGDYVDGLYRHGWRRILVVTGHGGNDATL 122

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             V+ +  +    L  + S         + +    E+  H G+ ET+ MLA+APHLV  D
Sbjct: 123 GTVAQDLLVTRPDLQFAWSPLTPLAADVVAASGPPEVSGHSGQAETAQMLAVAPHLVHTD 182

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
                ++R SE        R  G          L+  GV+G+   A  + GE +++   +
Sbjct: 183 RLVAGTTRLSELDALGGLARWRGGPKLTVGYDRLSGSGVLGDPRRADPEHGEAIVTAIVD 242

Query: 245 CFIQLL 250
                +
Sbjct: 243 RITDFV 248


>gi|294101037|ref|YP_003552895.1| Creatininase [Aminobacterium colombiense DSM 12261]
 gi|293616017|gb|ADE56171.1| Creatininase [Aminobacterium colombiense DSM 12261]
          Length = 259

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 61/264 (23%), Positives = 102/264 (38%), Gaps = 16/264 (6%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     +     +   ++ + ++PLG+ EQHGP  P+ TD  I    A+R+++  P ++ 
Sbjct: 1   MYLASLTWKKLEEKITEETVALIPLGSVEQHGPLAPLGTDYFIPEEFAKRVEAAYPDKIM 60

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V  +P  P G    H    GT  +      E    I  ++   GI+K++ LN HGGN P 
Sbjct: 61  V--LPTMPYGVCPYHASFPGTIDMGIEILSEVMTRIAMSLMDTGIKKMIFLNGHGGNGPS 118

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +   +     R  +  +   W+                G HG   ETS+M+AL P  V M
Sbjct: 119 LDKAALAVYKRGGLAAIVDWWTLAGELNA------KWAGGHGAGQETSVMMALKPEWVNM 172

Query: 184 DLAENFSSRQSEFLRNFKYLRA----HGSHSFGWSMKDLNPKGVVG---NAMDATVKKGE 236
                 +           ++       GS      +KD+   G  G      DA  + GE
Sbjct: 173 KDFFPANIHHVSDSLQNTHISIVTFEKGSVRIIRDVKDVTSSGAYGGTDAPEDANREWGE 232

Query: 237 GLLSYFANCFIQLLNDINSFDVSI 260
            +L       I+ + +     +S 
Sbjct: 233 EILKGVTEYLIRFIAEYFKVSLSR 256


>gi|90420054|ref|ZP_01227962.1| putative creatinine amidohydrolase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335388|gb|EAS49138.1| putative creatinine amidohydrolase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 264

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 61/252 (24%), Positives = 111/252 (44%), Gaps = 5/252 (1%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           + +   +     D  +   V++ + A EQHGPHLP++TD +I A   + +++       V
Sbjct: 1   MRWERLTTREIQDLPRTIPVIVNVAAIEQHGPHLPLDTDAVIGAAFLDSLEARAGDE--V 58

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P   +  S  HM   GT ++ +   +++  AI+ ++ + G R +VI N+HGGN  + 
Sbjct: 59  LILPQVKVCCSEHHMDFPGTLSIGHRSFLDYVGAILQSVVRHGFRNLVIFNSHGGNQAIG 118

Query: 125 SIVSTEARMRFSML-VVSTSWSRFTIPQ-GIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            ++  E         +V  +W R   P+   I         H  E+ETS+ML + P  V+
Sbjct: 119 QVLLEEFGASHRDCRIVMLTWWRLAGPEISQIRESGFAGANHACELETSLMLHVDPASVR 178

Query: 183 -MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
             D     S   +    N   +       F    +  +  G VG+A  AT  KG+ ++  
Sbjct: 179 QPDHLPPMSYVPTHGWANADMILPARGALFRSMAEMSDGLGAVGDASLATAAKGQAIIEA 238

Query: 242 FANCFIQLLNDI 253
                + ++ D+
Sbjct: 239 VTEQLLAVVRDL 250


>gi|222479346|ref|YP_002565583.1| Creatininase [Halorubrum lacusprofundi ATCC 49239]
 gi|222452248|gb|ACM56513.1| Creatininase [Halorubrum lacusprofundi ATCC 49239]
          Length = 274

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 57/270 (21%), Positives = 98/270 (36%), Gaps = 10/270 (3%)

Query: 1   MNPLIIFTDNSLPLCA---DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           M+      +   P      D+ +    ++P+G  EQHGPHLPM TD++I   + ERI   
Sbjct: 1   MSVSRRLDELRHPEVEAYLDSSETPTALIPVGTTEQHGPHLPMGTDSMIPTEICERIAE- 59

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
                     P    G S  H   +G   L Y         +  ++ + G   IV ++ H
Sbjct: 60  ---DTDALVGPPINYGASDMHAGYEGITYLPYRTLATVVRDLAYSLAESGFTDIVFISGH 116

Query: 118 GGNSPLVSIVSTEARMRFS--MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
             N     + + +A           +  +        +  +   + G H    ET+ ++A
Sbjct: 117 LTNDWAAKVGANQASHDLPEEHYAYAFPYWDALSSDDMEDYLSFDAGWHANIGETAAVMA 176

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           +   LV +           E + N   L  H     G   + ++  GV G+  DAT + G
Sbjct: 177 INEGLVDLSETPYDDPDMPEDIENPGALLDHLPIGKGAFYR-VSDTGVWGDPSDATAELG 235

Query: 236 EGLLSYFANCFIQLLNDINSFDVSIFDKDV 265
           E       +   +L+N        I+ +D 
Sbjct: 236 EEYFETITHAVAELINTFQEVRDDIYVRDR 265


>gi|302336578|ref|YP_003801784.1| creatininase [Spirochaeta smaragdinae DSM 11293]
 gi|301633763|gb|ADK79190.1| Creatininase [Spirochaeta smaragdinae DSM 11293]
          Length = 253

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 54/263 (20%), Positives = 104/263 (39%), Gaps = 19/263 (7%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++ ++ + P      ++  +V++P+G+ E HG H+P+ TDT+I   + E ++        
Sbjct: 1   MLLSEMTWPQAEKYFKESDLVIIPIGSIECHGKHMPLGTDTLIPDKIIELLRRQED---R 57

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               P  P G         GT  L      E    I++ +++ G +K V+LN HGGN   
Sbjct: 58  FLIAPTIPYGACESLYPFPGTVNLGTDLLYELMKTIVENLKRHGAKKFVVLNGHGGNIKA 117

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  +  E      ++ +   W        +        G HGG  ET+ ++A+ P LV  
Sbjct: 118 LERIGYELDADGCLMAILNWWLN------VWEMNPEWKGGHGGGEETAAVMAIDPDLVDR 171

Query: 184 DLAENFSSRQSEFLRNFKYLRAHG------SHSFGWSMKDLNPKGVVG--NAMDATVKKG 235
               +     ++     K    +       + +       +   G +G  +   ATV+ G
Sbjct: 172 SYI-DLPLEITDLSDTIKGSGFNTVQYDNITVTIPRLTNHVTSNGWIGPDHPKYATVEWG 230

Query: 236 EGLLSYFANCFIQLLNDINSFDV 258
             +L  F N  +  L +    ++
Sbjct: 231 SEMLQTFTNFMVSFLKEFEKVEL 253


>gi|239826882|ref|YP_002949506.1| creatininase [Geobacillus sp. WCH70]
 gi|239807175|gb|ACS24240.1| Creatininase [Geobacillus sp. WCH70]
          Length = 243

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 60/240 (25%), Positives = 97/240 (40%), Gaps = 20/240 (8%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
               K  I ++P+GA E HGPHLP+ TDTI+A  LA R+   +        +P  P G  
Sbjct: 13  KKITKSRIAIMPIGAVEAHGPHLPLCTDTILAERLAYRLAEKVE----GFVLPAMPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ +++    I   + I   + K G R   ++N H GN   +   +     +F
Sbjct: 69  WSLRDFPGSISISNETLIRFLVEIGKNLYKQGFRIWAMVNGHLGNQTALKEAARVLYDQF 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI----HGGEIETSMMLALAPHLVKMDLAENFSS 191
               +   +    + + +    ET+       H  EIETS+ML LA   V+M+ A     
Sbjct: 129 PDFKIF-YFFYPGMNKIVNEIRETDSVHPVYFHACEIETSIMLYLAEEYVEMNKAICDIP 187

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
           + SE                 W  +      V+G+A  AT +KG+ ++         +L 
Sbjct: 188 KISEEADV---------TPTPW--EKFTQTAVLGDATKATKEKGKKIVETALQKMEHMLR 236


>gi|83596083|gb|ABC25440.1| creatininase [uncultured marine bacterium Ant4D5]
          Length = 251

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 59/261 (22%), Positives = 101/261 (38%), Gaps = 21/261 (8%)

Query: 1   MNPLIIFTDNSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           M+  I+  + + P   +A  D    VV+ +GA EQHGPHLP+  D +    LA  +   L
Sbjct: 1   MSDSILLEEMTWPEVGEAIADGRTTVVIAVGAIEQHGPHLPLLVDAVRGDRLAVEVARRL 60

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
                    P   +G S  HM   GT TL         L    ++ + G  ++  + +HG
Sbjct: 61  GS---ALVAPTIRVGCSEHHMGFPGTLTLRRETLEAICLDYATSLARHGFTRLCFVPSHG 117

Query: 119 GNSPLVSI--------VSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIET 170
           GN   ++         V  E R+     +V                    +G H    ET
Sbjct: 118 GNFGPLAEMLPALQAGVGKECRVDAYTDLVGFMDFWPAAVGEHAPDLVPRVGGHADIAET 177

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDA 230
           + M+ + P LV+ + AE    +  +     +              + + P G++G++  A
Sbjct: 178 AEMMVIRPDLVREERAEAGRVQVFDDALMHRVFSEG--------FRAVTPNGILGDSRGA 229

Query: 231 TVKKGEGLLSYFANCFIQLLN 251
           T   GE  +++ A+  +  L 
Sbjct: 230 TSAIGESCIAHAADGIVAALE 250


>gi|20093623|ref|NP_613470.1| hypothetical protein MK0183 [Methanopyrus kandleri AV19]
 gi|19886489|gb|AAM01400.1| Uncharacterized protein, putative amidase [Methanopyrus kandleri
           AV19]
          Length = 224

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 56/246 (22%), Positives = 91/246 (36%), Gaps = 30/246 (12%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
              P      +  +V+LP+G+ EQHG HLP+ TD +IA  L   +             P 
Sbjct: 6   LRHPEV--DLEGEVVLLPVGSTEQHGLHLPLGTDHLIAEALCREVSKRTGAPW----YPA 59

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
            P G S  HM   GT +L     +     +  +    G    + +N HGGN   +  V+ 
Sbjct: 60  IPYGVSRHHMGFPGTVSLRTKTMVALLTDVHRSFLHHGAAATLAVNGHGGNEAALGTVAE 119

Query: 130 EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENF 189
           E            SW +      +    ET+ G H  E+ETS+ML L P LV  +   + 
Sbjct: 120 EEERFH-----WISWWKLAPIDEL----ETDWGGHADELETSVMLYLHPELVGEERKVDG 170

Query: 190 SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
              +                       +++  G  G+   AT  KG+ +        + +
Sbjct: 171 RPTKPWEFP---------------DYHEISETGTKGDPRPATADKGKRIFKTVVERLVDI 215

Query: 250 LNDINS 255
           + ++  
Sbjct: 216 VEELRE 221


>gi|160936179|ref|ZP_02083552.1| hypothetical protein CLOBOL_01075 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440989|gb|EDP18713.1| hypothetical protein CLOBOL_01075 [Clostridium bolteae ATCC
           BAA-613]
          Length = 253

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 59/262 (22%), Positives = 112/262 (42%), Gaps = 17/262 (6%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +  +  + P      +++ +V+LP+G+ E HG H+P+ TDT+I   + + I+        
Sbjct: 1   MRLSKITWPTAERYFKENDMVILPIGSTECHGRHMPLGTDTLIPDKILDLIEEKND---N 57

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +   P+ P G         GT  +      ++   I+D + K G RKI++LN HGGN   
Sbjct: 58  ILIAPMIPYGACQSLADYPGTINIDSDVLYQYVYQIVDGLYKHGARKILVLNGHGGNIKT 117

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  +  E   + +M+V+   W                 G HGG  ET+ ++A+ P LV M
Sbjct: 118 IERIGLEFDKKGAMVVMLNWWLM------AWDMKPEWKGGHGGGEETAGIMAVDPSLVDM 171

Query: 184 DLAENFSSRQ----SEFLRNFKYLRAHG-SHSFGWSMKDLNPKGVVG--NAMDATVKKGE 236
              +          +     F+ +R  G       +   +   G +G  +   ATV+ G+
Sbjct: 172 SKIDLPLEMTNLTENLVATGFRTVRFKGVEIEILRNTPKVTDNGWIGPDHPNTATVEWGQ 231

Query: 237 GLLSYFANCFIQLLNDINSFDV 258
            ++   A+  + L+ ++    +
Sbjct: 232 EMVQTTADYILDLIEELKKVSL 253


>gi|257386646|ref|YP_003176419.1| creatininase [Halomicrobium mukohataei DSM 12286]
 gi|257168953|gb|ACV46712.1| Creatininase [Halomicrobium mukohataei DSM 12286]
          Length = 237

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 57/253 (22%), Positives = 108/253 (42%), Gaps = 17/253 (6%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +  ++ +    AD     + +LP+G+ EQHGPH P+ TD +     A            V
Sbjct: 1   MHLSEATWTDAADL-DTDLAILPVGSTEQHGPHGPLGTDVL--TAEAVAEAGAEAYDGEV 57

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P  P+G + EH +  GT  +      ++    + ++   G  ++V++N HGGN   +
Sbjct: 58  VVAPAIPVGVAEEHRHFAGTLWVGEDTFRDYVRETVASLASHGWDRVVVVNGHGGNVDAL 117

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             V        +   V  +W             +     HGG +ETS++L+ AP LV+ D
Sbjct: 118 REVCGRVTRDGTAYAVPLTWF---------DAVDAPDMGHGGPVETSLLLSTAPELVRTD 168

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             E  ++  ++    F++       +  +  ++ +  G VG+  DA  ++G+ LL   ++
Sbjct: 169 RLEASAANGADSWGAFEH-----GVNLAYDTEEFSENGTVGDPRDANRERGDALLDAASD 223

Query: 245 CFIQLLNDINSFD 257
               +L  +   D
Sbjct: 224 ALADVLASVRERD 236


>gi|323357701|ref|YP_004224097.1| amidase [Microbacterium testaceum StLB037]
 gi|323274072|dbj|BAJ74217.1| uncharacterized protein, putative amidase [Microbacterium testaceum
           StLB037]
          Length = 236

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 74/236 (31%), Positives = 110/236 (46%), Gaps = 6/236 (2%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP-RLPVTCMPVEPIGYSIEHMYVDG 83
           +LP GA E HGPHLP+ TD I+A   A    +      L V  +P   I  S EH +  G
Sbjct: 1   MLPTGAIEHHGPHLPLATDAIVAEASATAAVARAAAMGLDVWQLPTLSITKSDEHSWAPG 60

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T  LT    ++  + I  +I     R +V LN HGGN  L+++ + E R RF +      
Sbjct: 61  TLWLTPETMLQTVVDIGRSILTTRARTLVFLNGHGGNVALLNVANRELRRRFGLRTFFMP 120

Query: 144 WSRFTIPQGIIS-FPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
            +R     G      E   GIH G  ETSM++ L P LV       F +     + +F++
Sbjct: 121 AARVPSFDGTDGTPDEHGTGIHAGYGETSMIMHLRPELVDPS---TFHATVPAHIGDFRH 177

Query: 203 LRAHG-SHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
           +  +G   +FGW   D  P GV+G+   A  + G  +     +  ++ L +I+ FD
Sbjct: 178 IGFNGKPVTFGWLSNDFGPTGVLGDPTGANAEAGARMFEDSVSFVVEALEEISRFD 233


>gi|163794375|ref|ZP_02188347.1| Creatininase [alpha proteobacterium BAL199]
 gi|159180543|gb|EDP65064.1| Creatininase [alpha proteobacterium BAL199]
          Length = 261

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 92/253 (36%), Positives = 131/253 (51%), Gaps = 1/253 (0%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
             +   +    AD A ++ + VLP+ A EQHGPHLP+ TD I+  G+ +     LP  + 
Sbjct: 4   RHWEHLTTTDLADGAYRNAVAVLPVAAVEQHGPHLPLGTDAILTDGVLDAALQCLPDTVD 63

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V  +P + IG S EH    GT +      I  W AI  A+ + GIR++V+LN HGG +  
Sbjct: 64  VLRLPTQRIGLSPEHANFAGTLSFDAETLIAQWTAIGRAVARAGIRRLVLLNGHGGQTAP 123

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           V IV+   R  F M VV +++         I   E+  G HGG IET++MLA+ P LV++
Sbjct: 124 VDIVAMRLRSEFGMTVVRSTYFALIGEHPAIDARESAFGWHGGLIETALMLAIRPDLVRV 183

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
             A +F S   +       LR  G    GW  +DLN  G  GNA  ATV+ G  LL+  A
Sbjct: 184 GEAADFRSVAEDIAAEHSALRVEGETGLGWMAEDLNLSGATGNAAAATVEIGRTLLNQAA 243

Query: 244 NCFIQLLNDINSF 256
                LL ++++F
Sbjct: 244 GRLGTLLAELHAF 256


>gi|319655075|ref|ZP_08009142.1| hypothetical protein HMPREF1013_05765 [Bacillus sp. 2_A_57_CT2]
 gi|317393239|gb|EFV74010.1| hypothetical protein HMPREF1013_05765 [Bacillus sp. 2_A_57_CT2]
          Length = 269

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 60/254 (23%), Positives = 102/254 (40%), Gaps = 10/254 (3%)

Query: 4   LIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
            I   +N      +  + +  +++P+G+ EQHG HLP+ TD+ +A  +AE        R 
Sbjct: 3   SIWLQENKWEDVEEYLQSNKTIIVPVGSVEQHGKHLPLGTDSFVAIKVAEEA----GKRT 58

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG-NS 121
                P    G++  HM   GT TL           +  ++   G  KI+I+N H   N 
Sbjct: 59  ETLVAPPNWTGWAPHHMAYPGTITLRPETLTNLMYDVCKSLIYHGFEKIIIVNGHREANL 118

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTI-PQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           P + I  T+ R      +               +   E     H  E+ETS ML L P L
Sbjct: 119 PPLKIAITKLRNETGAFLSIADPFYIADQVARKVKKSEPGGVGHAAEMETSHMLFLHPEL 178

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHG--SHSFGWSMKDLNPK-GVVGNAMDATVKKGEG 237
            +MD A    S +  FL++  ++        S     ++ +   G+VG+   +T + GE 
Sbjct: 179 CEMDKAVKNVSEKHRFLQHDPFVEGDRIFVPSDVGVYREGSLNVGIVGDPTVSTKENGET 238

Query: 238 LLSYFANCFIQLLN 251
                 +  ++ + 
Sbjct: 239 YHQELISNMVEFIE 252


>gi|196231716|ref|ZP_03130573.1| Creatininase [Chthoniobacter flavus Ellin428]
 gi|196224188|gb|EDY18701.1| Creatininase [Chthoniobacter flavus Ellin428]
          Length = 252

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 65/258 (25%), Positives = 103/258 (39%), Gaps = 17/258 (6%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   D   P  A   KD  ++ PL A EQHG HLP+ TD+++   +  R+      +   
Sbjct: 1   MQLVDLPWPAVAALPKDTPIIFPLAALEQHGHHLPVFTDSLLLGEVIRRVVPRFEEK--A 58

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P++ +G S  H+   GT +      ++    + +     G R+   +N HGGN    
Sbjct: 59  LFAPLQWLGNSEHHLDFAGTLSAAPRVYLDMLNGLAENFLHHGFRRFFFVNGHGGNDVPG 118

Query: 125 SIVSTEARMRFS-----MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
                E R R       + + +T WS  + P             H  E ETSMML LAPH
Sbjct: 119 RQAIFELRQRHRELDDVLFLFATYWSLGSRPWDADPAIVQREMGHACEWETSMMLRLAPH 178

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV         +  + F             S GW  ++ +  G +G    +T  KGE L 
Sbjct: 179 LVGDYKQAPPVAFGTPF----------TPASRGWITRERSEPGHIGRPRFSTADKGETLF 228

Query: 240 SYFANCFIQLLNDINSFD 257
             F++    ++  +  +D
Sbjct: 229 RVFSDDVASMIERVIKWD 246


>gi|16804684|ref|NP_466169.1| hypothetical protein lmo2647 [Listeria monocytogenes EGD-e]
 gi|224499320|ref|ZP_03667669.1| hypothetical protein LmonF1_06347 [Listeria monocytogenes Finland
           1988]
 gi|224503707|ref|ZP_03672014.1| hypothetical protein LmonFR_14609 [Listeria monocytogenes FSL
           R2-561]
 gi|254830920|ref|ZP_05235575.1| hypothetical protein Lmon1_06149 [Listeria monocytogenes 10403S]
 gi|16412147|emb|CAD00860.1| lmo2647 [Listeria monocytogenes EGD-e]
          Length = 249

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 60/239 (25%), Positives = 94/239 (39%), Gaps = 18/239 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +PV P G  
Sbjct: 13  AKITKTKPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAAKTD----GFVLPVLPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ TL+     +  + I +++ K G R  V ++ H GN   +   + E   +F
Sbjct: 69  WSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAARELYAKF 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSR 192
             +V+   +        +             H  EIETS+ML L+P    M  A +    
Sbjct: 129 PDMVILHIFYPNIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENTDMSRAIDDPPI 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                               W         V+G A  AT +KGE L+       ++L+ 
Sbjct: 189 LPIDAD---------FTPTPWQT--FTKTAVLGEATLATAEKGEYLIEKTLKTCVELIK 236


>gi|160935546|ref|ZP_02082921.1| hypothetical protein CLOBOL_00436 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441290|gb|EDP19000.1| hypothetical protein CLOBOL_00436 [Clostridium bolteae ATCC
           BAA-613]
          Length = 255

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 71/254 (27%), Positives = 113/254 (44%), Gaps = 9/254 (3%)

Query: 1   MNPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI-L 58
           M   +++     P     A K+ +V++P+GA EQHGPHLP+ TDTI+A  +AER      
Sbjct: 1   MKNQLLWEQLRAPELKKLAEKNAVVMIPMGAVEQHGPHLPVATDTILAQWIAERAAKEMW 60

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +PV   P   I  S+ HM+  G+ +LT    I+       AI   G RKI I+N HG
Sbjct: 61  DKGIPVVIAPAFVIANSMHHMHFSGSLSLTPGTFIQVLKEQCRAIAVQGFRKIAIINGHG 120

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           GN+  + +   +        V +  ++            +    IH GE+ETS++LA   
Sbjct: 121 GNTAPIDVALIDINQELGFPVYNVPYT--AGVDESPFLDKQNYMIHSGEVETSLILAYDE 178

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV         +  S            G+ S    M+     G++G +  A+ +KG  L
Sbjct: 179 SLVDPSY-----TNLSGNPGGCSDYEDCGALSTFHYMESHTENGIMGESCAASKEKGIAL 233

Query: 239 LSYFANCFIQLLND 252
              +    +++L+D
Sbjct: 234 ADAYCKRLVEVLSD 247


>gi|313623077|gb|EFR93357.1| creatininase subfamily [Listeria innocua FSL J1-023]
          Length = 247

 Score =  186 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 101/246 (41%), Gaps = 17/246 (6%)

Query: 9   DNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           + +      A  D  + +LPLGA EQHG HLP+  D  +A  LAE +            +
Sbjct: 10  NMTRDEVEKAITDFPVAILPLGATEQHGHHLPLGVDIFLAEHLAELVSEKTG----AIVI 65

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P  P GYS     + GT ++           +  ++ + G++ +V++N H  N+  +   
Sbjct: 66  PPMPFGYSWVWRDIPGTISIQQHHVEAIIKDVAHSVSRYGVKMLVLINGHDSNNNSMKYA 125

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLA 186
             E      M V+   +   +          T  G IH  E ETS+MLA    LV+M  A
Sbjct: 126 VRELADELEMPVMYLFYPSLSEVMEKNCESGTWHGMIHACEFETSLMLATKKELVQMKKA 185

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                 +              + S G    DL+  GV G+A  AT +KGE ++  FA   
Sbjct: 186 VREYPEKPTLYGKS-------TISLG----DLSKSGVYGDASLATEEKGEQMIQLFAEKM 234

Query: 247 IQLLND 252
             LL +
Sbjct: 235 AALLLE 240


>gi|106364382|dbj|BAE95208.1| hypothetical conserved protein [unclutured Candidatus Nitrosocaldus
           sp.]
          Length = 273

 Score =  186 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 74/268 (27%), Positives = 122/268 (45%), Gaps = 32/268 (11%)

Query: 13  PLCADARKDWI---VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
               DA ++      +LP+G+ EQHG HLP+ TD+IIA  +A R+   L        +P 
Sbjct: 9   EEVRDAIRNDARIKAILPIGSLEQHGKHLPLGTDSIIAEHIAARVAERLS----AILLPC 64

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
              G S EH  +    +++          +  ++ + G+R+I+ILNAH GN   +     
Sbjct: 65  IGYGISYEHEPL-FNVSISAQTLCMLVEDLCRSLAENGVRRIIILNAHYGNEYALLSCVK 123

Query: 130 EARMRF---SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
           E   ++    +L+ S ++S F            E   H GE ETS+MLA+ P LV+MD+ 
Sbjct: 124 ELAKKYKDKGILICSITYSLF-----------LEEPDHAGESETSLMLAIRPDLVRMDVL 172

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSF--------GWSMKDLNPKGVVGNAMDATVKKGEGL 238
                 + E  R     R   S S           S+  +   G++G+ M A+  KG+ L
Sbjct: 173 GKGDEVRQEGYRGKGRGRDSKSDSIILSRITLLPGSIAGIARDGIIGDPMMASKDKGDAL 232

Query: 239 LSYFANCFIQLLNDINSF--DVSIFDKD 264
           L   ++  I+++ ++      +S  DKD
Sbjct: 233 LEEISSKVIKMIEEVEHAYEQMSRQDKD 260


>gi|47096612|ref|ZP_00234200.1| creatinine amidohydrolase, putative [Listeria monocytogenes str.
           1/2a F6854]
 gi|254899334|ref|ZP_05259258.1| hypothetical protein LmonJ_05959 [Listeria monocytogenes J0161]
 gi|254912527|ref|ZP_05262539.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254936854|ref|ZP_05268551.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|47014997|gb|EAL05942.1| creatinine amidohydrolase, putative [Listeria monocytogenes str.
           1/2a F6854]
 gi|258609449|gb|EEW22057.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|293590512|gb|EFF98846.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 247

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 99/246 (40%), Gaps = 17/246 (6%)

Query: 9   DNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           + +      A  D  + +LPLGA EQHG HLP+  D  +A  LAE +            +
Sbjct: 10  NMTRDEVEKAITDFPVAILPLGATEQHGHHLPLGVDIFLADHLAELVSEKTG----AVVI 65

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P  P GYS     + GT ++           +  ++ + G++ +V++N H  N+  +   
Sbjct: 66  PPMPFGYSWVWRDIPGTISIQQHHVEAIIKDVAHSVSRYGVKMLVLINGHDSNNNSMKYA 125

Query: 128 STEARMRFSMLV-VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
             E      M V      S   + +           IH  E ETS+MLA    LV+M  A
Sbjct: 126 VRELADELEMPVMYLFYPSLSEVMEKNCESDTWHGMIHACEFETSLMLATKKELVQMKKA 185

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                 +              + S G    DL+  GV G+A  AT +KGE ++  FA   
Sbjct: 186 VREYPEKPTLYGK-------TTISLG----DLSKSGVYGDASLATEEKGEQMIELFAEKM 234

Query: 247 IQLLND 252
             LL +
Sbjct: 235 TALLLE 240


>gi|240102642|ref|YP_002958951.1| Creatinine amidohydrolase (creatininase) [Thermococcus
           gammatolerans EJ3]
 gi|239910196|gb|ACS33087.1| Creatinine amidohydrolase (creatininase) [Thermococcus
           gammatolerans EJ3]
          Length = 242

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 61/248 (24%), Positives = 104/248 (41%), Gaps = 16/248 (6%)

Query: 5   IIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   + S P     +   + V+LP+G+ E HG HLP+ TD      +AE ++  +  R  
Sbjct: 4   VRIEELSWPEFDRIKDKVVAVILPVGSVEAHGRHLPLGTDVFAPLKIAELVEQKVRERGK 63

Query: 64  -VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            V  MP    G+S       GT  +       +   ++  +   G +KIV+LN HGGN  
Sbjct: 64  EVLVMPPIWYGHSFALNAYPGTINVRPESLRMYVGDVLAELAAEGFKKIVLLNGHGGNVY 123

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            ++  + +    +  + V          + I+S        H GE ETS+MLA+ P LV 
Sbjct: 124 PLTEAAEDVAELYPDVEVYLINWWLDFREDILSV--CSGQGHAGEDETSVMLAIRPELVN 181

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           M  A           R  + ++           K++ P G+  +   AT +KGE +L   
Sbjct: 182 MREARGRR-----VKRKIRVIKKD-------IGKEVFPDGLNDDPSSATAEKGERILQIV 229

Query: 243 ANCFIQLL 250
           +    +++
Sbjct: 230 SESIARII 237


>gi|332799950|ref|YP_004461449.1| Creatininase [Tepidanaerobacter sp. Re1]
 gi|332697685|gb|AEE92142.1| Creatininase [Tepidanaerobacter sp. Re1]
          Length = 239

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 61/246 (24%), Positives = 96/246 (39%), Gaps = 19/246 (7%)

Query: 10  NSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
            +     +   K  I +LP+GA E HGPHLP+ TD  +A  L+ ++   +        +P
Sbjct: 6   LTYLEFQEFISKKPIAILPIGAVEAHGPHLPIGTDNYLAERLSRKVAEKVD----ALVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
               G       V G+  ++          I  ++ K G+R  VI+N H GN   +   +
Sbjct: 62  TFSYGQVWSLRNVPGSINVSNEHLTGVLTDIGKSLYKFGVRYFVIINTHVGNMTAIKEAA 121

Query: 129 TEARMRFSMLVVST--SWSRFTIPQGIISFPETEIGI-HGGEIETSMMLALAPHLVKMDL 185
                 +  L V          I + +        G  H  EIETS ML LAP  VKMD 
Sbjct: 122 RNLYDFYKDLKVFYFIYPGTAKITKEVRESKPMPGGYFHACEIETSYMLYLAPDYVKMDK 181

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
           A +      E                 W   ++    V+G+A  AT +KG+ ++      
Sbjct: 182 ALDDFPDLPEDFE---------YTPTPWD--EITDTIVLGSATLATEEKGQKIIDVAVET 230

Query: 246 FIQLLN 251
            +++L 
Sbjct: 231 IVKILE 236


>gi|225569813|ref|ZP_03778838.1| hypothetical protein CLOHYLEM_05907 [Clostridium hylemonae DSM
           15053]
 gi|225161283|gb|EEG73902.1| hypothetical protein CLOHYLEM_05907 [Clostridium hylemonae DSM
           15053]
          Length = 252

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 61/259 (23%), Positives = 114/259 (44%), Gaps = 17/259 (6%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     +     +A +KD ++V+P+G+ EQHG    + TD ++ + LA+ +  +      
Sbjct: 1   MYLGKMTTAQAKEAFQKDPVLVIPVGSTEQHGAQCALGTDYMVPSYLADHVADMED---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G    H+  +G+  + Y         I+D++ + G+++ V+LN HGGN+P 
Sbjct: 57  VIIAPTVPYGVCPYHLSFEGSINIGYEGLYMVLHGIMDSLMQHGVKRFVVLNGHGGNTPS 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +   + E   +  +      WS            E   G HG  +ETS M+A+AP  V +
Sbjct: 117 IDRAALEVYHKGGICASIDWWSLVA------ELDEKFCGGHGDILETSAMMAVAPDAVHL 170

Query: 184 DLAENFSSRQSEFLRNFKYLRA----HGSHSFGWSMKDLNPKGVVG--NAMDATVKKGEG 237
           +L +  +++         Y++A     G+       K++ P G  G  +  D+T + G+ 
Sbjct: 171 ELGQPMNAQHPSENVEAAYIQAVRYKGGTVRLVRDTKEIAPSGWFGPFDPKDSTAELGQE 230

Query: 238 LLSYFANCFIQLLNDINSF 256
            L          L ++  F
Sbjct: 231 ALDLSVEFIRGFLEEMKGF 249


>gi|47097130|ref|ZP_00234698.1| creatinine amidohydrolase, putative [Listeria monocytogenes str.
           1/2a F6854]
 gi|254829096|ref|ZP_05233783.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|254899902|ref|ZP_05259826.1| hypothetical protein LmonJ_08811 [Listeria monocytogenes J0161]
 gi|254912892|ref|ZP_05262904.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254937273|ref|ZP_05268970.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|284800467|ref|YP_003412332.1| hypothetical protein LM5578_0213 [Listeria monocytogenes 08-5578]
 gi|284993653|ref|YP_003415421.1| hypothetical protein LM5923_0213 [Listeria monocytogenes 08-5923]
 gi|47014497|gb|EAL05462.1| creatinine amidohydrolase, putative [Listeria monocytogenes str.
           1/2a F6854]
 gi|258601507|gb|EEW14832.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|258609879|gb|EEW22487.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|284056029|gb|ADB66970.1| hypothetical protein LM5578_0213 [Listeria monocytogenes 08-5578]
 gi|284059120|gb|ADB70059.1| hypothetical protein LM5923_0213 [Listeria monocytogenes 08-5923]
 gi|293590892|gb|EFF99226.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 249

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 60/239 (25%), Positives = 94/239 (39%), Gaps = 18/239 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +PV P G  
Sbjct: 13  AKITKTKPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETDGFVLPVLPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ TL+     +  + I +++ K G R  V ++ H GN   +   + E   +F
Sbjct: 69  WSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAARELYAKF 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSR 192
             +V+   +        +             H  EIETS+ML L+P    M  A +    
Sbjct: 129 PDMVILHIFYPNIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENTDMSRAIDDPPI 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                               W         V+G A  AT +KGE L+       ++L+ 
Sbjct: 189 LPIDAD---------FTPTPWQT--FTKTAVLGEATLATAEKGEYLIEKTLKTCVELIK 236


>gi|241767792|ref|ZP_04765390.1| Creatininase [Acidovorax delafieldii 2AN]
 gi|241361169|gb|EER57807.1| Creatininase [Acidovorax delafieldii 2AN]
          Length = 245

 Score =  185 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 88/240 (36%), Positives = 128/240 (53%), Gaps = 3/240 (1%)

Query: 29  GAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLT 88
            A EQHGPHLP++ D  +  G+ +    +LP  LP   +P + +G S EH+   GT TL+
Sbjct: 1   AAIEQHGPHLPLSVDATLLQGVIDAALPLLPAALPALFLPPQVVGLSPEHIRFPGTLTLS 60

Query: 89  YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFT 148
            A  I  W  I + + + G++K+++LN HGG   ++ IV+ E R R  +LV S+SW    
Sbjct: 61  PATVIALWTEIGECVARAGVKKLLLLNGHGGQVSVMDIVARELRTRSKLLVYSSSWFSLP 120

Query: 149 IPQGI---ISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRA 205
           +P  +    S  E   GIH GEIETSMML LAP  V MD A +F S   +    F  L  
Sbjct: 121 LPDAVAGQFSAEEHRFGIHAGEIETSMMLHLAPATVHMDHARDFRSTSQDRAERFAILGN 180

Query: 206 HGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDV 265
             S   GW M+D +  G VGNA  AT +KG  ++   A   ++LL +++   ++      
Sbjct: 181 GKSAKLGWQMQDYHVAGAVGNAAAATAEKGRAVVEGAAQQLVRLLQELHDLSLATLVDGP 240


>gi|16804007|ref|NP_465492.1| hypothetical protein lmo1968 [Listeria monocytogenes EGD-e]
 gi|224498581|ref|ZP_03666930.1| hypothetical protein LmonF1_02344 [Listeria monocytogenes Finland
           1988]
 gi|224501231|ref|ZP_03669538.1| hypothetical protein LmonFR_01700 [Listeria monocytogenes FSL
           R2-561]
 gi|254827146|ref|ZP_05231833.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|254831430|ref|ZP_05236085.1| hypothetical protein Lmon1_08753 [Listeria monocytogenes 10403S]
 gi|255029979|ref|ZP_05301930.1| hypothetical protein LmonL_14524 [Listeria monocytogenes LO28]
 gi|284802413|ref|YP_003414278.1| hypothetical protein LM5578_2169 [Listeria monocytogenes 08-5578]
 gi|284995555|ref|YP_003417323.1| hypothetical protein LM5923_2120 [Listeria monocytogenes 08-5923]
 gi|16411421|emb|CAD00046.1| lmo1968 [Listeria monocytogenes EGD-e]
 gi|258599529|gb|EEW12854.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|284057975|gb|ADB68916.1| hypothetical protein LM5578_2169 [Listeria monocytogenes 08-5578]
 gi|284061022|gb|ADB71961.1| hypothetical protein LM5923_2120 [Listeria monocytogenes 08-5923]
          Length = 247

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 101/246 (41%), Gaps = 17/246 (6%)

Query: 9   DNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           + +      A  D  + +LPLGA EQHG HLP+  D  +A  LAE +            +
Sbjct: 10  NMTRDEVEKAITDFPVAILPLGATEQHGHHLPLGVDIFLADHLAELVSEKTG----AVVI 65

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P  P GYS     + GT ++           +  ++ + G++ +V++N H  N+  +   
Sbjct: 66  PPMPFGYSWVWRDIPGTISIQQHHVEAIIKDVAHSVSRYGVKMLVLINGHDSNNNSMKYA 125

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLA 186
             E      M V+   +   +          T  G IH  E ETS+MLA    LV+M  A
Sbjct: 126 VRELADELEMPVMYLFYPSLSEVMEKNCESGTWHGMIHACEFETSLMLATKKELVQMKKA 185

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                 +              + S G    DL+  GV G+A  AT +KGE ++  FA   
Sbjct: 186 VREYPEKPTLYGK-------TTISLG----DLSKSGVYGDASLATEEKGEQMIELFAEKM 234

Query: 247 IQLLND 252
             LL +
Sbjct: 235 TALLLE 240


>gi|305664436|ref|YP_003860723.1| hypothetical protein FB2170_16431 [Maribacter sp. HTCC2170]
 gi|88708453|gb|EAR00689.1| hypothetical protein FB2170_16431 [Maribacter sp. HTCC2170]
          Length = 254

 Score =  185 bits (470), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 59/261 (22%), Positives = 107/261 (40%), Gaps = 13/261 (4%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS-ILP 59
           M    I  + +     +A+ D + +LP GA E H  HLP  TD   +  LA         
Sbjct: 1   MIRPYILAETNWKALENAKFD-LAILPWGATEAHNYHLPYATDVYESDALAAESARLAWE 59

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
               V  +P  P G +     +     L     +     +I+ + + GI+K++I N+HGG
Sbjct: 60  KGSKVIVLPSIPFGVNTGQSDIYLDINLNPTTQLAILADVIEVLNRQGIKKLLIFNSHGG 119

Query: 120 NSPLVSIVSTEARMRFS-MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           N+     +  E  ++F  M +  ++W +               G H  E+ETS+ML L P
Sbjct: 120 NN--FKPLVRELGLKFPEMFICFSNWFQSLNKTEYFDEE----GDHADEMETSLMLYLRP 173

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV         S +   +++F          +     +++    +GN M +T +KGE  
Sbjct: 174 DLVLPKKIWGLGSSKKFKIKSFSEGWVWAERKW----SEVSEDTGIGNPMQSTTEKGERF 229

Query: 239 LSYFANCFIQLLNDINSFDVS 259
                    Q ++++++ D++
Sbjct: 230 FKDVTIKIGQFIHELSNSDLA 250


>gi|315304988|ref|ZP_07875062.1| creatinine amidohydrolase [Listeria ivanovii FSL F6-596]
 gi|313626642|gb|EFR95701.1| creatinine amidohydrolase [Listeria ivanovii FSL F6-596]
          Length = 249

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 59/239 (24%), Positives = 97/239 (40%), Gaps = 18/239 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +PV P G  
Sbjct: 13  AKITKTTPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETNAFVLPVLPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ T++     +  + I +++ + G R  V ++ H GN   +   + E   +F
Sbjct: 69  WSLQDFPGSLTVSNETVTKMVVEIGESLYRQGFRLFVPVSGHLGNMAALKDAARELYAKF 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSR 192
             ++    +        +             H  EIETS+ML L+P  V M+ A +    
Sbjct: 129 PDMITLHIFYPNIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENVDMNRAIDDPPI 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                               W  ++     V+G A  AT KKGE L+       ++L+ 
Sbjct: 189 LPIDAD---------YTPTPW--QNFTKTAVLGEATLATAKKGEYLIEKTLKTCVELIK 236


>gi|261855406|ref|YP_003262689.1| creatininase [Halothiobacillus neapolitanus c2]
 gi|261835875|gb|ACX95642.1| Creatininase [Halothiobacillus neapolitanus c2]
          Length = 265

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 89/251 (35%), Gaps = 18/251 (7%)

Query: 4   LIIFTDNSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
              +   +         D     +LP+GA EQHGPH+    D+ +A  L     +     
Sbjct: 2   KRTWHQLTWEEIGQIVADGMDAAILPVGATEQHGPHMGCGMDSELAGQLCRDAAAQTG-- 59

Query: 62  LPVTCMPVEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             V  +P  P G S+ H     GT  +     I+    I D +   GI ++ I+N+H  N
Sbjct: 60  --VFLLPTLPYGCSVGHSRRWPGTLAVQPKTLIDLVKEIGDWVHSAGINRLFIINSHVTN 117

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           +  +       R     L+V+   S    P+   +        H    ET++M  LAP L
Sbjct: 118 AAPLRCALEMLRAEHDGLMVALINSAQISPRVRDAHHADGDDWHANAAETALMQYLAPEL 177

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+ D   +           F +            +   +  GV G+   AT + G  L  
Sbjct: 178 VREDKLIDADDPDRTADCVFSH-----------PVNRTSLNGVTGSPSKATAEDGRQLFE 226

Query: 241 YFANCFIQLLN 251
           +      + + 
Sbjct: 227 WMVTDLSEKIR 237


>gi|294055603|ref|YP_003549261.1| Creatininase [Coraliomargarita akajimensis DSM 45221]
 gi|293614936|gb|ADE55091.1| Creatininase [Coraliomargarita akajimensis DSM 45221]
          Length = 260

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 67/253 (26%), Positives = 104/253 (41%), Gaps = 18/253 (7%)

Query: 2   NPLIIFTDNSLPLCADARKDWI--VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
                ++  + P    A +  +  V+LPLGA EQHGPHL    D+++A  L     + L 
Sbjct: 4   PKHSQWSQMTWPEIHTAIQAGVDAVILPLGATEQHGPHLGTGMDSVLADQLC----AELG 59

Query: 60  PRLPVTCMPVEPIGYSIEHMY-VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
            R  V  +P    G SI H +   GT  L+    I     I D + + G+R+I ++N H 
Sbjct: 60  ERTQVPVLPTLSYGCSIGHSHRWPGTLALSPTTLIAVLCDIGDWLYRAGVRRIFLVNCHV 119

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           GN+  V       R R+  L+++        P+    F       H    ETS+MLA AP
Sbjct: 120 GNAAPVRCALDTLRCRYDDLMLAALNDGDLTPEIAKEFAADGNDWHANAAETSLMLAKAP 179

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            +V+   A   S+   +   +           F   +   +  GV G+   ATV  GE L
Sbjct: 180 EMVRP--AVVASADDPDRTAD---------CVFAHPVNRTSTNGVTGSPSRATVAAGEAL 228

Query: 239 LSYFANCFIQLLN 251
                   ++ + 
Sbjct: 229 YETMLTTLVERVE 241


>gi|116874012|ref|YP_850793.1| creatinine amidohydrolase [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116742890|emb|CAK22014.1| creatinine amidohydrolase [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 249

 Score =  184 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 58/239 (24%), Positives = 96/239 (40%), Gaps = 18/239 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +PV P G  
Sbjct: 13  AKITKTKPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETDGFVLPVLPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ TL+     +  + I +++ K G R  V ++ H GN   +   + E   ++
Sbjct: 69  WSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAARELYAKY 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSR 192
             +++   +        +             H  EIETS+ML L+P    M  A +    
Sbjct: 129 PDMIILHIFYPNIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADMSRAIDDPPI 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                               W  ++     V+G A  AT +KGE L+       ++L+ 
Sbjct: 189 LPIDAD---------FTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKTLKTCVELIK 236


>gi|167760532|ref|ZP_02432659.1| hypothetical protein CLOSCI_02906 [Clostridium scindens ATCC 35704]
 gi|167661898|gb|EDS06028.1| hypothetical protein CLOSCI_02906 [Clostridium scindens ATCC 35704]
          Length = 250

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 62/259 (23%), Positives = 112/259 (43%), Gaps = 17/259 (6%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     +     +A +KD ++V+P+G+ EQHG    + TD ++ + LA+ +  +      
Sbjct: 1   MYLGKMTTAQAKEAFQKDPVLVIPVGSTEQHGAQCALGTDYMVPSYLADHVADMED---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G    H+  +G+  + Y         I+D++ + G+R+ V+LN HGGN+P 
Sbjct: 57  VIIAPTVPYGVCPYHLSFEGSINIGYEGLYMVLHGIMDSLMQHGVRRFVVLNGHGGNTPS 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +   + E   +  +      WS            E   G HG  +ETS M+A+ P  V +
Sbjct: 117 IDRAALEVYHKGGICASIDWWSLVA------ELDEKFRGGHGDILETSAMMAVDPDAVHL 170

Query: 184 DLAENFSSRQSEFLRNFKYLRA----HGSHSFGWSMKDLNPKGVVG--NAMDATVKKGEG 237
           +L +  + +         Y++A     G+       K++ P G  G  +  D+T + G+ 
Sbjct: 171 ELGQPMNPQHPSKNVEAAYIQAVRYKGGTVRLVRDTKEIAPSGWFGPFDPKDSTSELGQE 230

Query: 238 LLSYFANCFIQLLNDINSF 256
            L          L +I  F
Sbjct: 231 ALDMSVTFIRGFLEEIKGF 249


>gi|328468130|gb|EGF39136.1| creatinine amidohydrolase, putative [Listeria monocytogenes 1816]
          Length = 475

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 59/239 (24%), Positives = 96/239 (40%), Gaps = 18/239 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +PV P G  
Sbjct: 13  AKITKTKPVLLPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETSGFVLPVLPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ TL+     +  + I +++ K G R  V ++ H GN   +   + E   ++
Sbjct: 69  WSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAARELYAKY 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSR 192
             +V+   +        +             H  EIETS+ML L+P    M  A +    
Sbjct: 129 PDMVILHIFYPNIQKLAMDVREGNANHHTYIHACEIETSLMLYLSPENADMSRAIDDPPI 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                               W  ++     V+G A  AT +KGE L+       ++L+ 
Sbjct: 189 LPIDAD---------FTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKTLKTCVELIK 236


>gi|71905720|ref|YP_283307.1| creatininase [Dechloromonas aromatica RCB]
 gi|71845341|gb|AAZ44837.1| Creatininase [Dechloromonas aromatica RCB]
          Length = 252

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 65/266 (24%), Positives = 101/266 (37%), Gaps = 22/266 (8%)

Query: 5   IIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           +++ D +     D         +LP+GA EQHGPHL    DT+IA  L   +        
Sbjct: 1   MLWNDLTWQELPDVLAACGHAAILPVGATEQHGPHLGCGVDTVIADQLCRAVAKRTG--- 57

Query: 63  PVTCMPVEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
            V  +P  P G S+ H     GT  +T    IE    I D     G+R++ I+NAH  N+
Sbjct: 58  -VPMLPPLPYGCSLGHSRRWPGTIAVTPVVLIEFVKQIGDWAYHSGVRRLFIVNAHVTNA 116

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +       R     L+V+   +     +            H  + ETS+MLA+AP  V
Sbjct: 117 APLRCALEMLRAEHDDLMVAVINTASLSQRVREFHAADGDDWHANDAETSLMLAIAPEGV 176

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + +                      G   F   +   +  GV G    AT  KGE   ++
Sbjct: 177 RPEKLPEADDPDR-----------TGCCVFAHPVNRTSRNGVTGQPSAATAAKGEQWFAW 225

Query: 242 FANCFIQLL----NDINSFDVSIFDK 263
            ++   +L+     +    D S F +
Sbjct: 226 LSDDLAELIARGCQETPPLDFSYFSQ 251


>gi|158604963|gb|ABW74778.1| creatininase [Campylobacter concisus 13826]
          Length = 257

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 63/269 (23%), Positives = 119/269 (44%), Gaps = 19/269 (7%)

Query: 4   LIIFTDNSLPLCA---DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
            ++  + S        +A +    +   G+ E HG HLP+  D  +   +A+R    L  
Sbjct: 3   KVVLNEFSARELKQKFEAHEIDSAITTFGSCESHGWHLPLGPDLFVPEEIAKRAALRLGK 62

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            +    +P  P G SI +     + TL +   I     I +++   GI+ I+ILN H GN
Sbjct: 63  TI---VVPGVPFGTSIHYNQFPMSVTLRFETTIAIAEDIFESLINNGIKHIIILNGHDGN 119

Query: 121 SPLVSIVSTEARMRF--SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
            P + I + + + R   ++LV   +W   T  +   +F   +   HGGE ETS+ +A+ P
Sbjct: 120 IPALEIAARKVKDRHKDAVLVFIPAWWNITGARLKGTFDVWDGLGHGGEGETSITMAVKP 179

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV ++ A++           F         +  W +K++   G  G++  A+++KG+ +
Sbjct: 180 ELVNLEYAKSQVPHDVIGFGEFS--------TIIWDIKEVTETGATGDSTKASLEKGQKM 231

Query: 239 LSYFANCFIQLLNDINSFDVSIFDKDVQK 267
           L    +  ++++  +   D      D +K
Sbjct: 232 LDCVTDYVVEIVEKLEKMDWKY---DHRK 257


>gi|295110922|emb|CBL27672.1| Uncharacterized protein, putative amidase [Synergistetes bacterium
           SGP1]
          Length = 272

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 63/249 (25%), Positives = 104/249 (41%), Gaps = 12/249 (4%)

Query: 10  NSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
            +     +A +KD ++++PLG+ EQ GPH P   D   A  +A+ +              
Sbjct: 9   MTWKEVENAFKKDPVILIPLGSTEQQGPHTPTG-DYRCAEAVAKAVSKRTG----AYMTT 63

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
             P GYS       G+ +L     I     I       GI++I+  N H GN+PL+  VS
Sbjct: 64  CIPFGYSEYFRGFPGSVSLQPKTFISLMEDICCCFLDHGIKRIMFFNGHAGNNPLLDRVS 123

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIIS-FPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
                   +++ + +      P    S F + +   HG E  TSM   L P  ++M+L  
Sbjct: 124 RMILRERGIMIPNVNLWSLLTPAFRKSVFDDPKTSAHGAEPLTSMTWYLNPEDMRMELLP 183

Query: 188 NFS----SRQSEFLRNFKYLRAHG-SHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
                    Q   + N   L   G   S   +M+D++P G++GNA+ A+ + G+ L    
Sbjct: 184 ERPRINRQVQGMDVENLTTLTYDGIGFSVFMNMEDISPDGIMGNALLASPENGKKLFDEV 243

Query: 243 ANCFIQLLN 251
                +L+ 
Sbjct: 244 IRNACKLVE 252


>gi|217966154|ref|YP_002351832.1| creatinine amidohydrolase [Listeria monocytogenes HCC23]
 gi|217335424|gb|ACK41218.1| creatinine amidohydrolase [Listeria monocytogenes HCC23]
 gi|307572236|emb|CAR85415.1| creatinine amidohydrolase [Listeria monocytogenes L99]
          Length = 249

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 59/239 (24%), Positives = 95/239 (39%), Gaps = 18/239 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I            +PV P G  
Sbjct: 13  AKITKTKPVILPIGAVEAHGPHLPLGTDNILASEYSAKIA----TETDGFVLPVLPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ TL+     +  + I +++ K G R  V ++ H GN   +   + E   ++
Sbjct: 69  WSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAARELYAKY 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSR 192
             +V+   +        +             H  EIETS+ML L+P    M  A +    
Sbjct: 129 PDMVILHIFYPNIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADMSRAIDDPPI 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                               W  ++     V+G A  AT +KGE L+       ++L+ 
Sbjct: 189 LPIDAD---------FTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKTLKTCVELIK 236


>gi|16801857|ref|NP_472125.1| hypothetical protein lin2796 [Listeria innocua Clip11262]
 gi|16415332|emb|CAC98022.1| lin2796 [Listeria innocua Clip11262]
 gi|313622182|gb|EFR92724.1| creatinine amidohydrolase [Listeria innocua FSL J1-023]
          Length = 249

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 60/239 (25%), Positives = 96/239 (40%), Gaps = 18/239 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +PV P G  
Sbjct: 13  AKITKTKPVLLPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETDGFVLPVLPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ TL+     +  + I +++ K G R  V ++ H GN   +   + E   +F
Sbjct: 69  WSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAARELYAKF 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSR 192
             ++V   +        +             H  EIETS+ML L+P    M  A +    
Sbjct: 129 PDMIVLHIFYPNIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADMSRAIDDPPI 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                               W  ++     V+G A  AT +KGE L+       ++L+ 
Sbjct: 189 LPIDAD---------FTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKTLKTCVELIK 236


>gi|269121787|ref|YP_003309964.1| creatininase [Sebaldella termitidis ATCC 33386]
 gi|268615665|gb|ACZ10033.1| Creatininase [Sebaldella termitidis ATCC 33386]
          Length = 244

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 61/243 (25%), Positives = 103/243 (42%), Gaps = 17/243 (6%)

Query: 10  NSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
            +     +   K+ +++LP+G+ EQHG HLP+ TDTI+A  LA  +     PR+    +P
Sbjct: 9   MTRTEVEEHLVKNPVMILPVGSTEQHGFHLPLGTDTILAKALARMVA----PRINSLIIP 64

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
               GYS     + GT TL           I  ++   G + ++I+N H  N+  +    
Sbjct: 65  ALYYGYSWVWHKIPGTITLEQEHFKTVLKDIAKSVETYGTKLLIIINGHDANNQSLKYTV 124

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI-HGGEIETSMMLALAPHLVKMDLAE 187
            E + +  M ++   +  F+         E + G+ H  E ETS+MLA    LV M  A 
Sbjct: 125 REMKYQTDMKILYFFYPNFSEIYKKYCESEIQNGLFHAEEFETSLMLAENDKLVDMTKAV 184

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
                      +   +             D++  GV G+A  A  +KG+ +   FA+   
Sbjct: 185 KEYPDYPPLYSHTSEILG-----------DISKSGVFGDATAAGKEKGQKMFEEFADEIC 233

Query: 248 QLL 250
           + +
Sbjct: 234 KAV 236


>gi|313631741|gb|EFR98941.1| creatinine amidohydrolase [Listeria seeligeri FSL N1-067]
 gi|313636090|gb|EFS01970.1| creatinine amidohydrolase [Listeria seeligeri FSL S4-171]
          Length = 249

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 57/239 (23%), Positives = 95/239 (39%), Gaps = 18/239 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +PV P G  
Sbjct: 13  AKITKTTPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETNAFVLPVLPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ T++     +  + I +++ + G R  V ++ H GN   +   + E   +F
Sbjct: 69  WSLQDFPGSLTVSNETVTKMVVEIGESLYRQGFRLFVPVSGHLGNMAALKDAARELYAKF 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSR 192
             ++    +        +             H  EIETS+ML L+P    M  A +    
Sbjct: 129 PDMITLHIFYPNIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADMTRAIDDPPI 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                               W  ++     V+G A  AT +KGE L+       ++L+ 
Sbjct: 189 LPIDAD---------YTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKTLKTCVELIK 236


>gi|226326081|ref|ZP_03801599.1| hypothetical protein COPCOM_03899 [Coprococcus comes ATCC 27758]
 gi|225205623|gb|EEG87977.1| hypothetical protein COPCOM_03899 [Coprococcus comes ATCC 27758]
          Length = 253

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 57/263 (21%), Positives = 102/263 (38%), Gaps = 18/263 (6%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +  T+ + P   +   K+ +V++ +G+ E HG H+P+ TDT+I   L E+I      +  
Sbjct: 1   MRLTNLTWPKAQEYFEKNDMVLISIGSIECHGRHMPLGTDTLIPEHLLEKI----EKKSD 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G         GT  +      +    I  ++ + G RK V LN HGGN  +
Sbjct: 57  VLIAPTIPYGSCQCLAPYPGTIDIDNEVLYQFCRQIFLSLYRHGARKFVFLNGHGGNIKM 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  +  E   +  ++ +   W                 G HGG  ET+ +L + P LV  
Sbjct: 117 IERLGMEFEDKGCLVAMLNWWLM------AWDMNPAWKGGHGGGEETAAILGIDPSLVDK 170

Query: 184 DLAENF----SSRQSEFLRNFKYLRAHG-SHSFGWSMKDLNPKGVVG--NAMDATVKKGE 236
                         +     F+ +   G +     +   +   G +G  +   AT + G+
Sbjct: 171 SEIGGELQFKHLSDNLKTTGFRSVEFKGVNVDIIRNTPHVTDNGWIGPDHPSTATEEWGK 230

Query: 237 GLLSYFANCFIQLLNDINSFDVS 259
            +L   AN  +  + +     +S
Sbjct: 231 EMLETTANYIVDFMEEFKKVKLS 253


>gi|266619232|ref|ZP_06112167.1| putative creatinine amidohydrolase [Clostridium hathewayi DSM
           13479]
 gi|288869223|gb|EFD01522.1| putative creatinine amidohydrolase [Clostridium hathewayi DSM
           13479]
          Length = 238

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 58/245 (23%), Positives = 96/245 (39%), Gaps = 17/245 (6%)

Query: 8   TDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
            + + P+  +  +     ++P+G+ EQHG HLP+ TD  +A  LA     ++  R     
Sbjct: 6   QNMTWPMVKERLEVCSTAIVPIGSTEQHGYHLPLGTDVFLAEHLA----RLISDRTGALV 61

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126
            P    GYS       GT +L           I+ ++ + G+ K+V LN H  N   +  
Sbjct: 62  FPTLNFGYSWVWRDRIGTVSLPQDHLQLVLKDIVKSVERYGVTKLVFLNGHEANGASMKY 121

Query: 127 VSTEARMRFSMLVVSTSWSRF-TIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
              + +    + V+   +     I    +  P      H  E ETS+ML+    LV MDL
Sbjct: 122 AIRDIQDDTPVKVLGMFYPGLQAIYDKYMESPTWGGMFHACEFETSLMLSAREELVHMDL 181

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
           A+     +                    S+ DL+  G  G+   A   KG+ +   FA  
Sbjct: 182 AQAEYPDRPPLYGMDNT-----------SIGDLSVSGTYGDPTAAAKDKGDRMFEEFAAK 230

Query: 246 FIQLL 250
             +L+
Sbjct: 231 AAELI 235


>gi|46908818|ref|YP_015207.1| creatinine amidohydrolase [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47093815|ref|ZP_00231561.1| creatinine amidohydrolase, putative [Listeria monocytogenes str. 4b
           H7858]
 gi|254931085|ref|ZP_05264444.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|46882091|gb|AAT05384.1| putative creatinine amidohydrolase [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47017812|gb|EAL08599.1| creatinine amidohydrolase, putative [Listeria monocytogenes str. 4b
           H7858]
 gi|293582630|gb|EFF94662.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|328469756|gb|EGF40676.1| creatinine amidohydrolase, putative [Listeria monocytogenes 220]
 gi|332313076|gb|EGJ26171.1| Creatinine amidohydrolase [Listeria monocytogenes str. Scott A]
          Length = 249

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 59/239 (24%), Positives = 96/239 (40%), Gaps = 18/239 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +PV P G  
Sbjct: 13  AKITKTKPVLLPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETSGFVLPVLPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ TL+     +  + I +++ K G R  V ++ H GN   +   + E   ++
Sbjct: 69  WSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAARELYAKY 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSR 192
             +V+   +        +             H  EIETS+ML L+P    M  A +    
Sbjct: 129 PDMVILHIFYPNIQKLAMDVREGNANHHTYIHACEIETSLMLYLSPENADMSRAIDDPPI 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                               W  ++     V+G A  AT +KGE L+       ++L+ 
Sbjct: 189 LPIDAD---------FTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKTLKTCVELIK 236


>gi|226225191|ref|YP_002759298.1| creatinine amidohydrolase [Listeria monocytogenes Clip81459]
 gi|254824993|ref|ZP_05229994.1| creatinine amidohydrolase [Listeria monocytogenes FSL J1-194]
 gi|254854148|ref|ZP_05243496.1| creatinine amidohydrolase [Listeria monocytogenes FSL R2-503]
 gi|254994458|ref|ZP_05276648.1| creatinine amidohydrolase [Listeria monocytogenes FSL J2-064]
 gi|255519626|ref|ZP_05386863.1| creatinine amidohydrolase [Listeria monocytogenes FSL J1-175]
 gi|300763603|ref|ZP_07073601.1| creatinine amidohydrolase [Listeria monocytogenes FSL N1-017]
 gi|225877653|emb|CAS06367.1| Putative creatinine amidohydrolase [Listeria monocytogenes serotype
           4b str. CLIP 80459]
 gi|258607540|gb|EEW20148.1| creatinine amidohydrolase [Listeria monocytogenes FSL R2-503]
 gi|293594233|gb|EFG01994.1| creatinine amidohydrolase [Listeria monocytogenes FSL J1-194]
 gi|300515880|gb|EFK42929.1| creatinine amidohydrolase [Listeria monocytogenes FSL N1-017]
          Length = 249

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 59/239 (24%), Positives = 96/239 (40%), Gaps = 18/239 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +PV P G  
Sbjct: 13  AKITKTKPVLLPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETDGFVLPVLPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ TL+     +  + I +++ K G R  V ++ H GN   +   + E   ++
Sbjct: 69  WSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAARELYAKY 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSR 192
             +V+   +        +             H  EIETS+ML L+P    M  A +    
Sbjct: 129 PDMVILHIFYPNIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADMSRAIDDPPI 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                               W  ++     V+G A  AT +KGE L+       ++L+ 
Sbjct: 189 LPIDAD---------FTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKTLKTCVELIK 236


>gi|289435912|ref|YP_003465784.1| creatinine amidohydrolase [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289172156|emb|CBH28702.1| creatinine amidohydrolase [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 249

 Score =  182 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 57/239 (23%), Positives = 95/239 (39%), Gaps = 18/239 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +PV P G  
Sbjct: 13  AKITKTTPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETNAFVLPVLPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ T++     +  + I +++ + G R  V ++ H GN   +   + E   +F
Sbjct: 69  WSLQDFPGSLTVSNETVAKMVVEIGESLYRQGFRLFVPVSGHLGNMAALKDAARELYAKF 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSR 192
             ++    +        +             H  EIETS+ML L+P    M  A +    
Sbjct: 129 PDMITLHIFYPNIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADMTRAIDDPPI 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                               W  ++     V+G A  AT +KGE L+       ++L+ 
Sbjct: 189 LPIDAD---------YTPTPW--QNFTKTAVLGEATLATAEKGEYLIEKTLKTCVELIK 236


>gi|55376890|ref|YP_134741.1| creatinine amidohydrolase [Haloarcula marismortui ATCC 43049]
 gi|55229615|gb|AAV45035.1| creatinine amidohydrolase [Haloarcula marismortui ATCC 43049]
          Length = 266

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 63/252 (25%), Positives = 107/252 (42%), Gaps = 4/252 (1%)

Query: 7   FTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   +     +  +    ++V+P+G+ EQHG HLP+ TDT++   + +     L     V
Sbjct: 13  WAGMTAGQIRNVGEQPGSVLVIPVGSVEQHGNHLPVVTDTLLVEAMVDTAIERLDGVPVV 72

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
                   G+S  H+   GT +L +A        I  A  + G   ++ +N HGGNS L+
Sbjct: 73  VTP-PVWSGFSPHHLSFGGTLSLEFAHLRATLEDIAHAGIQNGFDAMLFVNGHGGNSSLI 131

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQ-GIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
             V +   +     V+ T++      +   +   ET    HGGE ETS+MLAL P LV  
Sbjct: 132 DAVVSTVGVDTDAEVLGTTYFHLASDRIEELRTTETGGMAHGGEFETSLMLALRPDLVGD 191

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
               +       +    + L   G+ S   S  + +  G +G    A+ + GE + S   
Sbjct: 192 PAVRDGEPMDEHYGWGGQDLLDGGNVSVYRSFDEYSSSGAIGTPKQASAETGERIRSVIG 251

Query: 244 NCFIQLLNDINS 255
           +    L+  I+ 
Sbjct: 252 DELAALMVAIHE 263


>gi|254172231|ref|ZP_04878907.1| creatininase [Thermococcus sp. AM4]
 gi|214034127|gb|EEB74953.1| creatininase [Thermococcus sp. AM4]
          Length = 239

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 60/248 (24%), Positives = 106/248 (42%), Gaps = 16/248 (6%)

Query: 5   IIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   + S P     +   + V+LP+G+ E HG HLP+ TD      +AE ++  +  R  
Sbjct: 1   MRVEELSWPEFDRIKDKLVAVILPVGSVEAHGRHLPLGTDVFAPVRIAELVEQKIRERGK 60

Query: 64  -VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            V  MP    G+S       GT  +       +   ++  +   G R+IV+LN HGGN  
Sbjct: 61  EVLLMPPIWYGHSFALNVYPGTINVRPESLRMYVGDVLAELAAEGFRRIVLLNGHGGNVY 120

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            ++  + +    +  + V          + I+S   ++   H GE ETS+MLA+ P LV 
Sbjct: 121 PLTEAAEDVAELYPDVEVYLINWWLDFREEILSVCSSQ--GHAGEDETSVMLAVRPELVN 178

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           M  A              + ++ +         K++ P G+  +   AT +KGE +L   
Sbjct: 179 MREARG------------RKVKRNVRVIRKDIGKEVFPDGLNDDPSPATAEKGERILQLV 226

Query: 243 ANCFIQLL 250
           +    +++
Sbjct: 227 SERIARVI 234


>gi|298292221|ref|YP_003694160.1| creatininase [Starkeya novella DSM 506]
 gi|296928732|gb|ADH89541.1| Creatininase [Starkeya novella DSM 506]
          Length = 258

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 68/267 (25%), Positives = 106/267 (39%), Gaps = 30/267 (11%)

Query: 1   MNPLIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M   +   + S P   A       V+LPLG+ EQHGPHLP+N D ++  G+ ER+   + 
Sbjct: 1   MVDSVRLDELSWPEFKAKVAAGAPVLLPLGSTEQHGPHLPLNVDVVLPTGVCERVAREVG 60

Query: 60  PRLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVIL 114
                   P    G      S       GT +L           +I  + + G+R++V++
Sbjct: 61  ----GLVAPTVNYGCKSMPRSGGGEQFPGTLSLDANTFALVVRDVIRNLVRQGVRRLVVV 116

Query: 115 NAHGGNSPL----VSIVSTEARMRF--SMLVVSTSWSRFTIPQGIIS-FPETEIGI---H 164
           N H  N       + +   E +      ++V+   +  F     +   FPE   GI   H
Sbjct: 117 NGHYENCWPSVEGLDLALRELKSEGVDDLVVMRLEYWDFAQRATLDRLFPEGFPGIDLEH 176

Query: 165 GGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV 224
              +ETS+ML L P LV+MD A      +      F      G          L P GV+
Sbjct: 177 ASLLETSLMLVLRPELVEMDKAPTDGPAKFPPYDRFPVPDDFG----------LPPSGVL 226

Query: 225 GNAMDATVKKGEGLLSYFANCFIQLLN 251
             A  +T +KGE L++ +       + 
Sbjct: 227 AVATGSTAEKGEWLMADYVTRISAAMR 253


>gi|260906903|ref|ZP_05915225.1| creatinine amidohydrolase [Brevibacterium linens BL2]
          Length = 268

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 58/258 (22%), Positives = 100/258 (38%), Gaps = 5/258 (1%)

Query: 2   NPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP- 59
             +  + + +      A+ +  +++LP+GA EQHG  LP++TD+I A  +A  +   L  
Sbjct: 11  PQVRKYGELTSLEVEVAKANDALLILPVGACEQHGDGLPLSTDSIRADHVAMAVAEELAG 70

Query: 60  --PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
                    +P    G S  H  + GT +L     ++    +   +   G  +I+++  H
Sbjct: 71  STESPNAFVLPSIDYGVSPHHGNLPGTVSLDPRTFVDIVTTVAGQLCDSGFTRILVITGH 130

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
           GGN   + +           L  + S       +     P TE+  H GE ETS MLA+ 
Sbjct: 131 GGNIAALGVAQQVLLSSHPDLAFAYSPVSGLATETTAQLPRTEVSGHSGESETSQMLAID 190

Query: 178 PHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
             LV        ++   E     +  R     S   +       GV+G+   ATV  GE 
Sbjct: 191 DSLVDSPRLTAGATALDELSPRARLTRTKSPSS-AVTFDRYADNGVLGDPRTATVTAGEN 249

Query: 238 LLSYFANCFIQLLNDINS 255
           +L       +    ++  
Sbjct: 250 ILGEIIAKLVSYSKEMLR 267


>gi|327311762|ref|YP_004338659.1| Creatininase [Thermoproteus uzoniensis 768-20]
 gi|326948241|gb|AEA13347.1| Creatininase [Thermoproteus uzoniensis 768-20]
          Length = 243

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 57/259 (22%), Positives = 106/259 (40%), Gaps = 17/259 (6%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           + + + + P    A K  + VLP+G  E HGPHLP+ TD +    +A  +          
Sbjct: 1   MRWAELTWPEFEKADK-AVAVLPVGVVEAHGPHLPLGTDAL----MAIYVAERAAEEAGA 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P    G +       GT +++       +  +   + + G++ +V++N HGGN   +
Sbjct: 56  LLLPPIWYGTTYVLDRFPGTISISAETLYRLYRDVFAEVARNGVKNLVVVNGHGGNIDAL 115

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
            + + +      M +V  +W      +      ET  G H  E ETS ++A  PHLVK  
Sbjct: 116 RMAAKDVARSADMTIVVVNWWIDLAKEARRRVLETPEG-HAAEDETSEVIAAYPHLVK-- 172

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
                  R ++     +Y     +     + + +  K V G    A+ +KGE +L     
Sbjct: 173 ----AVPRDADEWVEMRY-----AVYGRRAYEAMYAKAVQGYPSRASREKGEEILRAAVE 223

Query: 245 CFIQLLNDINSFDVSIFDK 263
               L+ D+ +  + +  +
Sbjct: 224 ELKSLILDLKAGRLPLERR 242


>gi|325263118|ref|ZP_08129853.1| creatininase [Clostridium sp. D5]
 gi|324031511|gb|EGB92791.1| creatininase [Clostridium sp. D5]
          Length = 253

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 62/257 (24%), Positives = 103/257 (40%), Gaps = 16/257 (6%)

Query: 4   LIIFTDNSLPLCADARKDW---IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
            +   + S     +  KD      +   G+ E HG H  +  D  +   +A+R+   L  
Sbjct: 3   KVFLNEFSALEVQELLKDADQVTAITCFGSCESHGWHCCLGPDYFVPTEVAKRVAEKLD- 61

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V  +P  P G SI +     + TL Y   I     I +++   GI+ I ILN H GN
Sbjct: 62  --NVIVVPCVPFGTSIHYNQYPMSITLRYDTEIAIAEDIFESLINNGIKHIYILNGHDGN 119

Query: 121 SPLVSIVSTEARMRFSM--LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
            P + I +   + R      +    W     P     F       HGGE ETS+M+A+ P
Sbjct: 120 IPALEIAAHNVKNRHKDAKFLYLPDWWTKVGPVMGDRFEVWNGLGHGGEGETSIMMAVRP 179

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV ++ A++            K +  + +    W +K+L   G  G+   A+++KG  +
Sbjct: 180 ELVNLEYAKSQVPE--------KVIEINETTGIIWDIKELTETGATGDPTKASIEKGNQM 231

Query: 239 LSYFANCFIQLLNDINS 255
           L          + ++N 
Sbjct: 232 LDILVGIVADAIEEMNK 248


>gi|110801095|ref|YP_695202.1| creatininase [Clostridium perfringens ATCC 13124]
 gi|168204534|ref|ZP_02630539.1| creatininase [Clostridium perfringens E str. JGS1987]
 gi|168214350|ref|ZP_02639975.1| creatininase [Clostridium perfringens CPE str. F4969]
 gi|168217419|ref|ZP_02643044.1| creatininase [Clostridium perfringens NCTC 8239]
 gi|169344486|ref|ZP_02865455.1| creatininase [Clostridium perfringens C str. JGS1495]
 gi|182624093|ref|ZP_02951880.1| creatininase [Clostridium perfringens D str. JGS1721]
 gi|110675742|gb|ABG84729.1| creatininase [Clostridium perfringens ATCC 13124]
 gi|169297406|gb|EDS79515.1| creatininase [Clostridium perfringens C str. JGS1495]
 gi|170663802|gb|EDT16485.1| creatininase [Clostridium perfringens E str. JGS1987]
 gi|170714170|gb|EDT26352.1| creatininase [Clostridium perfringens CPE str. F4969]
 gi|177910709|gb|EDT73069.1| creatininase [Clostridium perfringens D str. JGS1721]
 gi|182380520|gb|EDT77999.1| creatininase [Clostridium perfringens NCTC 8239]
          Length = 251

 Score =  181 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 61/263 (23%), Positives = 103/263 (39%), Gaps = 28/263 (10%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M   +   + +    A  +KD +++LP+G+ EQHGPHLP   DT+IA G A RI      
Sbjct: 1   MYENVKMENMTWREFAK-KKDDVIILPIGSTEQHGPHLPTCVDTVIANGFAYRIAE---- 55

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
           ++     P    GY     S       GT  L  A      + IID   + G  KI IL+
Sbjct: 56  KINGVVAPALSYGYKSKPLSGGGPLFPGTIDLNGATLQALVMDIIDEFVRDGFTKIFILS 115

Query: 116 AHGGNSPLVSIVSTEARMRFSMLV--VSTSWSRFTIPQGIISFPE-----TEIGIHGGEI 168
           AH  N   +         ++   V  + T+W     P  I    +          H    
Sbjct: 116 AHFENEAFIVEAMDLCSAKYGDKVQLLLTNWWDPMSPDVIDKVFDEVPFPGWALEHAAVT 175

Query: 169 ETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM 228
           ETS+M+  AP LV+ D   +  +        +   +                 G++ +A 
Sbjct: 176 ETSLMMYFAPELVREDKIMDTENASPATYYRYPIEKDIVP-----------ETGILASAK 224

Query: 229 DATVKKGEGLLSYFANCFIQLLN 251
            ++ ++G+ ++       I++++
Sbjct: 225 SSSAERGKIIVDDVIPNIIEIID 247


>gi|222478519|ref|YP_002564756.1| Creatininase [Halorubrum lacusprofundi ATCC 49239]
 gi|222451421|gb|ACM55686.1| Creatininase [Halorubrum lacusprofundi ATCC 49239]
          Length = 249

 Score =  181 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 58/252 (23%), Positives = 101/252 (40%), Gaps = 20/252 (7%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI-----LP 59
           +   D +     DA  D +  +P+G+ EQHGPH P+ TDT+ A  +AE   +        
Sbjct: 1   MRLADATWTDVRDADID-VAFVPVGSTEQHGPHAPLGTDTLNAVAVAEAGAAAYEAVETE 59

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
               V   P  P+G + EH   DGT  ++      +     +++   GI ++V +N HGG
Sbjct: 60  SSADVVVTPPIPVGVAEEHRAFDGTMWISPDTFRAYVREAAESLPHHGIDRVVFVNGHGG 119

Query: 120 NSPLVSIVSTEARMR--FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
           N   ++ V+             V+ +W                   H G +ET+++ A  
Sbjct: 120 NVEALAEVARRFSRDDGHDGYAVAFTWFEAVG-------EHAGDMGHAGPLETALLRATN 172

Query: 178 PHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
           P LV+ D  E      ++    +         +      + +  GVVG+      ++GE 
Sbjct: 173 PDLVREDRIEAAREGAADRWGEWVS-----GVNLAHDSDEFSDNGVVGDPTAGDAERGEV 227

Query: 238 LLSYFANCFIQL 249
           LL   ++   +L
Sbjct: 228 LLDLASDALAEL 239


>gi|18309739|ref|NP_561673.1| creatinase [Clostridium perfringens str. 13]
 gi|168209870|ref|ZP_02635495.1| creatininase [Clostridium perfringens B str. ATCC 3626]
 gi|18144417|dbj|BAB80463.1| creatinase [Clostridium perfringens str. 13]
 gi|170711961|gb|EDT24143.1| creatininase [Clostridium perfringens B str. ATCC 3626]
          Length = 251

 Score =  181 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 61/263 (23%), Positives = 103/263 (39%), Gaps = 28/263 (10%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M   +   + +    A  +KD +++LP+G+ EQHGPHLP   DT+IA G A RI      
Sbjct: 1   MYENVKMENMTWREFAK-KKDDVIILPIGSTEQHGPHLPTCVDTVIANGFAYRIAE---- 55

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
           ++     P    GY     S       GT  L  A      + IID   + G  KI IL+
Sbjct: 56  KINGVVAPALSYGYKSKPLSGGGPLFPGTIDLNGATLQALVMDIIDEFVRDGFTKIFILS 115

Query: 116 AHGGNSPLVSIVSTEARMRFSMLV--VSTSWSRFTIPQGIISFPE-----TEIGIHGGEI 168
           AH  N   +         ++   V  + T+W     P  I    +          H    
Sbjct: 116 AHFENEAFIVEAMDLCSAKYGDKVQLLLTNWWDPMSPDVIDKVFDEVPFPGWALEHAAVT 175

Query: 169 ETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM 228
           ETS+M+  AP LV+ D   +  +        +   +                 G++ +A 
Sbjct: 176 ETSLMMYFAPELVREDKIMDTENASPATYYRYPIEKDIVP-----------ETGILASAK 224

Query: 229 DATVKKGEGLLSYFANCFIQLLN 251
            ++ ++G+ ++       I++++
Sbjct: 225 SSSAERGKIIVDDVIPNIIKIID 247


>gi|302339504|ref|YP_003804710.1| creatininase [Spirochaeta smaragdinae DSM 11293]
 gi|301636689|gb|ADK82116.1| Creatininase [Spirochaeta smaragdinae DSM 11293]
          Length = 250

 Score =  181 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 53/258 (20%), Positives = 99/258 (38%), Gaps = 16/258 (6%)

Query: 5   IIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     +        ++D I+V+P G+ EQHGP   + TD ++   LA+R+      +  
Sbjct: 1   MYLHKMTSTQAETALKQDPIIVIPTGSTEQHGPQCALGTDFLVPQHLADRV----SGKKN 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G    HM   G+  + Y         I  ++   G R+ +++N HGGN+P 
Sbjct: 57  VIVAPAIPFGVCPYHMSFAGSIDIGYEGLYTLMSGITRSLMHHGARRFLVINGHGGNNPA 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +   + +      ++     WS                G HG  +ETS M+A+    V +
Sbjct: 117 LDKAALDVYHAGGIMASIDWWSVVGQIDERF-----ANGGHGDILETSAMMAVDESCVDL 171

Query: 184 DLAENFSSRQSEFLRNFKYLRA----HGSHSFGWSMKDLNPKGVV--GNAMDATVKKGEG 237
            L+ + +          +Y++      G        K+L   G    G+   +T K G+ 
Sbjct: 172 SLSRDMAPVHPTGEIKAQYIQMVNFRGGLVRMARDTKELASNGWFGPGDPRGSTKKFGQD 231

Query: 238 LLSYFANCFIQLLNDINS 255
           ++        + + +   
Sbjct: 232 MMDVCVEFISEFIEEYRK 249


>gi|225571110|ref|ZP_03780127.1| hypothetical protein CLOHYLEM_07216 [Clostridium hylemonae DSM
           15053]
 gi|225160191|gb|EEG72810.1| hypothetical protein CLOHYLEM_07216 [Clostridium hylemonae DSM
           15053]
          Length = 268

 Score =  181 bits (460), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 59/276 (21%), Positives = 107/276 (38%), Gaps = 26/276 (9%)

Query: 1   MNPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M   I   +N+     +A +   + ++P+G+ EQHGP LP+ TD IIA  LAE +     
Sbjct: 1   MTNFIF--ENTWEENEEAIRTKKLAIIPVGSTEQHGPALPVGTDWIIAQYLAEMVGKRTD 58

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             L     PV P G+++ H    GT  ++      +   +   +   G    + +N HGG
Sbjct: 59  KGL---VTPVIPFGHALYHADFPGTMAVSQTTLTAYVSEVCQQLISYGFTHFLFINGHGG 115

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N+  +  V  + R++         +                   HG   ETS+M+ +AP 
Sbjct: 116 NNNALYDVGQQLRLQNIPAANIQWFEVAGDLDSKWGLI-----GHGDITETSVMMHIAPD 170

Query: 180 LVKMDLA---ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV---GN------- 226
            VK++ A   EN      + L   +              +D++  G +   G+       
Sbjct: 171 TVKVERAHIPENQKIGNIKLLDLHRGEFEGAGVYLNLRTRDVSKTGDLIEHGHSSGVDYS 230

Query: 227 --AMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
             A DA+ + G  +     +  ++ +++   F    
Sbjct: 231 RSAADASAELGREVCEAVVDYMLRFIDEFVEFQFEY 266


>gi|290891832|ref|ZP_06554829.1| creatinine amidohydrolase [Listeria monocytogenes FSL J2-071]
 gi|290558426|gb|EFD91943.1| creatinine amidohydrolase [Listeria monocytogenes FSL J2-071]
          Length = 249

 Score =  181 bits (460), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 59/239 (24%), Positives = 96/239 (40%), Gaps = 18/239 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +PV P G  
Sbjct: 13  AKITKTKPVILPIGAVEAHGPHLPLGTDNILASEYSAKIAA----ETDGFVLPVLPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ TL+     +  + I +++ K G R  V ++ H GN   +   + E   ++
Sbjct: 69  WSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAARELYAKY 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSR 192
             +V+   +        +             H  EIETS+ML L+P    M  A +    
Sbjct: 129 PDMVILHIFYPNIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADMSRAIDDPPI 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                               W  ++     V+G A  AT +KGE L+       ++L+ 
Sbjct: 189 LPIDAD---------FTPTPW--QNFTKTAVLGEATLATAEKGEYLIGKTLKTCVELIK 236


>gi|291563441|emb|CBL42257.1| Uncharacterized protein, putative amidase [butyrate-producing
           bacterium SS3/4]
          Length = 253

 Score =  181 bits (460), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 54/263 (20%), Positives = 101/263 (38%), Gaps = 18/263 (6%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   + + P   +   K+ +V++ +G+ E HG H+P+ TDT+I   L E+I      +  
Sbjct: 1   MRLENLTWPKAQEYFEKNDMVLVSIGSIECHGRHMPLGTDTLIPNHLLEKI----EKKSD 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G +       G+  +      +    +  ++ + G RK V LN HGGN  +
Sbjct: 57  VLIAPTIPYGSTPGLAPYPGSIDIDSEVLYQFCRQVFLSLYRHGARKFVFLNGHGGNIKM 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  +  E   +  ++ +   W                 G HGG  ET+ +L + P LV  
Sbjct: 117 IQRLGMEFEDKDCLVAMLNWWMM------AWDMNPAWKGGHGGGEETAAILGIDPSLVDK 170

Query: 184 DLAENF----SSRQSEFLRNFKYLRAHG-SHSFGWSMKDLNPKGVVG--NAMDATVKKGE 236
                         +     F+ +   G +         +   G +G  +   AT + G+
Sbjct: 171 SEIGGELQFKHLSDNLKTTGFRSVEYKGVTVEIPRKTPHVTDNGWIGPDHPSTATEEWGK 230

Query: 237 GLLSYFANCFIQLLNDINSFDVS 259
            +L   AN  +  + +     +S
Sbjct: 231 EMLETTANYIVDFMEEFKKVKLS 253


>gi|315647315|ref|ZP_07900428.1| Creatininase [Paenibacillus vortex V453]
 gi|315277517|gb|EFU40846.1| Creatininase [Paenibacillus vortex V453]
          Length = 242

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 58/246 (23%), Positives = 99/246 (40%), Gaps = 20/246 (8%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS  +    R+    +LP+GA E HGPHLP+ TD ++AA LA+++            +P
Sbjct: 6   ENSAEVKDKIRRLGAAILPIGAVEAHGPHLPLGTDNLLAARLADKLAERTDS----FVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
             P G         G+  ++    I     I +++ + G R  +++N H GN+  +   +
Sbjct: 62  TLPYGQVWSLRNFPGSINVSNEALIRLLADIGESLYQQGFRIFIMVNGHLGNAAALKEAA 121

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI----HGGEIETSMMLALAPHLVKMD 184
                R   L V   +      +      E         H  EIETS ML LA   V M 
Sbjct: 122 RILYERVPALKVF-YFFYPGTKEITAEVREASAAHGTYMHADEIETSYMLYLAGEYVDMS 180

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
            A + +                      W  +++    V+G+A  AT +KGE ++    +
Sbjct: 181 KAIDGAPHIPFDAD---------FTPTPW--EEMTASAVLGDATLATREKGERIIQRSLD 229

Query: 245 CFIQLL 250
              +++
Sbjct: 230 VMAEMV 235


>gi|28211518|ref|NP_782462.1| creatininase [Clostridium tetani E88]
 gi|28203959|gb|AAO36399.1| creatininase [Clostridium tetani E88]
          Length = 251

 Score =  180 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 57/263 (21%), Positives = 101/263 (38%), Gaps = 28/263 (10%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M   +   + +       +KD +++LP+G+ EQHGPHLP   DT++A G A RI      
Sbjct: 1   MYENVKMENMTWKEFEK-KKDNVIILPIGSTEQHGPHLPTCVDTVLANGFAYRIAE---- 55

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
           ++     P    GY     S       GT  L  A      + I+D   + G  KI +L+
Sbjct: 56  KIDGVVAPALSYGYKSKPLSGGGPLFPGTIDLNGATLQALIMDIVDEFVRDGFTKIFLLS 115

Query: 116 AHGGNSPLVSIVSTEARMRFSMLV--VSTSWSRFTIPQGIIS-----FPETEIGIHGGEI 168
           AH  N   +         ++   V  + T+W     P  I               H    
Sbjct: 116 AHFENEAFIVEAMDLCSQKYGDKVQILLTNWWDPMSPDVIDKIFTEVPFPGWALEHAAVT 175

Query: 169 ETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM 228
           ETS+M+  AP LV+ D   +  +        +   +                 G++ +A 
Sbjct: 176 ETSLMMYFAPELVREDQILDTENASPATYYRYPIEKDIVP-----------ETGILASAK 224

Query: 229 DATVKKGEGLLSYFANCFIQLLN 251
            ++ +KG+ ++       +++++
Sbjct: 225 SSSAEKGKIIVDDVIPNILKIID 247


>gi|284042712|ref|YP_003393052.1| creatininase [Conexibacter woesei DSM 14684]
 gi|283946933|gb|ADB49677.1| Creatininase [Conexibacter woesei DSM 14684]
          Length = 299

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 57/257 (22%), Positives = 100/257 (38%), Gaps = 8/257 (3%)

Query: 3   PLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P    +  +     DA     + ++P+G+ EQHGPH+ ++ D  IA G A R+   L   
Sbjct: 42  PSRDLSRLTWQQARDALGRARVALVPIGSCEQHGPHMTLDADLAIATGFAGRLADALGDE 101

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
                 P    G S  H+   GT TL     +     +++++   G+ +++++N HGGN 
Sbjct: 102 --AVVCPGVAYGMSEHHLAFPGTLTLRAETLLAIVRDLVESLAHWGVTRVLLVNGHGGNL 159

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             + + + EA      ++V            I          H  EIETS+ LA+AP  V
Sbjct: 160 DALRLAAREAVRDRPGVLVGAVMWSVLAADAIAPHAVGPRYGHACEIETSVALAVAPQAV 219

Query: 182 KMDLAENFSSRQSEF-LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
             +     +       L   +  R      F          G +G+A  A+ + GE +++
Sbjct: 220 LSERIAAPAPTPEGASLSEPQGARYDLPVPF----HHWTTDGALGDARHASRELGEQIVA 275

Query: 241 YFANCFIQLLNDINSFD 257
                   L   +   +
Sbjct: 276 VAIERATALARRLMEVE 292


>gi|167768706|ref|ZP_02440759.1| hypothetical protein ANACOL_00022 [Anaerotruncus colihominis DSM
           17241]
 gi|167669104|gb|EDS13234.1| hypothetical protein ANACOL_00022 [Anaerotruncus colihominis DSM
           17241]
          Length = 273

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 70/258 (27%), Positives = 116/258 (44%), Gaps = 17/258 (6%)

Query: 9   DNSLPLCADARKDWIV-VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
             S        +  +  VLP+G+ EQHG HLP+ TD +I     + ++  L        +
Sbjct: 26  QMSWLEVDALDRSRLAYVLPVGSTEQHGRHLPVGTDDLILQTSLDGLEKHLKTENTFLRL 85

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P    G S EH+   GT TL  A  +     ++  +++  ++ +VI+N+HGGN+P+   +
Sbjct: 86  PTLHYGNSFEHLDFPGTVTLRTATMLAFVEDLMMCMQRHQVKYLVIVNSHGGNAPVFHAM 145

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEI--GIHGGEIETSMMLALAPHLVKMDL 185
           + E   RF + V +  +      Q      +T I   IHGGEIET+ +    P  VK D 
Sbjct: 146 AQEWGQRFGIRVFNIDYFGSNFFQDAQPLLQTAINQDIHGGEIETAYLQYALPQTVKADF 205

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNP-KGVVGNAMDATVKKGEGLLSYFAN 244
               +    E            ++ +GW  +DL P  G++G A  +T++ GE L  Y  +
Sbjct: 206 IRPENDVFVELK----------NYYYGWLTRDLAPGSGLLGGASRSTLETGEKLFRYVQD 255

Query: 245 CFIQLLNDINSFDVSIFD 262
                    ++FD  + D
Sbjct: 256 KLAGY---FHAFDKELND 270


>gi|284167121|ref|YP_003405399.1| creatininase [Haloterrigena turkmenica DSM 5511]
 gi|284016776|gb|ADB62726.1| Creatininase [Haloterrigena turkmenica DSM 5511]
          Length = 260

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 64/253 (25%), Positives = 107/253 (42%), Gaps = 21/253 (8%)

Query: 7   FTDNSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
            T+ +      A  D    V++P+GA EQHGPHLP+ TDT I   +AER+ + L      
Sbjct: 9   LTECTWRDVETAIDDGRTTVIVPIGATEQHGPHLPLRTDTTIGDAIAERLANRLGD---A 65

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P  P G S EH    GT +++           + ++ + G  ++V+L +HGG+   V
Sbjct: 66  LVGPAIPFGPSREHEAFPGTVSISPRTLRTLLGDYVASLERSGFERVVLLPSHGGSFASV 125

Query: 125 SIVSTEARMRFSMLVVSTSW-----SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           +    E      + VV+                       E  +H G +ET++MLA+ P 
Sbjct: 126 AAAHPELACSHDVDVVAIDDLGRYLELLNEGLDRAGIDHREPVVHAGAVETAVMLAVDPD 185

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            V+ D A +         + ++             +   +P GV+G+A  AT   GE +L
Sbjct: 186 AVRADRAPDGYDGPVSAAKLYRD-----------GIDAYSPNGVLGDARPATADVGETIL 234

Query: 240 SYFANCFIQLLND 252
            +  + +   + D
Sbjct: 235 EHVVDAYAAEVRD 247


>gi|329927337|ref|ZP_08281596.1| creatininase [Paenibacillus sp. HGF5]
 gi|328938476|gb|EGG34861.1| creatininase [Paenibacillus sp. HGF5]
          Length = 242

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 98/246 (39%), Gaps = 20/246 (8%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS+ +    RK    +LP+GA E HGPHLP+ TD ++A+ LA+++            +P
Sbjct: 6   ENSVEVEEKIRKLGAAILPIGAVEAHGPHLPLGTDNLLASRLADKLAERTDS----FVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
             P G         G+  ++    I     I ++I   G R  +++N H GN+  +   +
Sbjct: 62  TLPYGQVWSLRNFPGSINVSNEALIRLLADIGESIYHQGFRLFIMVNGHLGNAVAMKEAA 121

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI----HGGEIETSMMLALAPHLVKMD 184
                R   L V   +      +      E         H  EIETS ML LA   V M 
Sbjct: 122 RILYERVPELKVF-YFFYPGTKEITAEVREASAAHGSYMHADEIETSYMLYLAGEYVDMS 180

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
            A + + +                    W  +++    V+G+A  AT +KGE ++     
Sbjct: 181 KAIDGAPQIPIEAD---------FTPTPW--EEMTASAVLGDATLATREKGERIIERSLE 229

Query: 245 CFIQLL 250
               ++
Sbjct: 230 VMADMV 235


>gi|311746121|ref|ZP_07719906.1| putative amidase [Algoriphagus sp. PR1]
 gi|126576341|gb|EAZ80619.1| putative amidase [Algoriphagus sp. PR1]
          Length = 253

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 58/254 (22%), Positives = 106/254 (41%), Gaps = 12/254 (4%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAE-RIKSILP 59
           M P  +  + +       R + + VLP GA E H  H+P  TD   A  +AE   K    
Sbjct: 1   MKPY-LLKEANWKNLKTDRFE-LAVLPWGATEAHNYHMPYGTDVYEADAIAEIGAKKAWE 58

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
               V  +P  P G +     +     L  +  +     +I+ + + G++K++ILN+HGG
Sbjct: 59  KGSKVIVLPTIPFGVNTGQHDIYLDMNLNPSTQMAILRDLIEVLDRQGLKKLLILNSHGG 118

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N      +  E  + F  +++ T     ++ + +      E+G H  E+ETS+++ L P 
Sbjct: 119 N--DFKTILRELGLEFPDMLLFTCNWFQSLDKTLY---FEEMGDHADEMETSLIMYLHPE 173

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV         S +   +   +   A     +     +++    +GN   A+ +KG+   
Sbjct: 174 LVSPLEEAGLGSEKKSVITGLQEKWAWAERRW----SEVSEDTGIGNPKKASPEKGKLYF 229

Query: 240 SYFANCFIQLLNDI 253
               N   QL+ +I
Sbjct: 230 EDATNKVAQLMTEI 243


>gi|225165847|ref|ZP_03727624.1| creatininase [Opitutaceae bacterium TAV2]
 gi|224799906|gb|EEG18358.1| creatininase [Opitutaceae bacterium TAV2]
          Length = 233

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 77/219 (35%), Positives = 110/219 (50%), Gaps = 9/219 (4%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           +LP+ A EQHGPHLP+ TD II  GL     + LP   PV   P    G S EH    GT
Sbjct: 1   ILPIAAIEQHGPHLPVGTDAIIGHGLLAAALARLPDDAPVWIAPPLTYGKSTEHETYAGT 60

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSW 144
            +LT         A  + + ++G R + ILN HGGNS +++    E +  F   + +   
Sbjct: 61  LSLTTPTLRALLRAQAEQLHRLGFRTLAILNTHGGNSAVLTYTLRELQTAFDPPLRAGML 120

Query: 145 SRFTIPQ-----GIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           +   +P+        +  E   G H G+ ETS+MLALAP  V+MD A          L +
Sbjct: 121 THGFVPELKPGPDEFTAQERAYGFHAGDWETSLMLALAPDTVRMDRAICA---WPARLDD 177

Query: 200 FKYLRAHGS-HSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
              LR  G   +F W+ +D++P GV+G+A  AT +KG+ 
Sbjct: 178 PGELRPEGPSLTFAWATEDISPSGVMGDATRATREKGDR 216


>gi|326332450|ref|ZP_08198726.1| putative creatinine amidohydrolase [Nocardioidaceae bacterium
           Broad-1]
 gi|325949763|gb|EGD41827.1| putative creatinine amidohydrolase [Nocardioidaceae bacterium
           Broad-1]
          Length = 253

 Score =  179 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 64/248 (25%), Positives = 113/248 (45%), Gaps = 3/248 (1%)

Query: 6   IFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
              + +    A  A    +VV+P+GA+EQHG  LP+ TD I A  LAE + + LP +  V
Sbjct: 4   RLAEMTTLEAARSAEAGTVVVIPVGAFEQHGAGLPLATDQIRAEALAEAVAAALPGK--V 61

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P  P+G S  H    GT +L            ++++   G R+ +++  HGGN+  +
Sbjct: 62  VIGPGVPVGVSPHHQAFAGTVSLRPTLFAAVVREYVESLAAHGWRRFLVITGHGGNNATL 121

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             ++ E       L ++ +         + +   + +  H GE ET+ ML +APHLV+ D
Sbjct: 122 GTLAQELLRDRPDLELAWTPVTTLAKDAVATMELSPVSGHSGEAETAQMLHVAPHLVRHD 181

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
           L    ++   E     +  R+    +       L+P GV+G+   AT + G  +L+   +
Sbjct: 182 LLTPGTTTPDELDPLARLARSVSQPAVALPYDRLSPTGVLGDPRRATAEDGRAILAEATD 241

Query: 245 CFIQLLND 252
             +  + +
Sbjct: 242 RIVAFIKE 249


>gi|255026903|ref|ZP_05298889.1| hypothetical protein LmonocytFSL_12236 [Listeria monocytogenes FSL
           J2-003]
          Length = 235

 Score =  179 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 98/240 (40%), Gaps = 17/240 (7%)

Query: 9   DNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           + +      A  D  + +LPLGA EQHG HLP+  D  +A  LAE +            +
Sbjct: 10  NMTRDEVEKAITDFPVAILPLGATEQHGHHLPLGVDIFLADHLAELVSEKTG----AVVI 65

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P  P GYS     + GT ++           +  ++ + G++ +V++N H  N+  +   
Sbjct: 66  PPMPFGYSWVWRDIPGTISIQQHHVEAIIKDVAHSVSRYGVKMLVLINGHDSNNNSMKYA 125

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLA 186
             E      M V+   +   +          T  G IH  E ETS+MLA    LV+M  A
Sbjct: 126 VRELADELEMPVMYLFYPSLSEVMEKNCESGTWHGMIHACEFETSLMLATKKELVQMKKA 185

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                 +              + S G    DL+  GV G+A  AT +KGE ++  FA   
Sbjct: 186 VREYPEKPTLYGK-------TTISLG----DLSKSGVYGDASLATEEKGERMVQLFAEKM 234


>gi|118580204|ref|YP_901454.1| creatininase [Pelobacter propionicus DSM 2379]
 gi|118502914|gb|ABK99396.1| Creatininase [Pelobacter propionicus DSM 2379]
          Length = 241

 Score =  179 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 58/253 (22%), Positives = 96/253 (37%), Gaps = 21/253 (8%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +I  + ++P       +   V++P G+ E+HGPHLP++TDT+ A  +A +   + P    
Sbjct: 1   MIIEEMTMPEFEQGLARSRTVLIPFGSVEEHGPHLPLSTDTLEACEVARKAALLTP---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +   P    G         GT +++       +  I+ A+   G+R  + L  H G +  
Sbjct: 57  LFVAPPIHYGNCRSTSCHPGTISISTTTLKMLFKDIVQALYSHGLRNFIALTGHAGGAHC 116

Query: 124 --VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +     E    +     +                ET    H GEIETS +L   PHLV
Sbjct: 117 SALQDAGEEMLSSYPDANFAVVTEYLLARDEGRGLIETPGDAHAGEIETSRILHSHPHLV 176

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           K      F +  +  L   K              +   P GV G+   AT +KG  L   
Sbjct: 177 KGSAPREFPAFPAGILVRDK--------------RRYWPGGVWGDPAKATAEKGARLEEL 222

Query: 242 FANCFIQLLNDIN 254
                ++L+  + 
Sbjct: 223 VVKKLVELIQTVE 235


>gi|323485673|ref|ZP_08091011.1| hypothetical protein HMPREF9474_02762 [Clostridium symbiosum
           WAL-14163]
 gi|323695149|ref|ZP_08109288.1| hypothetical protein HMPREF9475_04153 [Clostridium symbiosum
           WAL-14673]
 gi|323401023|gb|EGA93383.1| hypothetical protein HMPREF9474_02762 [Clostridium symbiosum
           WAL-14163]
 gi|323500807|gb|EGB16730.1| hypothetical protein HMPREF9475_04153 [Clostridium symbiosum
           WAL-14673]
          Length = 241

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 53/245 (21%), Positives = 97/245 (39%), Gaps = 15/245 (6%)

Query: 9   DNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           + S    A+ +     V++P GA E +GP LP+ +D+I++  + E +      +      
Sbjct: 3   EMSWTEFAERKLSCDTVIIPGGAIEVYGPQLPLGSDSIVSKAICEMVAE----KTNAMIG 58

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P   +G S       GT  +           +++++   G +  + +N H GN P++  +
Sbjct: 59  PFIEVGESAALYGFPGTIKIMPQTYYLMMRDVMESLIHWGFKNFMFINMHAGNVPIIGQL 118

Query: 128 STEARMRFSMLVVSTSWSRFTIPQ--GIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
             E +    +      W RFT P   GI          H  E  TS+ML L P  V +  
Sbjct: 119 CREYQRSSGIKCAQIDWWRFTQPNSVGICENTGWMAHGHASECGTSVMLYLHPEYVDLTK 178

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
            E    R  E    +  +  +         +D  P G++G+A   + +KGE ++    + 
Sbjct: 179 TECI--RMPEEYTKYPDIITYTE------FRDKTPNGILGDATIGSREKGEAIVRKCVDK 230

Query: 246 FIQLL 250
               +
Sbjct: 231 IAAFM 235


>gi|212224470|ref|YP_002307706.1| Hypothetical amidase [Thermococcus onnurineus NA1]
 gi|212009427|gb|ACJ16809.1| Hypothetical amidase [Thermococcus onnurineus NA1]
          Length = 238

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 59/249 (23%), Positives = 102/249 (40%), Gaps = 18/249 (7%)

Query: 5   IIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL-PPRL 62
           +   + + P   +A+K    V++P+G+ E HG HLP+ TD      L  R++  +     
Sbjct: 1   MRMEELTWPDFEEAKKSIDTVLIPVGSVEAHGRHLPLGTDVFAPLELCRRVEERVRNAGK 60

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            V   P    G++       GT  +       +   +I    + G +++V++N HGGN  
Sbjct: 61  DVLIAPPIWYGHTFVLNVYPGTIDVRADAFKAYVREVISEFVEEGFKRVVLMNGHGGNVY 120

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            +   + E    +    +          + I+S   ++   H G+ ETS+MLA+ P LVK
Sbjct: 121 PLIEAAEEVAESYPNAEIWLINWWIDFREDILSICSSQ--GHAGQDETSVMLAIRPELVK 178

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSM-KDLNPKGVVGNAMDATVKKGEGLLSY 241
           MD A                 R          + ++L P GV  +   AT + GE +L  
Sbjct: 179 MDKAVGEK-------------RTSRVRVIRKDIGRELFPDGVNDDPGSATRENGEAILGV 225

Query: 242 FANCFIQLL 250
            +    +LL
Sbjct: 226 ISEKIARLL 234


>gi|114778549|ref|ZP_01453376.1| Creatininase [Mariprofundus ferrooxydans PV-1]
 gi|114551138|gb|EAU53698.1| Creatininase [Mariprofundus ferrooxydans PV-1]
          Length = 259

 Score =  179 bits (454), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 55/245 (22%), Positives = 97/245 (39%), Gaps = 18/245 (7%)

Query: 10  NSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
            +     +  +      +LP+GA EQHGPHL    D  IA  L +++ +       +  +
Sbjct: 1   MTWEEIGELPRRGMDAAMLPVGATEQHGPHLGCGMDAEIAGKLCDQVAAATD----IALL 56

Query: 68  PVEPIGYSIEHM-YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126
           P+ P G SI H     GT  L     I+    I D +   G +++ I+N+H  N   +  
Sbjct: 57  PLLPYGCSIGHSKRWPGTLALQPKTLIDVVKQIGDWVHAAGFKRLFIVNSHVTNLAPLRC 116

Query: 127 VSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
                R  +  L+V+   +     +      +     H  E ETS+MLA++P +V+ +  
Sbjct: 117 ALEMLRADYDDLMVALINTGTLSARVRERHFQDAEDWHANEAETSLMLAVSPQMVRPERL 176

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
            +                  G   F   +   +  GV G    A+ ++GE L ++     
Sbjct: 177 ADSDDEDR-----------TGDCVFSHPVNRTSLNGVTGTPSLASRERGEELFAWMVEDL 225

Query: 247 IQLLN 251
            +L+ 
Sbjct: 226 SELIR 230


>gi|291612565|ref|YP_003522722.1| Creatininase [Sideroxydans lithotrophicus ES-1]
 gi|291582677|gb|ADE10335.1| Creatininase [Sideroxydans lithotrophicus ES-1]
          Length = 256

 Score =  179 bits (453), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 93/249 (37%), Gaps = 18/249 (7%)

Query: 5   IIFTDNSLPLCADARKDWIV--VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           + +++ +      A        +LP+GA EQHGPHL    D +IA  L   +      + 
Sbjct: 1   MRWSELTWSEIPAALAAVNHAAILPVGATEQHGPHLGCGVDFVIAEELCLAVSE----KT 56

Query: 63  PVTCMPVEPIGYSIEHM-YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
            V  +P  P G S+ H     GT +L     IE    I D     G+R++ I+NAH  N 
Sbjct: 57  RVPVLPTLPYGSSLGHSKRWPGTISLQPITLIEVVKQIGDWAYHSGVRRLFIVNAHVTNV 116

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +       R     ++V++  S     +            H  + ETS+MLA+AP LV
Sbjct: 117 APLRCALEMLRAEHDDMMVASIGSATLSDRVRKFHFADAADWHANDAETSLMLAIAPALV 176

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + +L                     G   F   +   +  GV G    A+  KG     +
Sbjct: 177 RPELCAEADDMDR-----------TGGCIFPHPVNRTSLNGVTGKPSQASADKGRSGFDW 225

Query: 242 FANCFIQLL 250
                  L+
Sbjct: 226 MVEDLSALI 234


>gi|261408617|ref|YP_003244858.1| Creatininase [Paenibacillus sp. Y412MC10]
 gi|261285080|gb|ACX67051.1| Creatininase [Paenibacillus sp. Y412MC10]
          Length = 242

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 97/246 (39%), Gaps = 20/246 (8%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +NS+ +    RK    +LP+GA E HGPHLP+ TD ++A+ LA+++            +P
Sbjct: 6   ENSVEVEEKIRKLGAAILPIGAVEAHGPHLPLGTDNLLASRLADKLAERTDS----FVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
             P G         G+  ++    I     I ++I   G R  +++N H GN+  +   +
Sbjct: 62  TLPYGQVWSLRNFPGSINVSNEALIRLLADIGESIYHQGFRIFIMVNGHLGNAVALKEAA 121

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI----HGGEIETSMMLALAPHLVKMD 184
                R   L V   +      +      E         H  EIETS ML LA   V M 
Sbjct: 122 RILYERVPELKVF-YFFYPGTKEITAEVREASAAHGSYMHADEIETSYMLYLAGEYVDMS 180

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
            A + +                      W  +++    V+G+A  AT +KGE ++     
Sbjct: 181 KAIDGAPHIPIEAD---------FTPTPW--EEMTASAVLGDATLATREKGERIIERSLE 229

Query: 245 CFIQLL 250
               ++
Sbjct: 230 VMADMV 235


>gi|220919634|ref|YP_002494937.1| Creatininase [Methylobacterium nodulans ORS 2060]
 gi|219952054|gb|ACL62445.1| Creatininase [Methylobacterium nodulans ORS 2060]
          Length = 260

 Score =  178 bits (451), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 64/236 (27%), Positives = 102/236 (43%), Gaps = 6/236 (2%)

Query: 2   NPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
            P + +   S     D AR+D IV+LP+ + EQHGPHLP   D  +   +  R   ++ P
Sbjct: 9   PPEVAWNRLSAEALNDLARRDAIVLLPVASTEQHGPHLPTGVDDFLGTAVCRRTAELVAP 68

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             P+   P    G +  H+   GT TL+ A        +  +I   G RK+V++N+HGGN
Sbjct: 69  DRPIVVAPTVWCGLADHHVAFGGTFTLSLATYHALLRDLCRSILAAGFRKVVLVNSHGGN 128

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
              +S ++ E        + + ++             +    +H  E ETSMM+AL   L
Sbjct: 129 ITALSSLAVELTRELDAPIATATYFMEAADAVSGILEDQGNVMHACEAETSMMMALDSDL 188

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           V             +   +   L        GW  ++++  GV G+A  A+  KGE
Sbjct: 189 VDATRLAEAHGPGFDIADS---LMPTLKRVRGW--QEVSRGGVAGDARRASAAKGE 239


>gi|284172773|ref|YP_003406155.1| Creatininase [Haloterrigena turkmenica DSM 5511]
 gi|284017533|gb|ADB63482.1| Creatininase [Haloterrigena turkmenica DSM 5511]
          Length = 245

 Score =  178 bits (451), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 65/259 (25%), Positives = 110/259 (42%), Gaps = 15/259 (5%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +     +     DA +  + +LP+G+ EQHGPH P+ TDT+ A  +AE           V
Sbjct: 1   MHLERATWTEI-DAVETDLALLPVGSTEQHGPHAPLGTDTLNAEAVAEAAAERY--EGTV 57

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P  P+G + EH    GT   + +    +   I+ ++   G  +IV++N HGGN+  +
Sbjct: 58  AVAPAVPVGIAEEHRQFTGTLWTSESTFKAYVRDIVSSLAHHGFDRIVLVNGHGGNTSAL 117

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             V+     R     V  +W              +    HGG +ET+++    P  V+ D
Sbjct: 118 QEVAGRITRRDDAYTVPFTWFDEVG-------EHSSRMGHGGPLETALVQHANPGAVRED 170

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             E  +   SE   +++     G  +  +   +    GVVG+  +A+ + GE LL   A+
Sbjct: 171 RLEEAAENGSERWGDWQ-----GRVNLAFDSAEFTENGVVGDPREASAELGEELLDAAAD 225

Query: 245 CFIQLLNDINSFDVSIFDK 263
             I LL  +   D+     
Sbjct: 226 ALIALLKTVADRDLDRPAH 244


>gi|313616867|gb|EFR89542.1| creatinine amidohydrolase [Listeria innocua FSL S4-378]
          Length = 249

 Score =  178 bits (451), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 58/239 (24%), Positives = 95/239 (39%), Gaps = 18/239 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   V+LP+GA E HGPHLP+ TD I+A+  + +I +          +PV P G  
Sbjct: 13  AKITKTKPVLLPIGAVEAHGPHLPLGTDNILASEYSVKIAA----ETDGFVLPVLPYGQV 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
                  G+ TL+     +  + I +++ K G R  V ++ H GN   +   + E   +F
Sbjct: 69  WSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLFVPVSGHLGNMAALKDAARELYAKF 128

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLALAPHLVKMDLAENFSSR 192
             +++   +        +             H  EIETS+ML L+P    M  A +    
Sbjct: 129 PDMIILHIFYPNIQKLAMDVREGKANHHTYIHACEIETSLMLYLSPENADMSRAIDDPPI 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                               W  ++     V+G A   T +KGE L+       ++L+ 
Sbjct: 189 LPIDAD---------FTPTPW--QNFTKTAVLGEATXXTAEKGEYLIEKTLKTCVELIK 236


>gi|300713022|ref|YP_003738834.1| Creatininase [Halalkalicoccus jeotgali B3]
 gi|299126706|gb|ADJ17043.1| Creatininase [Halalkalicoccus jeotgali B3]
          Length = 273

 Score =  177 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 57/268 (21%), Positives = 94/268 (35%), Gaps = 10/268 (3%)

Query: 1   MNPLIIFTDNSLPLCA---DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           M       +   P      D  +    ++P+G  EQHG HL M TD  I   + ERI   
Sbjct: 1   MPDTHRLDELRHPQVESYLDRAETPTALIPVGTTEQHGEHLAMGTDAFIPTEICERIAE- 59

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
               +     P    G S  H    G   LTY         I  ++ + G   IV L+ H
Sbjct: 60  ---DVDALVGPPINYGASDMHAGYAGITYLTYRTLATVVHDIAYSLAEAGFTDIVFLSGH 116

Query: 118 GGNSPLVSIVSTEARMRFS--MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
             N     + + +A         V +  +        +  +   + G H    ET+ ++A
Sbjct: 117 LTNDWAAKVGANQASHDLPEENYVYAFPYWDALSGDDMEEYLSFDAGWHANIGETAAVMA 176

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           +   LV ++     +      + N   L  H     G   + ++  GV G+  DAT + G
Sbjct: 177 IDEDLVDLEETAFDAPDLPMDIENPAALLDHLLIGKGAYYR-ISETGVWGDPSDATAELG 235

Query: 236 EGLLSYFANCFIQLLNDINSFDVSIFDK 263
           E       +   +L+N        I+ +
Sbjct: 236 EEYFETITHAVAELINTFQDVRDEIYQR 263


>gi|225570045|ref|ZP_03779070.1| hypothetical protein CLOHYLEM_06141 [Clostridium hylemonae DSM
           15053]
 gi|225161515|gb|EEG74134.1| hypothetical protein CLOHYLEM_06141 [Clostridium hylemonae DSM
           15053]
          Length = 253

 Score =  177 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 103/257 (40%), Gaps = 16/257 (6%)

Query: 4   LIIFTDNSLPLCADARK---DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
            +   + S     +  +   D   +   G+ E HG H  +  D  +   +A+R+   +  
Sbjct: 3   KVFLNEFSALEVKELLEHAEDVTAITCFGSCESHGWHCCLGPDYFVPTEVAKRVAEKMD- 61

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V  +P  P G SI +     + TL Y   I     I +++   GI+ I ILN H GN
Sbjct: 62  --NVVVVPCVPFGTSIHYNQYPMSVTLRYETEIAIAEDIFESLINNGIKHIYILNGHDGN 119

Query: 121 SPLVSIVSTEARMRFSM--LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
            P + I +   + R      +    W     P     F       HGGE ETS+M+A+ P
Sbjct: 120 IPALEIAAHNVKDRHRDAKFLYLPDWWTKVGPIMGERFEVWNGLGHGGEGETSIMMAVRP 179

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV ++ A++            K +  + +    W +K+L   G  G+   A+++KGE +
Sbjct: 180 ELVNLEYAKSQVPE--------KVIEINETTGVIWDIKELTETGATGDPTKASMEKGEQM 231

Query: 239 LSYFANCFIQLLNDINS 255
           L          +  +N 
Sbjct: 232 LDILVGLVADAIEKMNK 248


>gi|326391419|ref|ZP_08212956.1| Creatininase [Thermoanaerobacter ethanolicus JW 200]
 gi|325992554|gb|EGD51009.1| Creatininase [Thermoanaerobacter ethanolicus JW 200]
          Length = 241

 Score =  177 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 62/252 (24%), Positives = 106/252 (42%), Gaps = 19/252 (7%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   + +        +K  IV++P+G+ E HG HLP+ TD        E I+  +     
Sbjct: 1   MYLINYASDDFQKNLQKSDIVIIPVGSVEAHGHHLPLGTDIFSPRLFCEMIERKIGD--Y 58

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G S +     GT  +      E+  A+  ++ + G++K++ LN HGGN   
Sbjct: 59  VWIAPEIPYGQSYDLSVYPGTIHVPSEVLAEYVYAVGKSLYENGLKKLIFLNGHGGNINA 118

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +++ S E  ++  M+V++ +W      + +     T+   H GE ETS +L     LV+M
Sbjct: 119 LNLAS-EKLVQLGMVVLTINWWLDFTKEILTI---TQGQGHAGEDETSAILYYNEKLVQM 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D A                 +      F    K      + G+A  AT +KGE +     
Sbjct: 175 DKATKN------------LKKPLYRVYFKDRGKVFYENAMSGDATLATKEKGEKIFELLT 222

Query: 244 NCFIQLLNDINS 255
              I+++ DI  
Sbjct: 223 EKIIKIILDIRE 234


>gi|254479571|ref|ZP_05092885.1| creatininase subfamily protein [Carboxydibrachium pacificum DSM
           12653]
 gi|214034493|gb|EEB75253.1| creatininase subfamily protein [Carboxydibrachium pacificum DSM
           12653]
          Length = 240

 Score =  177 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 59/251 (23%), Positives = 107/251 (42%), Gaps = 19/251 (7%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   + +        +K   V++P+G+ E HG HLP+ TD        + I+  +     
Sbjct: 1   MYLINYTSDDFQKHLQKSDTVIVPVGSVEAHGHHLPLGTDIFSPRLFCQMIEEKIGD--Y 58

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G S +     GT  +      E+  A+  ++ + G++K++ LN HGGN   
Sbjct: 59  VWIAPEIPYGQSYDLSVYPGTIHVPSEVLAEYVYAVGKSLYENGLKKLIFLNGHGGNINA 118

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +++ S E   +  M V++ +W      + I++  E +   H GE ETS +L     LV+M
Sbjct: 119 LNLAS-EKLAQLGMTVLTINWW-LDFSKEILTITEGQ--GHAGEDETSAILYYDERLVQM 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D A               + +      F    K L    + G+A  AT +KGE +     
Sbjct: 175 DKATKN------------FKKPLYRVYFKDRGKILYENAMSGDATLATKEKGEKIFKLLT 222

Query: 244 NCFIQLLNDIN 254
              ++++ ++ 
Sbjct: 223 EKIVEIILNVR 233


>gi|160936440|ref|ZP_02083809.1| hypothetical protein CLOBOL_01332 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440723|gb|EDP18461.1| hypothetical protein CLOBOL_01332 [Clostridium bolteae ATCC
           BAA-613]
          Length = 304

 Score =  177 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 63/262 (24%), Positives = 111/262 (42%), Gaps = 18/262 (6%)

Query: 3   PLIIFTDNSLPL-CADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
             + F DN+  + CA A++   I +LP+GA EQHGPH P  +D+  A G+AE +      
Sbjct: 13  DSVWFQDNTAAVNCAYAKEVCDIAILPIGAIEQHGPHCPCGSDSFNAMGIAEAVARKSGA 72

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            +           +   H  + GT  LT+   +     I+      G  K +I++AH G 
Sbjct: 73  MILAC---PMYGSHPAHHWGMPGTIPLTFETHVGLLTDIVRGAANAGFNKFLIISAH-GQ 128

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           +  +     +  +     + ST +      +  +         H  E ETS+ L+L P  
Sbjct: 129 TMSMFEAVHKLGIEGYFTIGSTWYDFLRDNKKTLD----TFMWHADEAETSVALSLYPDK 184

Query: 181 VKMDLAENFSSRQ--------SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATV 232
           V MDLA    +          +      + +  H   +F    KD    GV+G+  +A+ 
Sbjct: 185 VHMDLAVPGKAHGLIDSKWKIAPGQAAGEGMLYHFEGTFSLMEKDDLDTGVIGDPTNASK 244

Query: 233 KKGEGLLSYFANCFIQLLNDIN 254
           +KG+ ++   A+ + +LL ++ 
Sbjct: 245 EKGDKIVERCADLYCELLEEVK 266


>gi|266622793|ref|ZP_06115728.1| putative creatinine amidohydrolase [Clostridium hathewayi DSM
           13479]
 gi|288865456|gb|EFC97754.1| putative creatinine amidohydrolase [Clostridium hathewayi DSM
           13479]
          Length = 252

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 63/259 (24%), Positives = 106/259 (40%), Gaps = 21/259 (8%)

Query: 7   FTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
           + + + P   +A ++  + +LPLGA E HGPH+ ++ D  I      R+ +       + 
Sbjct: 4   WRNLTWPEAKEAVEEMPVCLLPLGAIEAHGPHMKLDVDNHICEEQCRRVCA----ETGII 59

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
            MP  P+G         GT TL+Y   I     ++ + RK G   + I + H GN P V 
Sbjct: 60  LMPTIPVGQVWSLNRFPGTLTLSYHTLIAVIKDLLYSFRKRGFELVFIHSHHYGNVPAVK 119

Query: 126 IVSTEARMRFS---MLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPHLV 181
               E    F    M+++    S     + +  S     +  H  E+ETS  L   P  V
Sbjct: 120 QAVRECYDEFRDMKMVILEERQSMRDKAKEVCTSPFAHPVFWHACEVETSQALECCPDRV 179

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
            M+ A     +  E            S    W   ++   GV+G+A   T +KG+ L   
Sbjct: 180 YMERAICDYPKFPEDFD---------STPTYWD--EVTSTGVMGDAKAGTKEKGKVLTEA 228

Query: 242 FANCFIQLLN-DINSFDVS 259
             N  ++L+  ++   ++S
Sbjct: 229 EVNAMVRLVTYEMQKMNLS 247


>gi|292494083|ref|YP_003533225.1| creatininase [Haloferax volcanii DS2]
 gi|291369069|gb|ADE01299.1| creatininase [Haloferax volcanii DS2]
          Length = 231

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 57/251 (22%), Positives = 99/251 (39%), Gaps = 21/251 (8%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +    +S     DA    + +LP+G+ EQHGPH P+ TDTIIA  LA          L  
Sbjct: 1   MHLETSSWTDVKDAAP-TVALLPVGSTEQHGPHAPVGTDTIIAQELASEAGRR--SDLNS 57

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P  P+G +  H +  GT +++      +   I+ ++    +  +V +N HGGN   +
Sbjct: 58  VVLPTIPVGIAPYHSHFPGTLSVSAETLRRYSYEILTSLSNSSVETVVFVNGHGGNGETL 117

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             ++       ++ +    W   +               H GE+ETSM L + P  V   
Sbjct: 118 RNLTRTVADDSTVDLEVFLWEWMSAVDD--------HVNHAGELETSMHLHICPDEV--- 166

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
                 S        +      G  +     ++ +  G VG+A  A+ ++GE L     +
Sbjct: 167 -----GSPTDGDAATWDDTVDGGVVN--RFTEEFSKNGAVGDATSASAEQGEQLFETATD 219

Query: 245 CFIQLLNDINS 255
                L  ++ 
Sbjct: 220 ALCSFLRRVDD 230


>gi|288562910|pdb|3A6J|A Chain A, E122q Mutant Creatininase Complexed With Creatine
 gi|288562911|pdb|3A6J|B Chain B, E122q Mutant Creatininase Complexed With Creatine
 gi|288562912|pdb|3A6J|C Chain C, E122q Mutant Creatininase Complexed With Creatine
 gi|288562913|pdb|3A6J|D Chain D, E122q Mutant Creatininase Complexed With Creatine
 gi|288562914|pdb|3A6J|E Chain E, E122q Mutant Creatininase Complexed With Creatine
 gi|288562915|pdb|3A6J|F Chain F, E122q Mutant Creatininase Complexed With Creatine
 gi|288562916|pdb|3A6K|A Chain A, The E122q Mutant Creatininase, Mn-Zn Type
 gi|288562917|pdb|3A6K|B Chain B, The E122q Mutant Creatininase, Mn-Zn Type
 gi|288562918|pdb|3A6K|C Chain C, The E122q Mutant Creatininase, Mn-Zn Type
 gi|288562919|pdb|3A6K|D Chain D, The E122q Mutant Creatininase, Mn-Zn Type
 gi|288562920|pdb|3A6K|E Chain E, The E122q Mutant Creatininase, Mn-Zn Type
 gi|288562921|pdb|3A6K|F Chain F, The E122q Mutant Creatininase, Mn-Zn Type
 gi|288562922|pdb|3A6L|A Chain A, E122q Mutant Creatininase, Zn-Zn Type
 gi|288562923|pdb|3A6L|B Chain B, E122q Mutant Creatininase, Zn-Zn Type
 gi|288562924|pdb|3A6L|C Chain C, E122q Mutant Creatininase, Zn-Zn Type
 gi|288562925|pdb|3A6L|D Chain D, E122q Mutant Creatininase, Zn-Zn Type
 gi|288562926|pdb|3A6L|E Chain E, E122q Mutant Creatininase, Zn-Zn Type
 gi|288562927|pdb|3A6L|F Chain F, E122q Mutant Creatininase, Zn-Zn Type
          Length = 260

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 67/270 (24%), Positives = 106/270 (39%), Gaps = 33/270 (12%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           M+  +   + +        A  D +++LP+GA EQHG H+ MN D ++   + +R+   +
Sbjct: 1   MSKSVFVGELTWKEYEARVAAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAERI 60

Query: 59  PPRLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVI 113
                   MP    GY     S    +  GT +L  A        II  + + G R++V+
Sbjct: 61  G----ALVMPGLQYGYKSQQKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVL 116

Query: 114 LNAHGGNSPL----VSIVSTEARMRF--SMLVVSTSWSRFTIPQGIIS--FPETEIGI-- 163
           +N H  NS      + +   E R        VV  S+  F     +I   +PE  +G   
Sbjct: 117 MNGHYQNSMFIVEGIDLALRELRYAGIQDFKVVVLSYWDFVKDPAVIQQLYPEGFLGWDI 176

Query: 164 -HGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKG 222
            HGG  ETS+MLAL P LV +D   +           F    A                G
Sbjct: 177 EHGGVFETSLMLALYPDLVDLDRVVDHPPATFPPYDVFPVDPARTPAP-----------G 225

Query: 223 VVGNAMDATVKKGEGLLSYFANCFIQLLND 252
            + +A  A+ +KGE +L          + +
Sbjct: 226 TLSSAKTASREKGELILEVCVQGIADAIRE 255


>gi|319764563|ref|YP_004128500.1| creatininase [Alicycliphilus denitrificans BC]
 gi|330826779|ref|YP_004390082.1| Creatininase [Alicycliphilus denitrificans K601]
 gi|317119124|gb|ADV01613.1| Creatininase [Alicycliphilus denitrificans BC]
 gi|329312151|gb|AEB86566.1| Creatininase [Alicycliphilus denitrificans K601]
          Length = 285

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 93/277 (33%), Positives = 140/277 (50%), Gaps = 12/277 (4%)

Query: 2   NPLII----FTDNSLPLCADARKDWIV-----VLPLGAYEQHGPHLPMNTDTIIAAGLAE 52
            P       +++      A AR   +      VLP+ A EQHGPHLP++ D  +  G+  
Sbjct: 7   PPERFASHWWSELGARDFAQARASGLAQRAVAVLPVAAVEQHGPHLPLSVDATLLQGVIA 66

Query: 53  RIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIV 112
               +LP  LP   +P + +G S EH+   GT TL+ A  I  W  + + + + G+RK++
Sbjct: 67  AALPLLPDGLPALFLPPQNVGLSTEHLSYPGTLTLSPATLIALWTELGECVARAGVRKLL 126

Query: 113 ILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQ---GIISFPETEIGIHGGEIE 169
           +LN HGGN   + IV+ E R R  +LV S+SW    +P    G+    E   GIHGG IE
Sbjct: 127 LLNGHGGNVAPMDIVARELRQRCGLLVYSSSWFSLPLPDEVNGLFGAEEHRFGIHGGAIE 186

Query: 170 TSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMD 229
           TSMML LAP  V+M+ A ++ S   E    +  L    S   GW+++D +P G VG+A  
Sbjct: 187 TSMMLHLAPATVRMEHARHWPSSSQERAARYPILGNGRSAKLGWAIEDYHPAGAVGDAAG 246

Query: 230 ATVKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDVQ 266
           A   KG  ++   A    QL+ +I++  +       +
Sbjct: 247 AMADKGRAVVQAAAQALAQLIAEIHALPLDTVGGAPR 283


>gi|111026498|ref|YP_708781.1| hypothetical protein RHA1_ro10434 [Rhodococcus jostii RHA1]
 gi|110825341|gb|ABH00623.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 280

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 56/272 (20%), Positives = 102/272 (37%), Gaps = 13/272 (4%)

Query: 3   PLIIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
             +   D +    A    +D +V++P G+ EQHGP   +  DT +A G+ E         
Sbjct: 7   QSVWMQDLTWEEVASHIEQDRVVLVPFGSTEQHGPAGVLGVDTYVATGIVEDTAKRTG-- 64

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG-N 120
               C P    G S  HM  +GT +L     I     +  ++   G  +IV++N H G N
Sbjct: 65  --ALCAPPMWFGDSPHHMAFEGTISLRTETLISVVKDVCTSLAHHGFNRIVLVNGHKGSN 122

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
            P +              V+        + + +    +     HGGE+E S +L   P  
Sbjct: 123 LPALGTAVRALHEESLPHVIFAVADPLHLARNVAPSIKETNEHHGGELELSQVLYRYPGR 182

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFG----WSMKD---LNPKGVVGNAMDATVK 233
           ++ D      +  +E    F      G    G    WS ++     P G + +++  T  
Sbjct: 183 IRTDRLTGEGAPFAEVFGGFVGNDLFGPAPDGVDVVWSSREQRKFAPTGSMSSSLGVTED 242

Query: 234 KGEGLLSYFANCFIQLLNDINSFDVSIFDKDV 265
           KG+    +  +   +++  + ++   +   D 
Sbjct: 243 KGKQFHGHLVDRLSEVVEWLRTYSGPLGSIDP 274


>gi|284163731|ref|YP_003402010.1| creatininase [Haloterrigena turkmenica DSM 5511]
 gi|284013386|gb|ADB59337.1| Creatininase [Haloterrigena turkmenica DSM 5511]
          Length = 246

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 60/259 (23%), Positives = 108/259 (41%), Gaps = 15/259 (5%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   D +     D  +  + V+P+G+ EQHGPH P+ TD + A  +A+     +     V
Sbjct: 1   MDLRDATWTDVRDC-ETELAVVPVGSTEQHGPHAPLGTDVVAAEAVADAGVEHVDRE--V 57

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P  P+G + EH    GT  ++     ++    ++++   G  ++VI+N HGGN   +
Sbjct: 58  VRAPAIPVGIAEEHRQFPGTMWVSEDTFRDYVREAVESLAHHGFDRVVIVNGHGGNVDAL 117

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             V            V  +W              +    HGG +ET+++   AP LV+ +
Sbjct: 118 REVGGRITRGGDAYAVPFTWFEAVG-------EHSAEMGHGGPLETALLRHCAPDLVREE 170

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             E+     +E   ++         +  +   +    GVVG+  D   + GE LL    +
Sbjct: 171 RIEDARDGHAEGWGDW-----LSYTNLAYDSAEFTENGVVGDPEDGDRQCGEELLELAGD 225

Query: 245 CFIQLLNDINSFDVSIFDK 263
              +LL  +   DVS  ++
Sbjct: 226 ALARLLEAVAERDVSRPER 244


>gi|119952666|ref|YP_950330.1| creatinine amidohydrolase [Arthrobacter aurescens TC1]
 gi|119951796|gb|ABM10705.1| creatinine amidohydrolase [Arthrobacter aurescens TC1]
          Length = 281

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 53/264 (20%), Positives = 98/264 (37%), Gaps = 13/264 (4%)

Query: 3   PLIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P +   D +          D +++LP G+ EQHGP   +  DT +A G+ E   + +   
Sbjct: 7   PSVWLQDLTWEEVDGHLASDQLILLPFGSTEQHGPAGTLGIDTFVATGIVEDAATRMG-- 64

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG-N 120
               C P    G S  H+   GT +L     +     +  ++   G R+I+++N H G N
Sbjct: 65  --ALCAPPMWFGDSPHHLAFPGTVSLKTETLMAVVRDVCTSLASHGFRQIILVNGHKGSN 122

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
              +   + +        V+        + +      +     HGGE+E S +    P  
Sbjct: 123 LAALGSAARDLHENHLPDVMFAVADPLHLARNAAPHIKETNEHHGGELELSQVHFRYPGQ 182

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFG----WSM---KDLNPKGVVGNAMDATVK 233
           V+MD   +  +  +     F      G    G    WS    +D  P G + +++     
Sbjct: 183 VRMDRLTDEGADFARVFGGFVGADLFGPAPDGVDVIWSSREQRDFAPTGSLSSSLGVESD 242

Query: 234 KGEGLLSYFANCFIQLLNDINSFD 257
           KG     +  +   +++  +   D
Sbjct: 243 KGRRFHEHIVDRLCEVITWMREND 266


>gi|75345307|sp|P83772|CRNA_PSEPU RecName: Full=Creatinine amidohydrolase; AltName: Full=Creatininase
 gi|42542992|pdb|1J2T|A Chain A, Creatininase Mn
 gi|42542993|pdb|1J2T|B Chain B, Creatininase Mn
 gi|42542994|pdb|1J2T|C Chain C, Creatininase Mn
 gi|42542995|pdb|1J2T|D Chain D, Creatininase Mn
 gi|42542996|pdb|1J2T|E Chain E, Creatininase Mn
 gi|42542997|pdb|1J2T|F Chain F, Creatininase Mn
 gi|42542998|pdb|1J2U|A Chain A, Creatininase Zn
 gi|42542999|pdb|1J2U|B Chain B, Creatininase Zn
 gi|42543000|pdb|1J2U|C Chain C, Creatininase Zn
 gi|42543001|pdb|1J2U|D Chain D, Creatininase Zn
 gi|42543002|pdb|1J2U|E Chain E, Creatininase Zn
 gi|42543003|pdb|1J2U|F Chain F, Creatininase Zn
 gi|42543898|pdb|1V7Z|A Chain A, Creatininase-Product Complex
 gi|42543899|pdb|1V7Z|B Chain B, Creatininase-Product Complex
 gi|42543900|pdb|1V7Z|C Chain C, Creatininase-Product Complex
 gi|42543901|pdb|1V7Z|D Chain D, Creatininase-Product Complex
 gi|42543902|pdb|1V7Z|E Chain E, Creatininase-Product Complex
 gi|42543903|pdb|1V7Z|F Chain F, Creatininase-Product Complex
 gi|288562880|pdb|3A6D|A Chain A, Creatininase Complexed With 1-Methylguanidine
 gi|288562881|pdb|3A6D|B Chain B, Creatininase Complexed With 1-Methylguanidine
 gi|288562882|pdb|3A6D|C Chain C, Creatininase Complexed With 1-Methylguanidine
 gi|288562883|pdb|3A6D|D Chain D, Creatininase Complexed With 1-Methylguanidine
 gi|288562884|pdb|3A6D|E Chain E, Creatininase Complexed With 1-Methylguanidine
 gi|288562885|pdb|3A6D|F Chain F, Creatininase Complexed With 1-Methylguanidine
 gi|662294|dbj|BAA08265.1| creatinine amidohydrolase [Pseudomonas sp. PS-7]
          Length = 260

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 67/270 (24%), Positives = 106/270 (39%), Gaps = 33/270 (12%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           M+  +   + +        A  D +++LP+GA EQHG H+ MN D ++   + +R+   +
Sbjct: 1   MSKSVFVGELTWKEYEARVAAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAERI 60

Query: 59  PPRLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVI 113
                   MP    GY     S    +  GT +L  A        II  + + G R++V+
Sbjct: 61  G----ALVMPGLQYGYKSQQKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVL 116

Query: 114 LNAHGGNSPL----VSIVSTEARMRF--SMLVVSTSWSRFTIPQGIIS--FPETEIGI-- 163
           +N H  NS      + +   E R        VV  S+  F     +I   +PE  +G   
Sbjct: 117 MNGHYENSMFIVEGIDLALRELRYAGIQDFKVVVLSYWDFVKDPAVIQQLYPEGFLGWDI 176

Query: 164 -HGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKG 222
            HGG  ETS+MLAL P LV +D   +           F    A                G
Sbjct: 177 EHGGVFETSLMLALYPDLVDLDRVVDHPPATFPPYDVFPVDPARTPAP-----------G 225

Query: 223 VVGNAMDATVKKGEGLLSYFANCFIQLLND 252
            + +A  A+ +KGE +L          + +
Sbjct: 226 TLSSAKTASREKGELILEVCVQGIADAIRE 255


>gi|288562886|pdb|3A6E|A Chain A, W174f Mutant Creatininase, Type I
 gi|288562887|pdb|3A6E|B Chain B, W174f Mutant Creatininase, Type I
 gi|288562888|pdb|3A6E|C Chain C, W174f Mutant Creatininase, Type I
 gi|288562889|pdb|3A6E|D Chain D, W174f Mutant Creatininase, Type I
 gi|288562890|pdb|3A6E|E Chain E, W174f Mutant Creatininase, Type I
 gi|288562891|pdb|3A6E|F Chain F, W174f Mutant Creatininase, Type I
 gi|288562892|pdb|3A6F|A Chain A, W174f Mutant Creatininase, Type Ii
 gi|288562893|pdb|3A6F|B Chain B, W174f Mutant Creatininase, Type Ii
 gi|288562894|pdb|3A6F|C Chain C, W174f Mutant Creatininase, Type Ii
 gi|288562895|pdb|3A6F|D Chain D, W174f Mutant Creatininase, Type Ii
 gi|288562896|pdb|3A6F|E Chain E, W174f Mutant Creatininase, Type Ii
 gi|288562897|pdb|3A6F|F Chain F, W174f Mutant Creatininase, Type Ii
          Length = 260

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 67/270 (24%), Positives = 106/270 (39%), Gaps = 33/270 (12%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           M+  +   + +        A  D +++LP+GA EQHG H+ MN D ++   + +R+   +
Sbjct: 1   MSKSVFVGELTWKEYEARVAAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAERI 60

Query: 59  PPRLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVI 113
                   MP    GY     S    +  GT +L  A        II  + + G R++V+
Sbjct: 61  G----ALVMPGLQYGYKSQQKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVL 116

Query: 114 LNAHGGNSPL----VSIVSTEARMRF--SMLVVSTSWSRFTIPQGIIS--FPETEIGI-- 163
           +N H  NS      + +   E R        VV  S+  F     +I   +PE  +G   
Sbjct: 117 MNGHYENSMFIVEGIDLALRELRYAGIQDFKVVVLSYWDFVKDPAVIQQLYPEGFLGFDI 176

Query: 164 -HGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKG 222
            HGG  ETS+MLAL P LV +D   +           F    A                G
Sbjct: 177 EHGGVFETSLMLALYPDLVDLDRVVDHPPATFPPYDVFPVDPARTPAP-----------G 225

Query: 223 VVGNAMDATVKKGEGLLSYFANCFIQLLND 252
            + +A  A+ +KGE +L          + +
Sbjct: 226 TLSSAKTASREKGELILEVCVQGIADAIRE 255


>gi|288562898|pdb|3A6G|A Chain A, W154f Mutant Creatininase
 gi|288562899|pdb|3A6G|B Chain B, W154f Mutant Creatininase
 gi|288562900|pdb|3A6G|C Chain C, W154f Mutant Creatininase
 gi|288562901|pdb|3A6G|D Chain D, W154f Mutant Creatininase
 gi|288562902|pdb|3A6G|E Chain E, W154f Mutant Creatininase
 gi|288562903|pdb|3A6G|F Chain F, W154f Mutant Creatininase
          Length = 260

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 67/270 (24%), Positives = 106/270 (39%), Gaps = 33/270 (12%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           M+  +   + +        A  D +++LP+GA EQHG H+ MN D ++   + +R+   +
Sbjct: 1   MSKSVFVGELTWKEYEARVAAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAERI 60

Query: 59  PPRLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVI 113
                   MP    GY     S    +  GT +L  A        II  + + G R++V+
Sbjct: 61  G----ALVMPGLQYGYKSQQKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVL 116

Query: 114 LNAHGGNSPL----VSIVSTEARMRF--SMLVVSTSWSRFTIPQGIIS--FPETEIGI-- 163
           +N H  NS      + +   E R        VV  S+  F     +I   +PE  +G   
Sbjct: 117 MNGHYENSMFIVEGIDLALRELRYAGIQDFKVVVLSYFDFVKDPAVIQQLYPEGFLGWDI 176

Query: 164 -HGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKG 222
            HGG  ETS+MLAL P LV +D   +           F    A                G
Sbjct: 177 EHGGVFETSLMLALYPDLVDLDRVVDHPPATFPPYDVFPVDPARTPAP-----------G 225

Query: 223 VVGNAMDATVKKGEGLLSYFANCFIQLLND 252
            + +A  A+ +KGE +L          + +
Sbjct: 226 TLSSAKTASREKGELILEVCVQGIADAIRE 255


>gi|237720776|ref|ZP_04551257.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|229449611|gb|EEO55402.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
          Length = 251

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 62/246 (25%), Positives = 109/246 (44%), Gaps = 15/246 (6%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS- 75
             RK  IV+LP GA E H  HLP  TD I++  +A     +   +  V CM + PIG   
Sbjct: 16  KDRKYDIVILPWGATEPHNLHLPYMTDCILSHDVAVDAALMAKQKYGVNCMVMPPIGMGS 75

Query: 76  --IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
                  +       Y         I+ ++   G RK++I+N HGGN      +  +  +
Sbjct: 76  QNPGQRELPFCIHTRYETQKAILTDIVSSLYVQGFRKLIIINGHGGN--TFKSMIRDLSV 133

Query: 134 RFSMLVVSTS-WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            +   ++++S W      +     P    G H  E+ETS+M+   P LV ++ A N    
Sbjct: 134 DYPDFLIASSEWYTVLKVKDYFENP----GDHADEVETSVMMHYHPELVNLEEAGNG-EY 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           ++  +++     A    ++G   KD    GV G+   A+V+KG+      A  + +L ++
Sbjct: 189 KTFAIQSLNEKVAWIPRNWGKVSKD---TGV-GDPRGASVEKGKKFAEAVAEKYAKLFDE 244

Query: 253 INSFDV 258
           + + ++
Sbjct: 245 LVNQEL 250


>gi|322371135|ref|ZP_08045687.1| Creatininase [Haladaptatus paucihalophilus DX253]
 gi|320549125|gb|EFW90787.1| Creatininase [Haladaptatus paucihalophilus DX253]
          Length = 254

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 68/263 (25%), Positives = 110/263 (41%), Gaps = 13/263 (4%)

Query: 6   IFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
              + +     DA  D  + +LP G+ EQHGP LP+ TD + A  +A      L  R  V
Sbjct: 3   RLAEETTTTARDALSDVDVALLPTGSVEQHGPALPLGTDFMAAQAVAGT----LGDRENV 58

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P  P+G S  H   DGT     A   ++   I+ +I   G++K+VI+N HGGN   +
Sbjct: 59  VLLPTVPVGVSEHHRQFDGTLWTDPATFEDYVTDIVSSIASHGVQKVVIVNGHGGNDGAL 118

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             V+   R       V  +W        ++         H  EIETSM+L +A  LV+  
Sbjct: 119 RRVARRVRREEVAYAVPWNWW--GGIGDVLEDEFGMGITHADEIETSMLLEVAEELVREA 176

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             E   +  ++      +       + G+   D +  GVVG     + + G  LL   ++
Sbjct: 177 ALEAAEAGANDAWGEDVH-----GANVGFDTADFSESGVVGQPTRGSREAGARLLDASSD 231

Query: 245 CFIQLLNDINSFDVSIF-DKDVQ 266
               L+  +   D+     +D +
Sbjct: 232 ELAALVEWLGEQDIDHLWPEDHR 254


>gi|239627177|ref|ZP_04670208.1| creatininase [Clostridiales bacterium 1_7_47_FAA]
 gi|239517323|gb|EEQ57189.1| creatininase [Clostridiales bacterium 1_7_47FAA]
          Length = 251

 Score =  175 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 63/263 (23%), Positives = 98/263 (37%), Gaps = 28/263 (10%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M+  I   + +    A  RKD IV+LP+GA EQHGPHLP+  DT++A   + RI   +  
Sbjct: 1   MSGHIKMKEMTWTEYA-GRKDGIVILPIGATEQHGPHLPLCVDTVLAEEFSYRIAGQVD- 58

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
                  P    GY     S       GT  L           +ID   + G  +I++ N
Sbjct: 59  ---GIVAPSLCYGYKSKPFSGGGPLFPGTIDLNGQTLQNLVQDVIDEFVRDGFSRILLFN 115

Query: 116 AHGGNSPLVSIVSTEARMRFSMLV--VSTSWSRFTIPQGIISFPE-----TEIGIHGGEI 168
           AH  N P V         R    V  +  +W     P  I    +          H    
Sbjct: 116 AHFENEPFVVEAMDLCSARHGDGVKLLLMNWWDPMSPNMIERIFDQVPFPGWALEHAAIT 175

Query: 169 ETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM 228
           ETS+M+  AP LV+ DL  +             ++     + +      +   GV+  A 
Sbjct: 176 ETSLMMYFAPELVRQDLIADV-----------DHVDPGFCYRYPIDKNSIPSNGVLATAR 224

Query: 229 DATVKKGEGLLSYFANCFIQLLN 251
            ++  KG+ ++    +     + 
Sbjct: 225 SSSALKGQWIVEDVVSNISDFIR 247


>gi|298481306|ref|ZP_06999499.1| amidase [Bacteroides sp. D22]
 gi|298272510|gb|EFI14078.1| amidase [Bacteroides sp. D22]
          Length = 251

 Score =  175 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 62/246 (25%), Positives = 109/246 (44%), Gaps = 15/246 (6%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS- 75
             RK  IV+LP GA E H  HLP  TD I++  +A     +   +  V CM + PIG   
Sbjct: 16  KDRKYDIVILPWGATEPHNLHLPYMTDCILSHDVAVDAALMAKQKYGVNCMVMPPIGMGS 75

Query: 76  --IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
                  +       Y         I+ ++   G RK++I+N HGGN      +  +  +
Sbjct: 76  QNPGQRELPFCIHTRYETQKAILTDIVSSLYVQGFRKLIIINGHGGN--TFKSMIRDLSV 133

Query: 134 RFSMLVVSTS-WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            +   ++++S W      +     P    G H  E+ETS+M+   P LV ++ A N    
Sbjct: 134 DYPDFLIASSEWYTVLKVKDYFENP----GDHADEVETSVMMHYHPELVNLEEAGNG-EY 188

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           ++  +++     A    ++G   KD    GV G+   A+V+KG+      A  + +L ++
Sbjct: 189 KTFAVQSLNEKVAWIPRNWGKVSKD---TGV-GDPRGASVEKGKKFAEAVAEKYAKLFDE 244

Query: 253 INSFDV 258
           + + ++
Sbjct: 245 LVNQEL 250


>gi|89071014|ref|ZP_01158234.1| hypothetical protein OG2516_17965 [Oceanicola granulosus HTCC2516]
 gi|89043438|gb|EAR49654.1| hypothetical protein OG2516_17965 [Oceanicola granulosus HTCC2516]
          Length = 253

 Score =  175 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 65/241 (26%), Positives = 100/241 (41%), Gaps = 17/241 (7%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P  A  A +  + +LP+G++EQHGPHLP++TD  IA  +A               +PV
Sbjct: 11  TAPEIAAFAERHPVAILPVGSFEQHGPHLPLDTDNRIAEAMALETARR----SVGMVLPV 66

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +GY+       GT T  +   +     I +++   GI+ + +L+ HG N   V     
Sbjct: 67  LNVGYAWVWRGKPGTLTFRFETYMAIIRDIAESLSGWGIKAVYVLSGHGSNPQPVKHAIR 126

Query: 130 EARM-RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
           E     + + V++  +S                 IH  EIETS+MLA+AP LV+MD A  
Sbjct: 127 EHIHGHYDIGVLNGIYSGLGEMLEECDSRPWHNDIHAEEIETSLMLAIAPELVRMDRAAA 186

Query: 189 FSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
                       +            SM  L   GV G+   A+ +KG   L        +
Sbjct: 187 DYPPVPAEYGKSEL-----------SMGQLMESGVFGDPTVASAEKGRRWLETGGQRSAE 235

Query: 249 L 249
           L
Sbjct: 236 L 236


>gi|284044429|ref|YP_003394769.1| creatininase [Conexibacter woesei DSM 14684]
 gi|283948650|gb|ADB51394.1| Creatininase [Conexibacter woesei DSM 14684]
          Length = 243

 Score =  175 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 51/251 (20%), Positives = 102/251 (40%), Gaps = 18/251 (7%)

Query: 10  NSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
            +     +   +  + +LP+GA E HG HLP++TD ++A G+A ++ + +P       +P
Sbjct: 6   LTSAEVTEVLSRRPVALLPIGAVENHGDHLPLSTDNLLADGVAHQVAARVPDS---VVLP 62

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           +   G         GT +L+        + I  ++ + G+  +  +N H GN   + + +
Sbjct: 63  LVSYGQVWSTSAYAGTISLSLETMTSTLVEIGASLFEQGVPILAFVNGHMGNLDAMKLAA 122

Query: 129 TEARMRFSMLVVSTSWSRFTI--PQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
            +      M V++ ++        + +          H  E+ETS ML +AP  VKM+ A
Sbjct: 123 RDLHDELGMKVLALTYPGIGEISREVLEEERLHPSYFHACELETSYMLRIAPGAVKMEHA 182

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKG-VVGNAMDATVKKGEGLLSYFANC 245
           +    +    +               W     +P   V+G+   AT  KG+ ++      
Sbjct: 183 KANRPQLPIDIDVS---------PTPWDS--FSPDSPVLGDPTLATAAKGKAIIDVAVAK 231

Query: 246 FIQLLNDINSF 256
            ++L+      
Sbjct: 232 IVELIEHARRS 242


>gi|319649268|ref|ZP_08003427.1| hypothetical protein HMPREF1013_00031 [Bacillus sp. 2_A_57_CT2]
 gi|317399073|gb|EFV79752.1| hypothetical protein HMPREF1013_00031 [Bacillus sp. 2_A_57_CT2]
          Length = 256

 Score =  175 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 7   FTDNSLPLCADARKDWI--VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
            T  +      +  D +   ++P+GA+EQHGPH+  + D ++A  +A ++   + P    
Sbjct: 6   LTKMTWKEVEKSL-DTVEFAIIPVGAHEQHGPHMAESCDAVLAERMANKLGQRMFP--YA 62

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P   +G S  H++  GT TL  +  I     ++ ++++ GI+K + LN+HGGN   +
Sbjct: 63  IVTPTVNMGVSEHHIHFPGTITLQPSTLIAILTDMVSSLKQHGIKKFLFLNSHGGNQSTL 122

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           ++ +        + V   + +  +    I  + ++ +  H  E E S  L LAP LV+ D
Sbjct: 123 NLAAMTITKELEVEVY-YAKTTSSAKGSIGKYVKSPLFGHSCEREVSEALYLAPELVRED 181

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
           L E    ++      ++ LR   +    +  +++   G +G+    + + GE ++    +
Sbjct: 182 LLEKGDIKEG---GRWERLRPGKAVQGFYFYEEMTGNGCIGDGRQGSREIGEQIVEEALD 238

Query: 245 CFIQ 248
               
Sbjct: 239 NLSA 242


>gi|209527276|ref|ZP_03275786.1| Creatininase [Arthrospira maxima CS-328]
 gi|209492264|gb|EDZ92609.1| Creatininase [Arthrospira maxima CS-328]
          Length = 250

 Score =  175 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 46/250 (18%), Positives = 77/250 (30%), Gaps = 29/250 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P      +    ++LP+G+ EQHGP   + TD I A  +A      +         P 
Sbjct: 7   TWPEVEAYLQQSTGIILPIGSTEQHGPTGLIGTDAICAEAIA----KGVGEATQALVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  I      I  + K G      +N HGGN   +    +
Sbjct: 63  LNVGMALHHTAFPGTISLQPSTLIRVIKDYITFLAKSGFTTFFFINGHGGNIATLKAAFS 122

Query: 130 EARMRFSML---------VVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E     + L             +W        +         G H    E ++   L P 
Sbjct: 123 ETYAHLADLNLANSDRIRCRVGNWFMCPSVYKLAKELYGQSEGSHATPSEVAVTQYLYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K        ++                     + +   P G +G +   AT   G+ L
Sbjct: 183 SIKKASLNPNVAKGHPIYG-------------AANFRHNYPDGRMGSDPSLATPDHGKKL 229

Query: 239 LSYFANCFIQ 248
                    Q
Sbjct: 230 YELAVKELSQ 239


>gi|170289915|ref|YP_001736731.1| creatininase [Candidatus Korarchaeum cryptofilum OPF8]
 gi|170173995|gb|ACB07048.1| Creatininase [Candidatus Korarchaeum cryptofilum OPF8]
          Length = 229

 Score =  175 bits (445), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 54/235 (22%), Positives = 98/235 (41%), Gaps = 11/235 (4%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           ++PLG+ EQHG H P+ TD+++A  LAE           V   P    G+S  HM   GT
Sbjct: 1   MIPLGSTEQHGRHAPLGTDSLLAIALAEDASERTG----VLIAPPIWYGWSPHHMVAPGT 56

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG-GNSPLVSIVSTEARMRFSMLVVSTS 143
            ++     IE     I ++ + G RK V++N H   N P + I S  A+    + +    
Sbjct: 57  VSVRPEVLIELLYDAIRSLSRHGFRKFVLINGHRLANLPWIQIASERAQRELKVSIFIFD 116

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
               ++   +    +     HG ++ETS ++   P LV+M+ A+++   +  +    +  
Sbjct: 117 PLYMSL--DLRKKVDFGPFGHGDDMETSHLMHKFPELVRMEEAKDYVPERVVYADPLEPK 174

Query: 204 RAHGSHS----FGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
                          +K+     ++G    +   KG+    +     ++LL  I 
Sbjct: 175 DTLCYIPSTEERMMEIKESTGDTIIGTPSRSDPDKGKLYHEHLVGRLVELLQSIR 229


>gi|55376867|ref|YP_134718.1| hypothetical protein pNG7317 [Haloarcula marismortui ATCC 43049]
 gi|55229592|gb|AAV45012.1| unknown [Haloarcula marismortui ATCC 43049]
          Length = 243

 Score =  175 bits (444), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 58/253 (22%), Positives = 103/253 (40%), Gaps = 20/253 (7%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
           +TD +        +  + +LP+G+ EQHGPH P+ TDT+ A  +AE         + V  
Sbjct: 8   WTDMT------EVETDLALLPVGSTEQHGPHAPLGTDTLDAEVVAEHGAERHDDPVVVAP 61

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126
               P+G + EH    GT   + +    +   I+ ++   G   +V++N HGGN   +  
Sbjct: 62  --AVPVGVAEEHRAFSGTLWTSESTFRSYVRDIVRSLASHGWDHVVLVNGHGGNIDALRE 119

Query: 127 VSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
           V+           V  +W              +    HGG +ETS++    P  V  D  
Sbjct: 120 VAGTITRHDEAFAVPFTWFNAVG-------DHSADMGHGGPLETSLLQHTNPETVHEDRL 172

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
           +  +   S+    ++        +  +   +    GVVG+  + + ++GE LL       
Sbjct: 173 DEAADGGSDGWGEWQS-----GVNLAFDSDEFTQNGVVGDPREGSAERGEMLLDLATESL 227

Query: 247 IQLLNDINSFDVS 259
           + LL++I    V 
Sbjct: 228 VALLDEIADRPVG 240


>gi|262197160|ref|YP_003268369.1| creatininase [Haliangium ochraceum DSM 14365]
 gi|262080507|gb|ACY16476.1| Creatininase [Haliangium ochraceum DSM 14365]
          Length = 246

 Score =  175 bits (443), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 56/253 (22%), Positives = 95/253 (37%), Gaps = 19/253 (7%)

Query: 6   IFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
                +     D   ++  V++P+G+ EQHGP   + TD + A  +A R+         +
Sbjct: 4   RLELCTWSEVEDYLTRERAVLVPIGSTEQHGPIGIIGTDFVCAEVIARRV----GAESKL 59

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P  P+G +  HM   G+ TL     +      + +  + G R +V +N HGGN P  
Sbjct: 60  LVAPTIPVGMARHHMAFPGSLTLRPETLMAVLRDYVWSFYQHGFRCVVFVNGHGGNIPTA 119

Query: 125 SIVSTEARMRF-SMLVVSTSWSRFTIPQGIIS-FPETEIGIHGGEIETSMMLALAPHLVK 182
               +  R  F    V    W R    Q +         G H    E S+ +A  P +VK
Sbjct: 120 QAALSNIREEFADAQVQWFDWFRCQPVQELARQLYGDREGAHATPSEVSVTMAAYPEVVK 179

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLSY 241
                       E   + +  R  G      + +   P G +G ++  AT + GE  +  
Sbjct: 180 ----------SIEGPLDIESCRIRG-IPSSQTFRQWYPDGRMGSDSSLATREHGERFIDT 228

Query: 242 FANCFIQLLNDIN 254
             +   +L+  + 
Sbjct: 229 AVSALAELIEPLR 241


>gi|225387051|ref|ZP_03756815.1| hypothetical protein CLOSTASPAR_00801 [Clostridium asparagiforme
           DSM 15981]
 gi|225046869|gb|EEG57115.1| hypothetical protein CLOSTASPAR_00801 [Clostridium asparagiforme
           DSM 15981]
          Length = 258

 Score =  175 bits (443), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 64/263 (24%), Positives = 104/263 (39%), Gaps = 19/263 (7%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   + +     +   +   VV+P+G+ E HG H+P+ TDT+I   + E    +L  +  
Sbjct: 1   MRLANVTCKKVEEYLTRSQTVVIPVGSIENHGKHMPLGTDTLIPDKIVE----LLEEKSG 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G +   M   GT TL     +     + D++ + G RK VILN HGGN+  
Sbjct: 57  VMIAPTIPYGATNTIMGCTGTITLGTDGLVMILTKVTDSLFRYGFRKFVILNGHGGNNKA 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V  +   R + L     W                 G HGG  ET+ ++ + P L+  
Sbjct: 117 IETVGMQLHRRGAWLANLNWWLMAG------ELNPEWKGGHGGAEETAGVMGVDPSLIDY 170

Query: 184 DLAENFSSRQSEFLRNFKYLRAHG------SHSFGWSMKDLNPKGVVGN--AMDATVKKG 235
           D          +   N K            +  F   M + +  G  G      ATV+ G
Sbjct: 171 DYINEPMDLIDDVAPNMKTTGWGTVDYKGATVVFPREMHNYSGNGWYGKDEPHLATVEWG 230

Query: 236 EGLLSYFANCFIQLLNDINSFDV 258
           + +L  FA+     L ++   D+
Sbjct: 231 QEMLRTFADYMADFLTELEKLDL 253


>gi|160882334|ref|ZP_02063337.1| hypothetical protein BACOVA_00282 [Bacteroides ovatus ATCC 8483]
 gi|156112248|gb|EDO13993.1| hypothetical protein BACOVA_00282 [Bacteroides ovatus ATCC 8483]
 gi|295084112|emb|CBK65635.1| Uncharacterized protein, putative amidase [Bacteroides
           xylanisolvens XB1A]
          Length = 254

 Score =  175 bits (443), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 110/246 (44%), Gaps = 15/246 (6%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS- 75
             RK  IV+LP GA E H  HLP  TD I++  +A     I   +  V CM + PIG   
Sbjct: 19  KDRKYDIVILPWGATEPHNLHLPYMTDCILSHDVAVDAALIAKQKYGVNCMVMPPIGMGS 78

Query: 76  --IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
                  +       Y         I+ ++   GIRK+VI+N HGGN      +  +  +
Sbjct: 79  QNPGQRELPFCIHTRYETQKAILTDIVSSLYVQGIRKLVIINGHGGN--TFKSMIRDLSV 136

Query: 134 RFSMLVVSTS-WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            +   ++++S W      +     P    G H  E+ETS+M+   P LV ++ A N    
Sbjct: 137 DYPDFLIASSEWYTVLKVKDYFENP----GDHADEVETSVMMHYHPELVNLEEAGNG-EY 191

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
           ++  +++     A    ++G   KD    GV G+   A+V+KG+      A  + +L ++
Sbjct: 192 KTFAIQSLNEKVAWIPRNWGKVSKD---TGV-GDPRGASVEKGKKFAEAVAEKYAKLFDE 247

Query: 253 INSFDV 258
           + + ++
Sbjct: 248 LVNQEL 253


>gi|284163500|ref|YP_003401779.1| creatininase [Haloterrigena turkmenica DSM 5511]
 gi|284013155|gb|ADB59106.1| Creatininase [Haloterrigena turkmenica DSM 5511]
          Length = 253

 Score =  174 bits (442), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 59/257 (22%), Positives = 101/257 (39%), Gaps = 21/257 (8%)

Query: 2   NPLIIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
              +   + + P    A ++     ++ +G+ EQHGPHLP+N D +    L+ RI + L 
Sbjct: 4   PSSVRLEECTWPEVETALENGRRTAIVAVGSIEQHGPHLPLNMDALDGDELSRRIAAELG 63

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
                   P    G S  HM   GT T+     ++   A   ++   G   +V++  HGG
Sbjct: 64  D---ALAAPTIRPGCSGHHMEFPGTITVPPETLMDLIRAYCRSLDDHGFEHVVLVPTHGG 120

Query: 120 NSPLVSIVSTEARMRFSMLVVS---TSWSRFTIPQGIISF--PETEIGIHGGEIETSMML 174
           N   VS V+ E        V++          + +G+        E  IH G  ET+M+L
Sbjct: 121 NFAPVSTVAPEIAREIDANVIALADLDDHMALLNEGLRDAGIEYQEDVIHAGAAETAMIL 180

Query: 175 ALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKK 234
           A+   LV+ D  E          R                 K +   GV+G+  +AT + 
Sbjct: 181 AIDEGLVRTDRLEAGPEGSISTARLLSE-----------GFKSITENGVLGDPDEATPEA 229

Query: 235 GEGLLSYFANCFIQLLN 251
           G+ +       +++ + 
Sbjct: 230 GDAIFDAVTAAYVERIE 246


>gi|206603782|gb|EDZ40262.1| Putative creatininase [Leptospirillum sp. Group II '5-way CG']
          Length = 251

 Score =  174 bits (442), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 47/257 (18%), Positives = 95/257 (36%), Gaps = 20/257 (7%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     + P          ++++P+G+ EQHGP+  + TD ++A  LA      +   + 
Sbjct: 1   MQIAHQNWPAVEHYLNSRSVLLIPIGSTEQHGPNGLIGTDHLVAESLA----RSVGEEMG 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +   P    G S  H+   G+ +L+    I     ++ +  + G  +   +N HGGN   
Sbjct: 57  ILVAPTLAYGMSHHHLAFPGSASLSPETLIRVIRDVVTSFARNGFSRFFFINGHGGNVSS 116

Query: 124 VSIVSTEARMRFS--MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           +    ++  +      L +++ W    +      F  TE G H    E ++   L P   
Sbjct: 117 IQAAFSDILLDHPSLRLQLASWWLMPEVTDQEKIFFGTENGHHATCGEVAVTWHLYPE-- 174

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
                 + +        + +     G   +    + L P G +G N   ++ +KG+ L  
Sbjct: 175 ------DETPIAPGVAPDPETEWPVGPERY----RTLFPDGRMGSNPSLSSGEKGKVLFE 224

Query: 241 YFANCFIQLLNDINSFD 257
                 +  +    S D
Sbjct: 225 IARKALVDRIRKFLSRD 241


>gi|20807500|ref|NP_622671.1| uncharacterized protein, putative amidase [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516029|gb|AAM24275.1| uncharacterized protein, putative amidase [Thermoanaerobacter
           tengcongensis MB4]
          Length = 240

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 106/251 (42%), Gaps = 19/251 (7%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   + +        +K   V++P+G+ E HG HLP+ TD        + I+  +     
Sbjct: 1   MYLINYTSDDFQKHLQKSDTVIVPIGSVEAHGHHLPLGTDIFSPRLFCQMIEEKIGD--Y 58

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G S +     GT  +      E+  A+  ++ +  ++K++ LN HGGN   
Sbjct: 59  VWIAPEIPYGQSYDLSVYPGTIHVPSEVLAEYVYAVGKSLYENELKKLIFLNGHGGNINA 118

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +++ S E   +  M V++ +W      + I++  E +   H GE ETS +L     LV+M
Sbjct: 119 LNLAS-EKLAQLGMTVLTINWW-LDFSKEILTITEGQ--GHAGEDETSAILYYDERLVQM 174

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D A               + +      F    K L    + G+A  AT +KGE +     
Sbjct: 175 DKATKN------------FKKPLYRVYFKDRGKILYENAMSGDATLATKEKGEKIFKLLT 222

Query: 244 NCFIQLLNDIN 254
              ++++ ++ 
Sbjct: 223 EKIVEIILNVR 233


>gi|288562904|pdb|3A6H|A Chain A, W154a Mutant Creatininase
 gi|288562905|pdb|3A6H|B Chain B, W154a Mutant Creatininase
 gi|288562906|pdb|3A6H|C Chain C, W154a Mutant Creatininase
 gi|288562907|pdb|3A6H|D Chain D, W154a Mutant Creatininase
 gi|288562908|pdb|3A6H|E Chain E, W154a Mutant Creatininase
 gi|288562909|pdb|3A6H|F Chain F, W154a Mutant Creatininase
          Length = 260

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 67/270 (24%), Positives = 107/270 (39%), Gaps = 33/270 (12%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           M+  +   + +        A  D +++LP+GA EQHG H+ MN D ++   + +R+   +
Sbjct: 1   MSKSVFVGELTWKEYEARVAAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAERI 60

Query: 59  PPRLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVI 113
                   MP    GY     S    +  GT +L  A        II  + + G R++V+
Sbjct: 61  G----ALVMPGLQYGYKSQQKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVL 116

Query: 114 LNAHGGNSPL----VSIVSTEARMRF--SMLVVSTSWSRFTIPQGIIS--FPETEIGI-- 163
           +N H  NS      + +   E R        VV  S++ F     +I   +PE  +G   
Sbjct: 117 MNGHYENSMFIVEGIDLALRELRYAGIQDFKVVVLSYADFVKDPAVIQQLYPEGFLGWDI 176

Query: 164 -HGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKG 222
            HGG  ETS+MLAL P LV +D   +           F    A                G
Sbjct: 177 EHGGVFETSLMLALYPDLVDLDRVVDHPPATFPPYDVFPVDPARTPAP-----------G 225

Query: 223 VVGNAMDATVKKGEGLLSYFANCFIQLLND 252
            + +A  A+ +KGE +L          + +
Sbjct: 226 TLSSAKTASREKGELILEVCVQGIADAIRE 255


>gi|154252090|ref|YP_001412914.1| creatininase [Parvibaculum lavamentivorans DS-1]
 gi|154156040|gb|ABS63257.1| Creatininase [Parvibaculum lavamentivorans DS-1]
          Length = 252

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 54/250 (21%), Positives = 94/250 (37%), Gaps = 22/250 (8%)

Query: 7   FTDNSLPLCADARK---DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   + P   D  K     + VLP+GA EQHGPHL   TDT++A  +             
Sbjct: 4   WAQLTGPQLGDLVKTKGRSLAVLPIGATEQHGPHLATGTDTLLADTICREACRRRG---- 59

Query: 64  VTCMPVEPIGYSIEHM-YVDGTKTLTYAEAIEHWLAIIDAIRKM-GIRKIVILNAHGGNS 121
           +  +P  P G S  H     GT +L+          +        GI +++ ++ H  N 
Sbjct: 60  LPMLPALPYGCSYGHTNAWPGTLSLSPETLTRVICELARWAIDNSGIDRLLFISGHATNG 119

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           P +     + R  +     +         + +  +      IH    ETSM++A+ P  V
Sbjct: 120 PSIESAILQLRYEYPHARFAARGLWEISDEALRLYTSDAADIHANVAETSMVMAIDPQSV 179

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           +M+ AE+     +  +             + ++M  + P GVVG    ++   G  +L  
Sbjct: 180 QMERAEDVEDVTAGLI-------------WRYAMPAVTPNGVVGRPSGSSAAAGREMLDR 226

Query: 242 FANCFIQLLN 251
                  +L 
Sbjct: 227 LIQDLETMLK 236


>gi|291569175|dbj|BAI91447.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 250

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 46/250 (18%), Positives = 78/250 (31%), Gaps = 29/250 (11%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P      +K   ++LP+G+ EQHGP   + TD I A  +A      +         P 
Sbjct: 7   TWPEVEAYLQKSTGIILPIGSTEQHGPTGLIGTDAICAEAIA----KGVGEATQALVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    G+ +L  +  I      I  + K G      +N HGGN   +    +
Sbjct: 63  LNVGMALHHTAFPGSISLQPSTLIRVIKDYITFLAKSGFTTFFFINGHGGNIATLKAAFS 122

Query: 130 EARMRFSML---------VVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E     + L             +W        +         G H    E ++   L P 
Sbjct: 123 ETYAHLADLNLANSDRIRCRVGNWFMCPSVYRLAKELYGDSEGSHATPSEVAVTQYLYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K                    +          + +   P G +G +   AT + G+ L
Sbjct: 183 SIK-------------KAPLNPNVAKGHPIYGAANFRHNYPDGRMGSDPSLATPEHGQKL 229

Query: 239 LSYFANCFIQ 248
                    Q
Sbjct: 230 YELAVKELSQ 239


>gi|284053173|ref|ZP_06383383.1| creatininase [Arthrospira platensis str. Paraca]
          Length = 250

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 46/250 (18%), Positives = 78/250 (31%), Gaps = 29/250 (11%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P      +K   ++LP+G+ EQHGP   + TD I A  +A      +         P 
Sbjct: 7   TWPEVEAYLQKSTGIILPIGSTEQHGPTGLIGTDAICAEAIA----KGVGEATQALVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    G+ +L  +  I      I  + K G      +N HGGN   +    +
Sbjct: 63  LNVGMALHHTAFPGSISLQPSTLIRVIKDYITFLAKSGFTTFFFINGHGGNIATLKAAFS 122

Query: 130 EARMRFSML---------VVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E     + L             +W        +         G H    E ++   L P 
Sbjct: 123 ETYAHLTDLNLANSDRIRCRVGNWFMCPSVYRLAKELYGDSEGSHATPSEVAVTQYLYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K                    +          + +   P G +G +   AT + G+ L
Sbjct: 183 SIK-------------KAPLNPNVAKGHPIYGAANFRHNYPDGRMGSDPSLATPEHGQKL 229

Query: 239 LSYFANCFIQ 248
                    Q
Sbjct: 230 YELAVKELSQ 239


>gi|124515096|gb|EAY56607.1| putative creatininase [Leptospirillum rubarum]
          Length = 251

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 47/257 (18%), Positives = 96/257 (37%), Gaps = 20/257 (7%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     + P          ++++P+G+ EQHGP+  + TD ++A  LA      +   + 
Sbjct: 1   MQIAHQNWPAVEHYLTTRSVLLIPIGSTEQHGPNGLIGTDHLVAESLA----RSVGEEMG 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +   P    G S  H+   G+ +L+    I     ++ +  + G  +   +N HGGN   
Sbjct: 57  ILVAPTLAYGMSHHHLAFPGSASLSPETLIRVIRDVVTSFARNGFSRFFFINGHGGNVSS 116

Query: 124 VSIVSTEARMRFS--MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           +    ++  +      L +++ W    +      F  TE G H    E ++   L P   
Sbjct: 117 IQAAFSDILLDHPSLRLQLASWWLMPEVTDQEKIFFGTENGHHATCGEVAVTWHLYPE-- 174

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
                 + +        + +     G   +    + L P G +G N   ++ +KG+ L  
Sbjct: 175 ------DETPIAPGVAPDPETEWPVGPERY----RTLFPDGRMGSNPSLSSGEKGKVLFE 224

Query: 241 YFANCFIQLLNDINSFD 257
                 ++ +    S D
Sbjct: 225 IARKALVERIRKFLSRD 241


>gi|83591093|ref|YP_431102.1| creatininase [Moorella thermoacetica ATCC 39073]
 gi|83574007|gb|ABC20559.1| Creatininase [Moorella thermoacetica ATCC 39073]
          Length = 282

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 62/267 (23%), Positives = 106/267 (39%), Gaps = 22/267 (8%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           ++   V++P+G+ E+HG H+P+ TD+     + ER   I      V   P+ P GYS  H
Sbjct: 19  KETDTVMVPVGSCEKHGAHVPLGTDSFTTISVTERAAKI----ANVPYTPLLPFGYSAHH 74

Query: 79  MY----VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           M       GT TL+          I  ++   G  KIV +  HG N+  +  +  + R +
Sbjct: 75  MGRVGEGCGTVTLSAETFRRVLYDIARSLIYHGANKIVFVTHHGSNTKPIDELLRKLRYQ 134

Query: 135 FSMLVVST---SWSRFTIPQGIIS-FPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
               V      +     + +GI+   PE   G H GE+ET+ M+A    LV M  A N  
Sbjct: 135 TGAFVAFYKTPTERECEVVKGILEGPPEETPGWHAGEMETAQMMAYDERLVDMSRAVNDR 194

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMK---------DLNPKGVVGNAMDATVKKGEGLLSY 241
           +    ++      +           +         + +    +GN    T +KG  L   
Sbjct: 195 AHAPAWMGPNFSKKDGTVTVMFRGSENIFVPMEHHEYSDHATIGNPFRGTKEKGLKLFEK 254

Query: 242 FANCFIQLLNDINSFDVSIFDKD-VQK 267
            A      L ++  F   + ++D  ++
Sbjct: 255 EAEHLAAFLEEVKKFPFKVENRDFPER 281


>gi|313127445|ref|YP_004037715.1| hypothetical protein Hbor_27250 [Halogeometricum borinquense DSM
           11551]
 gi|312293810|gb|ADQ68270.1| uncharacterized protein, putative amidase [Halogeometricum
           borinquense DSM 11551]
          Length = 248

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 48/229 (20%), Positives = 90/229 (39%), Gaps = 15/229 (6%)

Query: 5   IIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +  ++ +    +D   +  +  LP+G+ EQHGPH P+ TD   A  +A+           
Sbjct: 1   MRLSEATWTDVSDLAGETNLAFLPVGSTEQHGPHAPLGTDAFTAEAVADAGSEAYDGE-- 58

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  PIG + EH    GT  L+     +     + ++   G  ++V++N HGGN+  
Sbjct: 59  VVVAPTLPIGVAAEHRQFPGTLWLSPDTFRDTVRETVASLASHGFDRVVVVNGHGGNTDA 118

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V+           V+ +W              +    HGG +ET+++  +AP  V+ 
Sbjct: 119 LREVTGTITREDDAYAVAFTWFEAVG-------EHSSKMGHGGPLETALLRHVAPESVRE 171

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATV 232
           +  E      ++   ++         +      +    GVVG+      
Sbjct: 172 ERIETAREGGADRWGDWVS-----KVNLAHDSAEFTANGVVGDPSAGDA 215


>gi|225414507|ref|ZP_03761696.1| hypothetical protein CLOSTASPAR_05730 [Clostridium asparagiforme
           DSM 15981]
 gi|225041971|gb|EEG52217.1| hypothetical protein CLOSTASPAR_05730 [Clostridium asparagiforme
           DSM 15981]
          Length = 254

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 69/250 (27%), Positives = 104/250 (41%), Gaps = 6/250 (2%)

Query: 6   IFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           I  +   P       +  + V+P+GA EQHGP+   NTDT  A G ++ I      +  V
Sbjct: 5   ILEELIWPELKQVLPEIELAVVPVGACEQHGPNTTFNTDTARAYGFSKMIGERFGSQ--V 62

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P  P G S+ HM   GT TL     I     I  A+ K GIR+IV LN HGGNS  +
Sbjct: 63  LVCPPVPYGISVHHMAFPGTVTLRCETYINLLTDIAVALSKHGIRRIVFLNGHGGNSGSL 122

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPET-EIGIHGGEIETSMMLALAPHLVKM 183
           S V    +    +    +        +GI       E   H  E ET+  + L P +V+ 
Sbjct: 123 SAVINILKYEHGIDAYYSGIGLNLFEEGITPEMGWSENLGHASESETAQAMVLCPEVVRA 182

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           +  +     +   +R  +    +G  ++ W  +D +  G +G+A  A V  G  L     
Sbjct: 183 ER-KKGEVVEGFIIRGKEAPFRYGGCAWNWK-EDASANGALGDARLANVDDGARLNQIAL 240

Query: 244 NCFIQLLNDI 253
                ++  I
Sbjct: 241 EKVEHMIRHI 250


>gi|282856327|ref|ZP_06265607.1| creatininase [Pyramidobacter piscolens W5455]
 gi|282585830|gb|EFB91118.1| creatininase [Pyramidobacter piscolens W5455]
          Length = 252

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 55/259 (21%), Positives = 100/259 (38%), Gaps = 18/259 (6%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   + + P      ++D  V++ +G+ E HG H+P+ TDT+I   L   I      +  
Sbjct: 1   MRLENITWPRAERYLKEDGTVIIGIGSIESHGRHMPLGTDTLIPDKLLAMI----EEKTD 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G +       GT  +       + L +++++R+ G  K +ILN HGGN   
Sbjct: 57  VLIAPTIPYGATQSLNEYPGTVDIDNDVLYRYLLCVMESLRRHGAGKFLILNGHGGNMKP 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +   + +   +  +  V   W                 G HGG  ET+ +L + P LV  
Sbjct: 117 IERAALDMDKKGCLTAVLNWWLM------AWDMDPAWKGGHGGGEETAAILGIDPALVDR 170

Query: 184 DLAE-----NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG--NAMDATVKKGE 236
           +        N  S   +    +       S +    +  +   G +G  +   AT + G+
Sbjct: 171 NEIGPALKLNDISDAIKATGFYSVSYKGVSFNVPRQISKITDSGWIGPDHPGTATEEWGK 230

Query: 237 GLLSYFANCFIQLLNDINS 255
            +L+  A+    L  +   
Sbjct: 231 KMLAACADYIADLAEEFRK 249


>gi|282856329|ref|ZP_06265609.1| creatininase [Pyramidobacter piscolens W5455]
 gi|282585832|gb|EFB91120.1| creatininase [Pyramidobacter piscolens W5455]
          Length = 256

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 54/264 (20%), Positives = 94/264 (35%), Gaps = 21/264 (7%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     + P      +++  V++ +G+ E HG HLP+ TDTII   + E I      +  
Sbjct: 1   MRLEHIAWPRAEKYFKENDTVLIAVGSCECHGRHLPLGTDTIIPNRILELI----EEKSG 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G +       GT  +          A++D   + G R+ VILN HGGN   
Sbjct: 57  VLIAPTIPYGSTKSLACYPGTIDIGDELLCGLLAAVMDNFYRHGARRFVILNGHGGNIKP 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +  V  +   R  ++ +   W                 G HGG  ET+ ++ + P LV  
Sbjct: 117 IENVGFDFEKRGCLVALLNWWLM------AWDMNPAWKGGHGGGEETAGVMGVNPDLVDR 170

Query: 184 DLAENFSSRQSEFLRNFKYLRA------HGSHSFGWSMKDLNPK-GVVG--NAMDATVKK 234
                           F+            +      +  +    G +G  +   AT + 
Sbjct: 171 SEI-GGPLEYIHLSDRFETTGFRSVKYKGVNIEILRPVDHVTSTGGWIGPDHPATATEEW 229

Query: 235 GEGLLSYFANCFIQLLNDINSFDV 258
           G  +L   A+  +  + +     +
Sbjct: 230 GREMLQTCADYIVDFMEEFKKLPL 253


>gi|300868556|ref|ZP_07113173.1| creatininase [Oscillatoria sp. PCC 6506]
 gi|300333434|emb|CBN58365.1| creatininase [Oscillatoria sp. PCC 6506]
          Length = 251

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 46/259 (17%), Positives = 81/259 (31%), Gaps = 29/259 (11%)

Query: 11  SLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P       +   ++LP+G+ EQHGP   + TD I A  +A      +  ++     P 
Sbjct: 7   TWPEVETYLGQSQGMILPIGSTEQHGPTGLIGTDAICAEAIA----KGVGEQVKAMVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    G+ +L  +  +      I  + K G  K   +N HGGN   +    +
Sbjct: 63  INVGMALHHTDFPGSVSLRPSTLMLVIRDYITCLAKSGFTKFFFINGHGGNIATMKAAFS 122

Query: 130 EARMRFSML---------VVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E     S L             +W   +    +         G H    E ++   L P 
Sbjct: 123 ETYAHLSDLNIKNADLVQCSVGNWFMCSSVYKLAKELYGDREGSHATPSEVALTQYLYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K            +                    +   P G +G +   AT + G+  
Sbjct: 183 AIKQAPLSENVPSGHKIYG-------------ATDFRRRYPDGRMGSDPALATPEHGQKF 229

Query: 239 LSYFANCFIQLLNDINSFD 257
                        +  S D
Sbjct: 230 YELAVKELSNSYLEFLSSD 248


>gi|332709116|ref|ZP_08429084.1| uncharacterized protein, putative amidase [Lyngbya majuscula 3L]
 gi|332352122|gb|EGJ31694.1| uncharacterized protein, putative amidase [Lyngbya majuscula 3L]
          Length = 248

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 45/259 (17%), Positives = 83/259 (32%), Gaps = 29/259 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        K    ++LP+G+ EQHGP   + TD I A  +A+ +             P 
Sbjct: 7   TWKEIEAYLKQSPGIILPIGSTEQHGPTGLIGTDAICAEAIAKGVSEA----TNALVAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    G+ +L  +  I+     +  + + G  K   +N HGGN   +    +
Sbjct: 63  INVGMALHHTAFPGSISLKPSTLIQVIKDYLTCLTRAGFTKFFFINGHGGNIATLKAAFS 122

Query: 130 EARMRFSML---------VVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E+    S L             +W        +       + G H    E ++   L P 
Sbjct: 123 ESYAHLSDLQIPNGERVQCRVANWFMCRSVYKLAKELYGNQEGSHATPSEVALTQYLYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K                  + + +          +   P G +G N   AT + G+  
Sbjct: 183 AIK-------------RAPLSETVASGHPIYGAADFRRRYPDGRMGSNPALATPQHGKQF 229

Query: 239 LSYFANCFIQLLNDINSFD 257
                        +  + D
Sbjct: 230 YELAVKELSSSYLEFMAAD 248


>gi|15789443|ref|NP_279267.1| hypothetical protein VNG0124C [Halobacterium sp. NRC-1]
 gi|10579771|gb|AAG18747.1| conserved hypothetical protein [Halobacterium sp. NRC-1]
          Length = 260

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 54/257 (21%), Positives = 91/257 (35%), Gaps = 14/257 (5%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           +   +   D +    AD     + VLP+G+ EQHGPH P+ TD I A  +A         
Sbjct: 10  VPSRMRLADATWTD-ADGVDTDLAVLPVGSTEQHGPHAPLGTDHITAHAVAAAGADAYSD 68

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V   P   +G S EH    GT  +           ++ ++   G  ++V++N HGGN
Sbjct: 69  G-EVIVAPPITVGVSAEHRQFTGTLWVAPDTFRATVRDVVGSLASHGWDRVVVVNGHGGN 127

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           +  +  V      +     V  +W              +    H G +ET+ +    P L
Sbjct: 128 TAALGEVCATITRQDDAYAVPFTWFDAVG-------DHSSDMGHAGPLETAFLRHTDPEL 180

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           ++ D  +  +   ++        +     +           GVVG+       +G  LL 
Sbjct: 181 IREDRVQAAAEDGADAWG-----KWVSHANLAADAAAFTDNGVVGDPRAGDADRGAALLD 235

Query: 241 YFANCFIQLLNDINSFD 257
                   LL  +   D
Sbjct: 236 AATESLCALLAAVADRD 252


>gi|253574112|ref|ZP_04851454.1| creatininase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251846589|gb|EES74595.1| creatininase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 248

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 96/247 (38%), Gaps = 20/247 (8%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +N+  +    ++    +LP+GA E HGPHLP+ TD ++A  LA R+            +P
Sbjct: 6   ENAYDIAEKIKRMPCAILPIGAVEAHGPHLPLGTDNLLAERLALRLAERTES----LVLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
             P G         G+  ++    I     I +++ + G+R  V+LN H GN+  +   +
Sbjct: 62  TLPYGQVWSLQNFPGSINVSNEALIRMLYDIGESLYRQGLRIYVMLNGHLGNAVALKEAA 121

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI----HGGEIETSMMLALAPHLVKMD 184
                    L V   +      Q I    ET        H  E+ETS ML LA   V MD
Sbjct: 122 RLLYKDIPELKV-YYFFYPGTKQVIEQVRETPASHASYFHACELETSYMLYLAGEYVDMD 180

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
            A                          W  ++     V+G+A  AT +KGE ++    N
Sbjct: 181 KAVTDIPHIGLEAD---------CTPTPW--EEFTSTAVLGDAKLATKEKGEQIIEAALN 229

Query: 245 CFIQLLN 251
               ++ 
Sbjct: 230 AMAAMIE 236


>gi|307329732|ref|ZP_07608888.1| Creatininase [Streptomyces violaceusniger Tu 4113]
 gi|306884572|gb|EFN15602.1| Creatininase [Streptomyces violaceusniger Tu 4113]
          Length = 249

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 70/240 (29%), Positives = 105/240 (43%), Gaps = 17/240 (7%)

Query: 11  SLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVE 70
           +       R D + VLP+G++EQHG  LP+ TDT+IA  +A  I +  P    V  +P  
Sbjct: 18  TTEEVRADRAD-VAVLPIGSFEQHGAFLPLVTDTVIAGTIAGEIAAAYP----VLHLPPV 72

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
            I  S EH    GT +L+ A        I D++R+ GIR ++++N HGGN  L +IV   
Sbjct: 73  TISCSHEHAAWPGTVSLSAATLYAVVRDIADSLRRSGIRGLILVNGHGGNYVLRNIVQES 132

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
           A   F M +   S               +   +H GE+ETS++L   P LV+        
Sbjct: 133 AGGDFGMALFPGSADWDAARTRAGVRTPSNSDMHAGELETSILLHAHPELVRP------- 185

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
                      ++     H     M      GV+G    A+  KG+ LL+   + F + L
Sbjct: 186 -----GHETSDWISDDRKHLLTLGMPAYTESGVIGRPSRASAHKGKELLAGLVDSFAEYL 240


>gi|313127299|ref|YP_004037569.1| hypothetical protein Hbor_25700 [Halogeometricum borinquense DSM
           11551]
 gi|312293664|gb|ADQ68124.1| uncharacterized protein, putative amidase [Halogeometricum
           borinquense DSM 11551]
          Length = 252

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 61/256 (23%), Positives = 98/256 (38%), Gaps = 21/256 (8%)

Query: 3   PLIIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           P I     +      A +      V+ +GA EQHGPHLP+  DT+    LA RI   L  
Sbjct: 5   PSIRLEACTWTEVESALESGMRTAVVAVGAIEQHGPHLPLIMDTLAGDELARRIAEKLGD 64

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
                  P    G S  HM   GT T+     ++   +   ++ + G   I ++  HGGN
Sbjct: 65  ---AFAAPTIRPGCSGHHMEFPGTITVPPETLMDVIRSYCRSLDEHGFEHIALVPTHGGN 121

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPET-----EIGIHGGEIETSMMLA 175
              V+ V+ E        VV+ +     + +             E  IH G +ET+M+LA
Sbjct: 122 FAPVNTVAPEIGREIDANVVAVADLHEYMDRQKAGLHAGGVEYEESVIHAGAVETAMVLA 181

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
           +   LV+ D        +    R                   +   GV+G+   AT + G
Sbjct: 182 VDEGLVRTDELAVGHEGEVSTARLLSD-----------GFASITENGVLGDPRAATAEAG 230

Query: 236 EGLLSYFANCFIQLLN 251
           E +    A+ +++ + 
Sbjct: 231 EEIFEAVADAYVERIE 246


>gi|170722441|ref|YP_001750129.1| creatininase [Pseudomonas putida W619]
 gi|169760444|gb|ACA73760.1| Creatininase [Pseudomonas putida W619]
          Length = 260

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 66/275 (24%), Positives = 105/275 (38%), Gaps = 34/275 (12%)

Query: 1   MNPLIIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           MN  ++  + + P  A        + LP+GA EQHG H+ M  D ++   L + +   + 
Sbjct: 1   MNESVVVGELTWPEYAQKVASGSTIFLPVGALEQHGHHMCMEVDVLLPTALCKAVAREVD 60

Query: 60  PRLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVIL 114
                  +P    GY     S    +  GT +L  A        II  + + G RK+V++
Sbjct: 61  ----GLVLPALAYGYKSQQKSGGGNHFPGTTSLDGATLTHTIQDIIRELARHGARKLVLM 116

Query: 115 NAHGGNSPL----VSIVSTEARMRF--SMLVVSTSWSRFTIPQGIIS--FPETEIGI--- 163
           N H  NS      + +   E R        VV  S+  F     +I   +PE  +G    
Sbjct: 117 NGHYENSMFIVEGIDLALRELRYGGITDFKVVVLSYWDFVNAPAVIEELYPEGFLGWDIE 176

Query: 164 HGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGV 223
           HGG  ETS+MLAL P  V +  A +    +      F  +                  G 
Sbjct: 177 HGGVFETSLMLALHPEKVDLSRAVDHPPAKFPPYDVFPIIPERTPAC-----------GT 225

Query: 224 VGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
           + +   A+ +KGE  L          + +  +FD+
Sbjct: 226 LSSPKGASREKGELTLRVCVEGISSAVRE--AFDL 258


>gi|322370059|ref|ZP_08044621.1| Creatininase [Haladaptatus paucihalophilus DX253]
 gi|320550395|gb|EFW92047.1| Creatininase [Haladaptatus paucihalophilus DX253]
          Length = 245

 Score =  172 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 61/260 (23%), Positives = 101/260 (38%), Gaps = 15/260 (5%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +  +D +    AD     + +LP+G+ EQHGPH P+ TD + A                V
Sbjct: 1   MHLSDATWTD-ADDVDTDLALLPVGSTEQHGPHAPLGTDWLNAEA--VADAGAAAYDGEV 57

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P   +G S EH    GT  ++      +    + ++   G  ++VI+N HGGN   +
Sbjct: 58  VVAPPISVGVSEEHRQFTGTLWVSEDTFRRYVRETVASLAHHGWNRVVIVNGHGGNVAAL 117

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             V+           V  +W                   H G +ET+ +    P LV+ D
Sbjct: 118 REVAGTITRHDEAYAVPFTWFEAVG-------DHRSDMGHAGPLETAFLRHTRPDLVRED 170

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             E      S+    +         +  +   +    GVVG+  D   ++GE LL     
Sbjct: 171 EIEAAREGASDGWGEWVSY-----TNLAYDSAEFTENGVVGDPTDGDEERGEELLELATQ 225

Query: 245 CFIQLLNDINSFDVSIFDKD 264
             ++LL+ + S DVS  D++
Sbjct: 226 SLVKLLSAVESRDVSRPDRE 245


>gi|119485691|ref|ZP_01619966.1| Creatininase [Lyngbya sp. PCC 8106]
 gi|119457016|gb|EAW38143.1| Creatininase [Lyngbya sp. PCC 8106]
          Length = 246

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 45/250 (18%), Positives = 78/250 (31%), Gaps = 29/250 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P           +++P+G+ EQHGP   + TD I A  +A                P 
Sbjct: 7   TWPEVETYLSQSTGIIIPIGSTEQHGPTGLIGTDAICAEAIA----KGTGEATNALVSPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ HM   G+ +L  +  I      I ++   G  K   +N HGGN   +     
Sbjct: 63  INVGMALHHMAFPGSMSLQPSTLINVIKDYITSLAGHGFNKFFFINGHGGNIATLKAAFA 122

Query: 130 EARMRFSMLV----------VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           E     + L           V   +   ++ +        + G H    E ++   L P 
Sbjct: 123 ETYAHLADLHLPNADQVRCQVGNWFMCRSVYKLAKELYADQEGSHATPSEVAVTQYLYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K        ++                       +   P G +G N   AT + G+ L
Sbjct: 183 AIKQAPLSEDVAK-------------GYPIYGAADFRRHYPDGRMGSNPALATPEHGKQL 229

Query: 239 LSYFANCFIQ 248
                     
Sbjct: 230 YELAVKDLSN 239


>gi|75907458|ref|YP_321754.1| creatininase [Anabaena variabilis ATCC 29413]
 gi|75701183|gb|ABA20859.1| Creatininase [Anabaena variabilis ATCC 29413]
          Length = 251

 Score =  172 bits (436), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 48/259 (18%), Positives = 83/259 (32%), Gaps = 29/259 (11%)

Query: 11  SLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        +K   ++LP+G+ EQHGP   + TD I A  +A  +             P 
Sbjct: 7   TWQEVETYLQKSTGIILPIGSTEQHGPTGLIGTDAICAEAIARGVGEATG----AIVAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  I      + ++ K G  K   +N HGGN   +    +
Sbjct: 63  INVGMALHHTAFPGTISLRPSTLILLVRDYVTSLAKAGFTKFYFINGHGGNIATLKAAFS 122

Query: 130 EARM---------RFSMLVVSTSWSRFTIP-QGIISFPETEIGIHGGEIETSMMLALAPH 179
           E               +     +W       Q        + G H    E ++   + P 
Sbjct: 123 ETYAYLEDLQIPSAHKVQCQVANWFMCGSVYQLAKELYGDQEGSHATPSEVAVTQYVYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K       +    E  R  +   A          +   P G +G N   AT + G+  
Sbjct: 183 AIKQ------APLSPEVARGHRIYSAT-------DFRQHYPDGRMGSNPALATPEHGKQF 229

Query: 239 LSYFANCFIQLLNDINSFD 257
                        +  + D
Sbjct: 230 YDLAVKELSNGYLEFLNAD 248


>gi|255008574|ref|ZP_05280700.1| hypothetical protein Bfra3_05493 [Bacteroides fragilis 3_1_12]
 gi|313146303|ref|ZP_07808496.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313135070|gb|EFR52430.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 253

 Score =  172 bits (436), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 61/246 (24%), Positives = 98/246 (39%), Gaps = 14/246 (5%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV--TCMPVEPIG- 73
              K  +++LP GA E H  HLP  TD I+   +A     +   R  V    MP  P G 
Sbjct: 16  KGLKYDVIILPWGATEPHNLHLPYLTDCILPHDIAVEAAEMALARSGVRCMVMPPVPFGA 75

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           ++     +       YA        I+ ++   G RK+VIL  HGGN+     +  +   
Sbjct: 76  HNPGQRELPFCIHTRYATQQAILEDIVSSLYVQGFRKLVILCGHGGNN--FKGMIRDLAF 133

Query: 134 RFSML-VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            +    + + +W     P+G     E E+  H GE ET++M+   P LV +  A +  S+
Sbjct: 134 EYPDFLIAAANWFEVVSPKGYF---EAEVDDHAGESETAVMMHYHPELVNLAEAGDGKSK 190

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
                   + +         W  K     GV G+   AT +KGE  +        +L  +
Sbjct: 191 PFAIASLNEKVAW---VPRHWD-KATADSGV-GDPRKATAEKGERYVKPIVEKLARLFEE 245

Query: 253 INSFDV 258
           +   D+
Sbjct: 246 MVKHDL 251


>gi|134098955|ref|YP_001104616.1| creatininase [Saccharopolyspora erythraea NRRL 2338]
 gi|291006806|ref|ZP_06564779.1| creatininase [Saccharopolyspora erythraea NRRL 2338]
 gi|133911578|emb|CAM01691.1| creatininase [Saccharopolyspora erythraea NRRL 2338]
          Length = 242

 Score =  172 bits (435), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 58/248 (23%), Positives = 104/248 (41%), Gaps = 25/248 (10%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
            ++  + + P      +  +V++P G+ EQHGPHLP++TD+ IA  +A +    L     
Sbjct: 2   SLLLAEQAWPDLEG--RRPLVIVPFGSCEQHGPHLPLDTDSSIATAVAWKGVRELADGTD 59

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P +    S EH    GT ++         + +  ++      +++I+N HGGN+ +
Sbjct: 60  VLLAPTQHYTASGEHEGFPGTVSIGCDALHLLVVELGRSLSGW-CGRVLIVNGHGGNNAV 118

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           ++    + R     +     W    +              H G  ETSMM+AL P  V+ 
Sbjct: 119 LAKAVAQLRDERREVA----WWPCAV---------QGGDAHAGRTETSMMMALRPLSVRE 165

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D A    +     L          +     S++ ++P GV+G+   A+   GE LL+  A
Sbjct: 166 DRARAGRTEPVRKLMG----ELERN-----SVRAVSPNGVLGDPGGASAAAGERLLNRMA 216

Query: 244 NCFIQLLN 251
                 ++
Sbjct: 217 AELCTAVH 224


>gi|34810367|pdb|1Q3K|A Chain A, Crystal Structure Of Creatinine Amidohydrolase
           (Creatininase)
 gi|34810368|pdb|1Q3K|B Chain B, Crystal Structure Of Creatinine Amidohydrolase
           (Creatininase)
 gi|34810369|pdb|1Q3K|C Chain C, Crystal Structure Of Creatinine Amidohydrolase
           (Creatininase)
 gi|34810370|pdb|1Q3K|D Chain D, Crystal Structure Of Creatinine Amidohydrolase
           (Creatininase)
 gi|34810371|pdb|1Q3K|E Chain E, Crystal Structure Of Creatinine Amidohydrolase
           (Creatininase)
 gi|34810372|pdb|1Q3K|F Chain F, Crystal Structure Of Creatinine Amidohydrolase
           (Creatininase)
          Length = 259

 Score =  172 bits (435), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 64/265 (24%), Positives = 104/265 (39%), Gaps = 33/265 (12%)

Query: 4   LIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
            +   + +        A  D +++LP+GA EQHG H+ MN D ++   + +R+   +   
Sbjct: 3   SVFVGELTWKEYEARVAAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCQRVAERIG-- 60

Query: 62  LPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNA 116
                +P    GY     S    +  GT +L  A        II  + + G+R++V++N 
Sbjct: 61  --ALVLPGLQYGYKSQQKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGVRRLVLMNG 118

Query: 117 HGGNSPL----VSIVSTEARMR--FSMLVVSTSWSRFTIPQGIIS--FPETEIGI---HG 165
           H  NS      + +   E R        VV  S+  F     +I   +PE  +G    HG
Sbjct: 119 HYENSMFIVEGIDLALRELRYAGIHDFKVVVLSYWDFVKDPAVIQRLYPEGFLGWDIEHG 178

Query: 166 GEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG 225
           G  ETS+MLAL P LV ++   +           F    A                G + 
Sbjct: 179 GVFETSLMLALYPDLVDLERVVDHPPATFPPYDVFPVDPARTPAP-----------GTLS 227

Query: 226 NAMDATVKKGEGLLSYFANCFIQLL 250
           +A  A+ +KGE +L          +
Sbjct: 228 SAKTASREKGELILEVCVQGIADAI 252


>gi|297539395|ref|YP_003675164.1| Creatininase [Methylotenera sp. 301]
 gi|297258742|gb|ADI30587.1| Creatininase [Methylotenera sp. 301]
          Length = 254

 Score =  172 bits (435), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 58/250 (23%), Positives = 97/250 (38%), Gaps = 18/250 (7%)

Query: 5   IIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           + +++ +     +  A  +   +LP+GA EQHGPH+    D ++A  L   + ++     
Sbjct: 1   MFWSELTWAELPEKIAEANQAAILPIGATEQHGPHMGCGMDYVLADILCSAVSTL----T 56

Query: 63  PVTCMPVEPIGYSIEHM-YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
            V  +P  P G SI H     GT  +     I     I D     GIR++ I+N H  N+
Sbjct: 57  NVPMLPTMPYGCSIGHSQRWPGTLAIQPITLINMMKDIGDWAYHSGIRRLFIVNTHVTNA 116

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +       R     ++V+   S     +            H  + ETS+MLA APH+V
Sbjct: 117 APLRCALEMLRAEHDDMMVTVINSAHISERVRQFHHADGDDWHANDAETSLMLATAPHMV 176

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + +L                  R  G   F   +   +  GV G    +T +KG+    +
Sbjct: 177 RTELLNLADDPD----------RTEGLV-FSHPVNRTSTNGVTGMPSISTAEKGQEWFQW 225

Query: 242 FANCFIQLLN 251
                 +L+ 
Sbjct: 226 MVEDLSRLIQ 235


>gi|284049333|ref|YP_003399672.1| Creatininase [Acidaminococcus fermentans DSM 20731]
 gi|283953554|gb|ADB48357.1| Creatininase [Acidaminococcus fermentans DSM 20731]
          Length = 243

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 94/257 (36%), Gaps = 23/257 (8%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M                  KD +V++P GA E +GPHLPM TD ++A  +AE +      
Sbjct: 8   MPGKQYLERM--------EKDPLVIIPTGACEVYGPHLPMGTDLLVAKRIAELVAE---- 55

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
                  P    G S        T  +      ++   I+  + K G +KI+ +  H GN
Sbjct: 56  ETDALIAPTIEAGESSALASFPCTFAMPRKILEDYLDYILGKVLKDGAKKILFITGHAGN 115

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIP--QGIISFPETEIGIHGGEIETSMMLALAP 178
              V+ +S +   ++   +    W RF     +GI  +       H  E  TS+ML L P
Sbjct: 116 VDTVNYLSKKYMEQYDFKMAQVDWWRFATVHNKGICQYEGYMCNGHASECGTSVMLYLFP 175

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV            S    +F  L             D    G VG+A  AT +KGE +
Sbjct: 176 ELVDEAGETCVDPHTSSEFSDFITLGK---------FTDKTYNGTVGDATVATREKGEKI 226

Query: 239 LSYFANCFIQLLNDINS 255
           +       ++ +     
Sbjct: 227 VEACLARILKFIKAYYK 243


>gi|148264178|ref|YP_001230884.1| creatininase [Geobacter uraniireducens Rf4]
 gi|146397678|gb|ABQ26311.1| Creatininase [Geobacter uraniireducens Rf4]
          Length = 239

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 58/256 (22%), Positives = 95/256 (37%), Gaps = 21/256 (8%)

Query: 5   IIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +I  + ++    +  K    V +P G+ E+HG HLP++TDTI A  + +R   I+P    
Sbjct: 1   MIIEEMTMGDFEEGLKRTRTVYIPFGSVEEHGYHLPLSTDTIQAYEVGKRAAEIIP---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP- 122
           +   P    G         GT ++T A        I+ +    G+R  ++L  H G +  
Sbjct: 57  LFVAPPIHYGCCRSTACHPGTISITTATLKALLKDIVRSFHSHGMRNFIVLTGHAGGAHK 116

Query: 123 -LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +     E       + ++                ET    H GEIETS ++   P LV
Sbjct: 117 MALQDAGEELIAELLDIRMAVVTEYDLAKDAGRELVETAGDAHAGEIETSRIMHSHPQLV 176

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
                  F S     L   K              +   P GV G+   A+ +KG+ L   
Sbjct: 177 NGTGEREFPSFPVGILVRDK--------------RRFWPNGVWGDPTKASAEKGKRLEQL 222

Query: 242 FANCFIQLLNDINSFD 257
                + L   + +F+
Sbjct: 223 VTAKVVDLARALEAFE 238


>gi|220936241|ref|YP_002515140.1| Creatininase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997551|gb|ACL74153.1| Creatininase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 261

 Score =  171 bits (434), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 87/248 (35%), Gaps = 18/248 (7%)

Query: 7   FTDNSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   +               +LP+GA EQHGPHL    D  IAA L   +          
Sbjct: 5   WYTMTWEEIGALVAGGMDSAILPVGATEQHGPHLGCGMDAEIAARLCRDVAESTG----A 60

Query: 65  TCMPVEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
             +P  P G SI H     GT  L     I+    I D +   G R++ ++N H  N   
Sbjct: 61  MLLPALPYGCSIGHSRRWPGTIALQPKTLIDVIKDIGDWVYASGFRRLFLVNGHVTNEAP 120

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +       R     L+V+   +     +   +     +  H    ET++M+AL+PH+++ 
Sbjct: 121 LRCALEMLRAEHDDLMVALVNTPAISERVRTAHCADGMDWHANAAETALMMALSPHMLRA 180

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           +   +                      F   +   +  GV G+   A  ++G  L ++  
Sbjct: 181 ERIRDADDPDRTE-----------DCVFAHPVNRTSTNGVTGHPSRANREQGATLYAWMV 229

Query: 244 NCFIQLLN 251
                 + 
Sbjct: 230 EDLSARVR 237


>gi|218248213|ref|YP_002373584.1| Creatininase [Cyanothece sp. PCC 8801]
 gi|218168691|gb|ACK67428.1| Creatininase [Cyanothece sp. PCC 8801]
          Length = 248

 Score =  171 bits (434), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 45/259 (17%), Positives = 83/259 (32%), Gaps = 29/259 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P   +  K    +++P+G+ EQHGP   + TD I A  +A      +   +     P 
Sbjct: 7   TWPEVENYLKTSSGLIIPIGSTEQHGPTGLIGTDAICAEAIA----KGVGEEVQAMVAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L     I+  L  +  + + G R+   +N HGGN   +    +
Sbjct: 63  INVGMALHHTAFPGTISLRPTTLIQVILDYLTCLTEAGFRRFFFINGHGGNIATLKAAFS 122

Query: 130 EARMRFSML---------VVSTSWSRFTIP-QGIISFPETEIGIHGGEIETSMMLALAPH 179
           E     + L             +W       Q    +   + G H    E ++   + P 
Sbjct: 123 EVYYHLAHLRLSEADQVRCQVGNWFMCRSVYQKAKEWYGDQEGSHATPSEVAVTQYVYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K        +                        +   P G +G N   AT + G+  
Sbjct: 183 SIKKAALSPDVAS-------------GYPIYGAEDFRRHYPDGRMGSNPALATPEHGQEF 229

Query: 239 LSYFANCFIQLLNDINSFD 257
                        +    +
Sbjct: 230 YELAVKELSNSYLEFLQSE 248


>gi|149174717|ref|ZP_01853342.1| hypothetical protein PM8797T_26315 [Planctomyces maris DSM 8797]
 gi|148846411|gb|EDL60749.1| hypothetical protein PM8797T_26315 [Planctomyces maris DSM 8797]
          Length = 267

 Score =  171 bits (434), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 65/249 (26%), Positives = 102/249 (40%), Gaps = 9/249 (3%)

Query: 16  ADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVTCMPVEPI 72
           A  +++   + VLP+GA E H  HLP  TDT  A  ++ R+      R   V  +P  P 
Sbjct: 18  AYVKENPYQVAVLPMGATEPHNLHLPYGTDTYEADAISSRVCEAAHQRGAKVVMLPPIPY 77

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           G          +  +  +   +  + ++D++   G+ K++ILN+HGGN      +  E  
Sbjct: 78  GTETNQAAFPLSMNVNPSTLGQMIMDLVDSLANHGVNKLLILNSHGGN--DFKPLLRELH 135

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
              S+ +    W R T         E     H GE+ETS+ LA  P LV  D AE  +  
Sbjct: 136 GSTSVQIFLADWFRGTSADVKAEIFE-NPDDHAGEMETSLALAYFPQLVNRD-AETGALH 193

Query: 193 QSEFLRNFKYLRA--HGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
             +   N     A   G  S       L      GN   AT +KGE L+    +   Q +
Sbjct: 194 ADDGATNATRFSAVNEGWVSITRPWHLLTTNSGSGNPHQATAEKGERLMQILVDRLSQFV 253

Query: 251 NDINSFDVS 259
            +++   + 
Sbjct: 254 VELSEAKLD 262


>gi|167771048|ref|ZP_02443101.1| hypothetical protein ANACOL_02402 [Anaerotruncus colihominis DSM
           17241]
 gi|167666718|gb|EDS10848.1| hypothetical protein ANACOL_02402 [Anaerotruncus colihominis DSM
           17241]
          Length = 248

 Score =  171 bits (434), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 65/251 (25%), Positives = 107/251 (42%), Gaps = 22/251 (8%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           D +    A AR   + ++P+G+ EQHGPHLP++TD  IAA   E +            +P
Sbjct: 5   DRTADELA-ARDTDLAIIPIGSIEQHGPHLPLSTDYRIAAAFGEAVAEAAG----GFSIP 59

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
             P+    EHM   G   +          +++ ++++ G R+ V L  HGG   ++  V 
Sbjct: 60  PLPVSTCREHMGKKGAVWMDPDVFYHMLYSMLMSLKEQGFRRAVTLQCHGG-IFVLPAVI 118

Query: 129 TEARMR--FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
            +         + V+                ET+  +H GE+ETS+ML +AP LV M+ A
Sbjct: 119 RQVNATNNPDFMAVNIDICSLFGVVAAEGITETDKELHAGEVETSLMLHIAPELVHMERA 178

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
            +F          +             S+   +P GV G    A+  KG+ +L  F    
Sbjct: 179 VDFVPAVQRPYLGYG------------SIFRASPSGVWGEPSRASADKGKRILERFTALA 226

Query: 247 IQLLNDINSFD 257
           +Q ++   +FD
Sbjct: 227 VQEMD--QAFD 235


>gi|310828515|ref|YP_003960872.1| hypothetical protein ELI_2940 [Eubacterium limosum KIST612]
 gi|308740249|gb|ADO37909.1| hypothetical protein ELI_2940 [Eubacterium limosum KIST612]
          Length = 269

 Score =  171 bits (434), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 64/268 (23%), Positives = 101/268 (37%), Gaps = 20/268 (7%)

Query: 6   IFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
            + + S     +  K+  + +LP+GA EQHGPH P   D   A GLAE++          
Sbjct: 8   WWDELSKEEILEDVKNCDMAILPIGATEQHGPHCPCGCDAYNAKGLAEKVAEKTG----A 63

Query: 65  TCMPVEPIG-YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
             +P+ P G +   H Y+ GT  L Y         II      G +K  IL+AHG  S  
Sbjct: 64  MLLPLLPYGSHPYHHWYMPGTIPLGYETHTNVLCDIIRGAANAGYKKFFILSAHGQVSTT 123

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           + +   +  +     + +  +      Q  +  P      H  E ETSM L L P  + M
Sbjct: 124 L-VAVHKLGLEGYFTLSAHWYDLLRDNQTALETP----MTHADEAETSMALYLYPQYIDM 178

Query: 184 DLAENFSSR--------QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
             A +                +        H   +F          GV+G+   ATV+KG
Sbjct: 179 SKAVDDGGECLINDEFMIKPGMTPKPGQMYHFEGTFARPEYIELKSGVIGHPTLATVEKG 238

Query: 236 EGLLSYFANCFIQLLNDIN-SFDVSIFD 262
           E ++    +    ++ D+   F   +  
Sbjct: 239 EAIVEKAVSLISDIVEDVMERFPAGVQP 266


>gi|108805932|ref|YP_645869.1| creatininase [Rubrobacter xylanophilus DSM 9941]
 gi|108767175|gb|ABG06057.1| Creatininase [Rubrobacter xylanophilus DSM 9941]
          Length = 252

 Score =  171 bits (433), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 73/253 (28%), Positives = 104/253 (41%), Gaps = 20/253 (7%)

Query: 6   IFTDNSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
              + S P    A       V+LPLGA EQHGPHLP+ TDT+ A  LAE +   LP    
Sbjct: 4   RLAEMSWPEVERAVAAGHTTVILPLGATEQHGPHLPLGTDTVRAGALAELLAERLP---G 60

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               P  P G S EH    G   +         +         G R++V+L+AHGGN   
Sbjct: 61  ALVAPALPFGCSDEHAGFPGLLGVEKETLARLLVEAARRAAAWGARRLVLLSAHGGNGEA 120

Query: 124 VSIVSTEARMRFSMLVVSTSWS------RFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
           +++     R     L V +                    PE E+G+H GE ETS ML+L 
Sbjct: 121 LALAREALRRELPQLAVWSEEDLLSPSPALASVARREGIPEGELGLHAGEGETSEMLSLR 180

Query: 178 PHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
           P LV+ D A        +     + LR+ G       ++  +  GV+G+   A   +G+ 
Sbjct: 181 PDLVRRDRARPG--YTGDMGAVVEALRSGG-------LRAAHESGVLGDPTRAEAGRGDA 231

Query: 238 LLSYFANCFIQLL 250
            L   A    + +
Sbjct: 232 YLEARAEELARAV 244


>gi|166368004|ref|YP_001660277.1| creatininase [Microcystis aeruginosa NIES-843]
 gi|166090377|dbj|BAG05085.1| creatininase [Microcystis aeruginosa NIES-843]
          Length = 255

 Score =  170 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 42/256 (16%), Positives = 81/256 (31%), Gaps = 30/256 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        +    +++P+G+ EQHGP   + TD + A  +A      +  ++     P 
Sbjct: 7   TWLEVESYLEQSQGIIIPIGSTEQHGPTGLIGTDALCAEAIA----KGVGKQVRAMVAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  I+  L  +  + + G R+   +N HGGN   +     
Sbjct: 63  LNVGMALHHTAFPGTISLRPSTLIQVILDYVTCLARAGFRQFFFINGHGGNIATLKAAFA 122

Query: 130 EARMRFS---------MLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E               +     +W        +       + G H    E ++   L P 
Sbjct: 123 ETYYHLDSLNLPNTNEVKCQVANWFMVREVYLLAKELYGDQEGSHATPSEVALTQYLYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K        +                      + +   P G +G N   AT + G+  
Sbjct: 183 SLKNAFLSEKVASGHGIYG-------------AANFRQNYPDGRMGSNPALATPEHGQRF 229

Query: 239 LSYFANCFI-QLLNDI 253
                       L  +
Sbjct: 230 YELAVKELSNNYLEWL 245


>gi|284165675|ref|YP_003403954.1| creatininase [Haloterrigena turkmenica DSM 5511]
 gi|284015330|gb|ADB61281.1| Creatininase [Haloterrigena turkmenica DSM 5511]
          Length = 245

 Score =  170 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 57/253 (22%), Positives = 104/253 (41%), Gaps = 21/253 (8%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +    +S     +A      +LP+G+ EQHGPH P+ TDTI+A  +A+           V
Sbjct: 1   MRLETSSWTDVDEASP-TTALLPVGSTEQHGPHAPVGTDTIVARAIADAADRASDAESIV 59

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P  P+G +  H    GT  ++      +   ++++I    +  +V +N HGGN   +
Sbjct: 60  --GPTIPVGIAPYHGNFPGTCFVSAETFRRYVRDVVESIADSSVETVVFVNGHGGNGETL 117

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           S ++ E     ++   +  W               E   H GE+ET+++L L P  V   
Sbjct: 118 SHLAREVTAEDAIECEAYLWEWMRAVD--------EHVGHAGELETAVLLHLCPDDVGDP 169

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
           +A + ++          +              + +  G VG+A DA+ ++GE +     +
Sbjct: 170 VAGDAATWADTVDGGVVH----------QFTDEFSENGAVGDATDASPEQGERVFETAVD 219

Query: 245 CFIQLLNDINSFD 257
             +  L  + S D
Sbjct: 220 ALVSFLERVRSED 232


>gi|159027077|emb|CAO89262.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 255

 Score =  170 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 43/256 (16%), Positives = 82/256 (32%), Gaps = 30/256 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        +    +++P+G+ EQHGP   + TD + A  +A      +  ++     P 
Sbjct: 7   TWLEVESYLEQSQGIIIPIGSTEQHGPTGLIGTDALCAEAIA----KGVGTQVRAMVAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  I+  L  +  + + G R+   +N HGGN   +    +
Sbjct: 63  LNVGMALHHTAFPGTISLRPSTLIQVILDYVTCLARAGFRQFFFINGHGGNIATLKAAFS 122

Query: 130 EARMRFSML---------VVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E       L             +W        +       + G H    E ++   L P 
Sbjct: 123 ETYYHLDALNLPNTNEVKCQVANWFMVREVYLLAKELYGEQEGSHATPSEVALTQYLYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
             K        +   +                  + +   P G +G N   AT + G+  
Sbjct: 183 SRKNAFLSEKVASGHDIYG-------------AANFRQNYPDGRMGSNPALATPEHGQRF 229

Query: 239 LSYFANCFIQ-LLNDI 253
                       L  +
Sbjct: 230 YELAVKELSNTYLEWL 245


>gi|269929058|ref|YP_003321379.1| Creatininase [Sphaerobacter thermophilus DSM 20745]
 gi|269788415|gb|ACZ40557.1| Creatininase [Sphaerobacter thermophilus DSM 20745]
          Length = 251

 Score =  170 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 66/260 (25%), Positives = 95/260 (36%), Gaps = 19/260 (7%)

Query: 1   MNPLIIFTDNSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           M  +    D   P            VV   G+ EQHGP LP  TDT++   LAE +   L
Sbjct: 1   MAEIKRLADLHWPDVRALLDSGTRTVVTAAGSMEQHGPQLPFQTDTLLGTVLAEAVAERL 60

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
                V   P  P G S  HM   GT TL  A         + ++   G   ++++ +HG
Sbjct: 61  G---NVLVGPTIPFGVSEHHMAFPGTITLDTATFKAVVRHYVASLAHHGFTTVIVIPSHG 117

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEI------GIHGGEIETSM 172
           GN   +  +  E   +                + +      +       G H GE ETSM
Sbjct: 118 GNFAPLRELEEETGGQIGGARYLPYTDLMAFMKPMEEIAAQDGITPQVAGAHAGEAETSM 177

Query: 173 MLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATV 232
           +LA  P LV M  A         F+  F    A     F   M  L   G++G+A  A  
Sbjct: 178 VLAARPDLVDMSQAAEG------FVGTFDAGAAQ--LIFERGMTALTANGILGDARPADA 229

Query: 233 KKGEGLLSYFANCFIQLLND 252
            +GE  ++  A+       +
Sbjct: 230 ARGERYIAALADMLAAYFRE 249


>gi|172038872|ref|YP_001805373.1| putative creatininase [Cyanothece sp. ATCC 51142]
 gi|171700326|gb|ACB53307.1| putative creatininase [Cyanothece sp. ATCC 51142]
          Length = 248

 Score =  170 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 44/259 (16%), Positives = 87/259 (33%), Gaps = 30/259 (11%)

Query: 10  NSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
            + P   D  + +  +++P+G+ EQHGP   + TD I A  +A      +  +      P
Sbjct: 6   MTWPEVEDYLQTNTGIIIPIGSTEQHGPIGLIGTDAICAEAIA----KGVGEQTQTIVGP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
              +G ++ H    G+ +L  +  I+  L  +  + + G  +   +N HGGN   +    
Sbjct: 62  TINVGMALHHTAFPGSMSLRPSTLIQVILDYLTHLTQAGFTRYFFINGHGGNISPLKAAF 121

Query: 129 TEARMRF---------SMLVVSTSWSRFTIP-QGIISFPETEIGIHGGEIETSMMLALAP 178
           +E               +     +W       Q        + G H    E ++   + P
Sbjct: 122 SETYYHLSTLNIPHSDRIRAKVGNWFMCRSVYQKAKELYGDQEGSHATPSEVAVTQFIYP 181

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEG 237
             +K                    + +          +   P G +G N   AT + G+ 
Sbjct: 182 ESIK-------------KAPLSPDVNSGYPIYGAEDFRTHYPDGRMGSNPALATPEHGQQ 228

Query: 238 LLSYFANCFIQ-LLNDINS 255
           L         +  L  +++
Sbjct: 229 LYELAVKELSESYLKFLHA 247


>gi|257060466|ref|YP_003138354.1| creatininase [Cyanothece sp. PCC 8802]
 gi|256590632|gb|ACV01519.1| Creatininase [Cyanothece sp. PCC 8802]
          Length = 248

 Score =  170 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 45/259 (17%), Positives = 82/259 (31%), Gaps = 29/259 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P   +  K    +++P+G+ EQHGP   + TD I A  +A      +   +     P 
Sbjct: 7   TWPEVENYLKTSSGLIIPIGSTEQHGPTGLIGTDAICAEAIA----KGVGEEVHAMVAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L     I+  L  +  + + G R+   +N HGGN   +    +
Sbjct: 63  INVGMALHHTAFPGTISLRPTTLIQVILDYLTCLTEAGFRRFFFINGHGGNIATLKAAFS 122

Query: 130 EARMRFSML---------VVSTSWSRFTIP-QGIISFPETEIGIHGGEIETSMMLALAPH 179
           E     + L             +W       Q        + G H    E ++   + P 
Sbjct: 123 EVYYHLAHLRLSEADQVRCQVGNWFMCRSVYQKAKELYCDQEGSHATPSEVAVTQYIYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K        +                        +   P G +G N   AT + G+  
Sbjct: 183 SIKKAALSPDVAS-------------GYPIYGAEDFRRHYPDGRMGSNPALATPEHGQEF 229

Query: 239 LSYFANCFIQLLNDINSFD 257
                        +    +
Sbjct: 230 YELAVKELSNSYLEFLQSE 248


>gi|67923616|ref|ZP_00517087.1| Creatininase [Crocosphaera watsonii WH 8501]
 gi|67854540|gb|EAM49828.1| Creatininase [Crocosphaera watsonii WH 8501]
          Length = 248

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 46/260 (17%), Positives = 87/260 (33%), Gaps = 29/260 (11%)

Query: 10  NSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
            + P   +  + +  +++P+G+ EQHGP   + TD I A  +A      +         P
Sbjct: 6   MTWPEVEEYLQTNTGIIIPIGSTEQHGPTGLIGTDAICAEAIA----KGVGEATQTVVGP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
              +G ++ H    G+ +L  +  I+  L  + ++   G  +   +N HGGN   +    
Sbjct: 62  TINVGMALHHTAFPGSMSLRPSTLIQVILDYLTSLTAAGFTRYFFINGHGGNIATLKAAF 121

Query: 129 TEARMRFSML---------VVSTSWSRF-TIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           +E+    S L             +W     + Q        + G H    E ++   + P
Sbjct: 122 SESYYHLSHLNIPQATQVRAKVGNWFMCRAVYQKAKELYGDQEGSHATPSEVAVTQFVYP 181

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEG 237
             +K                    + +          +   P G +G N   AT + GE 
Sbjct: 182 ESIK-------------NASLSPDVNSGYPIYGASDFRSHYPDGRMGSNPALATPEHGEQ 228

Query: 238 LLSYFANCFIQLLNDINSFD 257
           L +       +        D
Sbjct: 229 LYNLAVKELSESYLKFAQAD 248


>gi|83595058|ref|YP_428810.1| creatininase [Rhodospirillum rubrum ATCC 11170]
 gi|83577972|gb|ABC24523.1| Creatininase [Rhodospirillum rubrum ATCC 11170]
          Length = 250

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/253 (23%), Positives = 99/253 (39%), Gaps = 19/253 (7%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M   +     +  +  +   D   ++PLG+ E HG HLP   D + A  LA  +   +  
Sbjct: 1   MEKTVQLEHMNTRVFVEGAYDT-ALIPLGSCESHGDHLPFAMDALTAHKLALGVAERMEK 59

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V  +P    G+S  + +   + +L+    I     I+D++    IR ++I+N H GN
Sbjct: 60  ---VFVLPPTFFGFSQHYWHKPMSISLSQDTNIRVIADILDSLAHWKIRNVLIINGHDGN 116

Query: 121 SPLVSIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALA 177
              + + +  AR+R   + +    +W             E   G  HGGE ETS+ LA  
Sbjct: 117 ISAIDVAARAARLRHPDMKIGSLDAWWVTAGNLLPKDTFEVWNGLGHGGEGETSIGLACF 176

Query: 178 PHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
           P LV M  A        E ++              W   +L   G  G    AT +KG+ 
Sbjct: 177 PELVDMAHARGMIPEVDENVKEL------------WDFSELTDYGATGAPEKATREKGQA 224

Query: 238 LLSYFANCFIQLL 250
           +     +  +  L
Sbjct: 225 MYDVLVDYLVAYL 237


>gi|37527772|ref|NP_931117.1| hypothetical protein plu3916 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787208|emb|CAE16288.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 256

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 51/257 (19%), Positives = 97/257 (37%), Gaps = 28/257 (10%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
             F + +      A +   ++ P+G  EQHGPHLP+N D++I    A     +L   +  
Sbjct: 14  REFAELTSEQVLTAVEGKTLIWPIGGIEQHGPHLPLNVDSVIPEAFA----RVLAEDING 69

Query: 65  TCMPVEPIG-----YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             +PV+P+       S   +   GT  L  +    +    I ++  +  +++VI+N H  
Sbjct: 70  FTLPVQPVSARSLPQSGGGLEFPGTVYLDGSTFTAYISRTIKSLCSLPFKQLVIINGHFE 129

Query: 120 NSPLVSIVSTEARMRF---SMLVVSTSWSRFTIPQGIIS---FPETEIGIHGGEIETSMM 173
           N   +       R         V+  SW                      H G  ETS+M
Sbjct: 130 NEGFIFEAVDALRAEGHFNDRSVIVFSWWSLVSDDWTREHLVDFPGWHAEHAGLTETSLM 189

Query: 174 LALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVK 233
           L L P LV+ +  ++    ++   +                 K+ + +GV+     ++ +
Sbjct: 190 LHLRPDLVRAERPDHDKPPRAGIYQVP-------------IKKEFSTRGVLSKTSGSSAE 236

Query: 234 KGEGLLSYFANCFIQLL 250
            GE +  +     ++L+
Sbjct: 237 IGELIFEHVRQQILELV 253


>gi|17231775|ref|NP_488323.1| hypothetical protein all4283 [Nostoc sp. PCC 7120]
 gi|17133418|dbj|BAB75982.1| all4283 [Nostoc sp. PCC 7120]
          Length = 249

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 47/250 (18%), Positives = 82/250 (32%), Gaps = 29/250 (11%)

Query: 11  SLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        +K   ++LP+G+ EQHGP   + TD I A  +A  +             P 
Sbjct: 7   TWQEVETYLQKSTGIILPIGSTEQHGPTGLIGTDAICAEAIAHGVGEATG----AIVAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  I      + ++ K G  K   +N HGGN   +    +
Sbjct: 63  INVGMALHHAAFPGTISLRPSTLILLVRDYVTSLAKAGFTKFYFINGHGGNIATLKAAFS 122

Query: 130 EARM---------RFSMLVVSTSWSRFTIP-QGIISFPETEIGIHGGEIETSMMLALAPH 179
           E  +            +     +W   +   Q        + G H    E ++   + P 
Sbjct: 123 ETYVYLEDLQIPSAHKVQCQVGNWFMCSSVYQLAKELYGDKEGSHATPSEVAVTQYVYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K       +    E  R  +   A          +   P G +G N   AT + G+  
Sbjct: 183 AIKQ------APLSPEVARGHRIYSAT-------DFRQHYPDGRMGSNPALATPEHGKQF 229

Query: 239 LSYFANCFIQ 248
                     
Sbjct: 230 YDLAVKELSN 239


>gi|254446852|ref|ZP_05060327.1| creatininase subfamily [Verrucomicrobiae bacterium DG1235]
 gi|198256277|gb|EDY80586.1| creatininase subfamily [Verrucomicrobiae bacterium DG1235]
          Length = 259

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 56/251 (22%), Positives = 91/251 (36%), Gaps = 18/251 (7%)

Query: 4   LIIFTDNSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
              + +++     D         +LP+GA EQHGP L +  D+++   L   +       
Sbjct: 6   SRQWENHTWEEIRDLVASGMDAAILPVGATEQHGPQLTLGMDSLLGRQLCSDV----SAT 61

Query: 62  LPVTCMPVEPIGYSIEHMY-VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             V  +P+ P G S+ H +   GT  L+    I     I D +   GIRK+ I+N+H  N
Sbjct: 62  TGVPTLPILPYGCSLGHSHRWPGTLALSPQTLISTITDIADWLHPAGIRKLFIVNSHVTN 121

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
              +       R ++  L ++   +    P+   +F       H    ETS++L L P  
Sbjct: 122 EAPLRCALELLRSKYDDLCIAIFNTGKLTPEIASAFSADAADWHANAAETSLVLHLEPAS 181

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
            + +               F +   H S             GV G    AT + GE L  
Sbjct: 182 TRPEKIPISDDPDRTTDCVFSHPVNHTSL-----------NGVTGKPSQATPEAGETLYQ 230

Query: 241 YFANCFIQLLN 251
                   L+ 
Sbjct: 231 ELHTTLSALIK 241


>gi|297155045|gb|ADI04757.1| hypothetical protein SBI_01636 [Streptomyces bingchenggensis BCW-1]
          Length = 249

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 69/240 (28%), Positives = 108/240 (45%), Gaps = 17/240 (7%)

Query: 11  SLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVE 70
           +      ARK  I VLP+G++EQHG  LP+ TDT+IA  +A+ I +       V  +P  
Sbjct: 18  TTDDVR-ARKAGIAVLPIGSFEQHGTFLPLVTDTVIACTIAQEIAA----TYAVHLLPPL 72

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
            I  S EH    GT +++ A        I +++R+ GI  ++++NAHGGN  L ++V   
Sbjct: 73  TISCSHEHETWPGTVSISAATLHAVVRDIAESLRRSGIDVLILVNAHGGNYVLRNVVQES 132

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
           A     M +   S    T   G      ++  +H GE+ETS++L   P LV+        
Sbjct: 133 ASTGTRMALFPGSADWDTARTGAGVQTSSQSDMHAGEVETSILLHAHPELVRP------- 185

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
                      +L     H     M      GV+G    AT +KG+ +L+   + F +  
Sbjct: 186 -----GYETSDFLAGDRRHLLTLGMAAYTESGVIGRPSLATAEKGKEILTALVDSFAEYF 240


>gi|108805822|ref|YP_645759.1| creatininase [Rubrobacter xylanophilus DSM 9941]
 gi|108767065|gb|ABG05947.1| Creatininase [Rubrobacter xylanophilus DSM 9941]
          Length = 264

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 52/257 (20%), Positives = 100/257 (38%), Gaps = 27/257 (10%)

Query: 4   LIIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
            +++ + + P   +        ++P GA EQHGPH+P+  D  ++  +A+ + +      
Sbjct: 21  PVLWEELTSPEIEELINRINAAIVPFGAVEQHGPHMPLCVDWNMSYHVAQGVSAATG--- 77

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            V  +     G S  H    GT +L     +     I++ +   G+R+ ++LN H  N  
Sbjct: 78  -VPVLHPVIYGVSASHGDFPGTISLRPETFLAVVEDIVNWLYHSGVRQFILLNGHAWNGA 136

Query: 123 LVSIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
            + + + + R R+  + V        +   +    +    +  H    ETS ML + P L
Sbjct: 137 PLQVCAEKIRTRYDDVRVRALDYVDMYPPSEIDGRYTYGRLLAHANYFETSCMLYVNPDL 196

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGE--- 236
           VKMD A +     S                + +    ++  GV G +  +A  + GE   
Sbjct: 197 VKMDRATSKQDFDSF---------------WDYRTDQVSISGVWGRDITEANAENGEREI 241

Query: 237 -GLLSYFANCFIQLLND 252
              +   A      +N+
Sbjct: 242 SRCIETMARAIAAAVNE 258


>gi|169235158|ref|YP_001688358.1| creatininase [Halobacterium salinarum R1]
 gi|167726224|emb|CAP13004.1| creatininase [Halobacterium salinarum R1]
          Length = 247

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 54/253 (21%), Positives = 90/253 (35%), Gaps = 14/253 (5%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   D +    AD     + VLP+G+ EQHGPH P+ TD I A  +A            V
Sbjct: 1   MRLADATWTD-ADGVDTDLAVLPVGSTEQHGPHAPLGTDHITAHAVAAAGADAYSDG-EV 58

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P   +G S EH    GT  +           ++ ++   G  ++V++N HGGN+  +
Sbjct: 59  IVAPPITVGVSAEHRQFTGTLWVAPDTFRATVRDVVGSLASHGWDRVVVVNGHGGNTAAL 118

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             V      +     V  +W              +    H G +ET+ +    P L++ D
Sbjct: 119 GEVCATITRQDDAYAVPFTWFDAVG-------DHSSDMGHAGPLETAFLRHTDPELIRED 171

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             +  +   ++        +     +           GVVG+       +G  LL     
Sbjct: 172 RVQAAAEDGADAWG-----KWVSHANLAADAAAFTDNGVVGDPRAGDADRGAALLDAATE 226

Query: 245 CFIQLLNDINSFD 257
               LL  +   D
Sbjct: 227 SLCALLAAVADRD 239


>gi|289582279|ref|YP_003480745.1| creatininase [Natrialba magadii ATCC 43099]
 gi|289531832|gb|ADD06183.1| Creatininase [Natrialba magadii ATCC 43099]
          Length = 254

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 58/235 (24%), Positives = 100/235 (42%), Gaps = 11/235 (4%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           V+P G+ EQHGP LP+  D + A    +        R     +P  P+G S+ H   DGT
Sbjct: 23  VVPTGSTEQHGPALPLGMDHMAA----QAFARSAADREDTVVLPTIPVGVSVHHRQFDGT 78

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSW 144
             ++     ++    I ++ + G+RK V++N HGGNS  +   +   R   +      +W
Sbjct: 79  LYVSAETFEQYVEETIASLAEHGVRKAVVVNGHGGNSGALRRAARTLRDEETAFAPPWNW 138

Query: 145 SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLR 204
                 + + +    E G H   +E+S++  +   LV+ D  E   +  SE      +  
Sbjct: 139 W--DSVEDVAADLFDEDGGHADAMESSLLWHIRDDLVQPDELEAAEAGASESWGESVH-- 194

Query: 205 AHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
                + G+   D +  G VG    A  +KGE L    A+    LL+ + +  + 
Sbjct: 195 ---GAALGFDTIDFSESGAVGRPTQADPEKGEALFEAGADQLDALLDWLAAQPLE 246


>gi|21225833|ref|NP_631612.1| hypothetical protein SCO7569 [Streptomyces coelicolor A3(2)]
 gi|11228466|emb|CAC16449.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)]
          Length = 263

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 59/263 (22%), Positives = 103/263 (39%), Gaps = 18/263 (6%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP-- 63
             T+ +      A +  I +LP+G+ EQH  HLPM TDT++   + +R   +L    P  
Sbjct: 5   RLTELTWREVRRAGERGIALLPIGSQEQHAGHLPMGTDTLLVEEVVDRALDLLDREAPGA 64

Query: 64  ----------VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVI 113
                     +  +P  P G+S  H+      +L+ A        ++D++   G  +I++
Sbjct: 65  SEGTGAPVPEIVRLPALPFGHSPHHL-FAAAVSLSAATLGAVLDDVLDSLVTSGYHRIMV 123

Query: 114 LNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMM 173
           +N HGGN  ++ +      +R  + V + S+   T        P+   G H G  ETS+M
Sbjct: 124 VNGHGGNDEIMRLAVKRFALRARVTVAACSYWTLTAGGDDAGRPDVTPG-HAGWFETSLM 182

Query: 174 LALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVK 233
           LA  P LV+  +                +          W   D +      +A  A   
Sbjct: 183 LAAHPGLVRTPVPARTPVEPPPLFDRPPHPGLTVERHGEWERVDGSTD----DASGADAD 238

Query: 234 KGEGLLSYFANCFIQLLNDINSF 256
           +G  LL   A    + +   ++ 
Sbjct: 239 RGGRLLDDRARGLARAIRAFDAA 261


>gi|302348427|ref|YP_003816065.1| Creatininase [Acidilobus saccharovorans 345-15]
 gi|302328839|gb|ADL19034.1| Creatininase [Acidilobus saccharovorans 345-15]
          Length = 264

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 65/248 (26%), Positives = 104/248 (41%), Gaps = 16/248 (6%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           D+    I V+P+G+ E+HG HLP+ TD I AA +A+R+   L   L     P    G S 
Sbjct: 13  DSSPRSIAVIPIGSVERHGDHLPLGTDAIEAAWVAQRVADALGADL----FPTIWYGVSP 68

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
                 GT  +     I +  +++  I + G R IVI+N HGGN+  + +   +A     
Sbjct: 69  ALARFPGTINVETDAFIAYVRSVLKEIARNGYRLIVIINGHGGNTTAIRVAMKDAAYSTG 128

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE- 195
              V   W R    + +     +    H GE ETS ML +    V M  A  + S  S  
Sbjct: 129 ATFVMFDWWRDAGREALRQLFTSP--GHAGEDETSAMLYIDGAHVDMSAARAYPSGWSPS 186

Query: 196 ---FLRNFKYLRAHGSHSFGWSMK------DLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                R+ K +R    +  G +++       L P  V+G+   A+  +G   L    +  
Sbjct: 187 SEGEARDLKSMRNSMIYVQGVAVESQAVDQALYPYAVLGDPTKASADRGAKWLEAVVSEI 246

Query: 247 IQLLNDIN 254
           +  +  + 
Sbjct: 247 VDRVRGLA 254


>gi|282856530|ref|ZP_06265805.1| creatininase [Pyramidobacter piscolens W5455]
 gi|282585651|gb|EFB90944.1| creatininase [Pyramidobacter piscolens W5455]
          Length = 261

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 51/264 (19%), Positives = 87/264 (32%), Gaps = 18/264 (6%)

Query: 5   IIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     +     +A  D +  ++PLG+ EQHG   P+ TD  I   +A R+++  P RL 
Sbjct: 1   MYLASMTWHEFHEATSDDLLALVPLGSTEQHGSIGPLGTDFAIPEEMARRLEAQYPDRL- 59

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
              +P  P G    H    GT  +  A       ++ + +   G+R+   LN HGGN P 
Sbjct: 60  -VVLPTMPYGVCPYHTEFSGTIDIGTAALQSVMTSVAEHLMNAGVRRFAFLNGHGGNDPA 118

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +         R  +  +   W+                       E  +M+AL P  V+ 
Sbjct: 119 LEAACLGIYERGGLGAILDWWTIARELDPRWGGGHGGG------QEAVVMMALRPDWVRK 172

Query: 184 DL---AENFSSRQSEFLRNFKYLRA--HGSHSFGWSMKDLNPKGVVG---NA-MDATVKK 234
           +     E   S   E    +    A    +     S       G  G   ++   A    
Sbjct: 173 EKNFVPEEIRSLTPELKSAYGNAIAFKGATVKIIRSTDAFTKTGTFGGGDDSCAKADAAW 232

Query: 235 GEGLLSYFANCFIQLLNDINSFDV 258
           G  +           + +     +
Sbjct: 233 GREIFEGTVRYLGDFVEEFLKAPL 256


>gi|189438877|ref|YP_001953958.1| amidase-like protein [Bifidobacterium longum DJO10A]
 gi|189427312|gb|ACD97460.1| Amidase-like protein [Bifidobacterium longum DJO10A]
          Length = 252

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 53/264 (20%), Positives = 93/264 (35%), Gaps = 28/264 (10%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M         + P   +A+    V++P+G+ EQHG HLP+ TD ++A  +AE +      
Sbjct: 1   MGSNRRMDHMTWPEFKEAKTRP-VIVPIGSTEQHGQHLPIGTDAVLATRVAEDLAER--- 56

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
            +  T +P    GY     S       GT  +     I     ++  +   G  KIV++N
Sbjct: 57  -IDGTVLPTLSYGYKSKPLSGGGPLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMN 115

Query: 116 AHGGNSPLVSIVSTEARMRFSMLV--VSTSWSRFTIPQGIISFPE-----TEIGIHGGEI 168
           AH  N   +             +   V T+W        I    +          H    
Sbjct: 116 AHFENEAFIVEAIDLVTRETGGVATIVETNWWDPVPQSVIDKVFDGLVFPGWALEHAAVT 175

Query: 169 ETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM 228
           ETS+ML  AP LV MD     +   ++    +   +                 G + N  
Sbjct: 176 ETSLMLHYAPELVHMDRMVEEAGATAKSYVRYPVRQGDVPA-----------HGGLANPA 224

Query: 229 DATVKKGEGLLSYFANCFIQLLND 252
            ++ ++G  +     +   ++  +
Sbjct: 225 GSSAERGRLIAEACVDAVAKICAE 248


>gi|238926578|ref|ZP_04658338.1| creatininase [Selenomonas flueggei ATCC 43531]
 gi|238885524|gb|EEQ49162.1| creatininase [Selenomonas flueggei ATCC 43531]
          Length = 251

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 57/254 (22%), Positives = 95/254 (37%), Gaps = 18/254 (7%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
               +     +       VL +GA E HG HL    DTI++  L + I   L     +  
Sbjct: 5   LWRMTAHQVKEGHFKK-AVLAVGACEAHGQHLAEGCDTIVSYKLGKAIADELGD---MLV 60

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126
           +P  P+GYS  +     T TL Y    +    I++++ + GI  I+I+N H GN   + +
Sbjct: 61  LPPIPVGYSGHYDSFPFTLTLQYDTVTQVIYDIVESVLRNGIDTILIINGHDGNIAPIEV 120

Query: 127 VSTEARMRFSM--LVVSTSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKM 183
            S + + ++    +     W             E   G  H GE ETS+   L P   + 
Sbjct: 121 ASRKIKEKYPGARIAALDQWWVTAGELLPKGTFEVWNGLGHAGEGETSIAYYLFPEWCEP 180

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           + A     +    L   K           W   +L      G+A   T +KGE +     
Sbjct: 181 EQATCRVPKNLPELMGIK-----------WDFSELTNTAQTGDATKGTAEKGEKMFKVLI 229

Query: 244 NCFIQLLNDINSFD 257
               + +  +++ D
Sbjct: 230 EYCTKTIKALDAVD 243


>gi|322689664|ref|YP_004209398.1| creatininase [Bifidobacterium longum subsp. infantis 157F]
 gi|320461000|dbj|BAJ71620.1| creatininase [Bifidobacterium longum subsp. infantis 157F]
          Length = 252

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 53/264 (20%), Positives = 93/264 (35%), Gaps = 28/264 (10%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M         + P   +A+    V++P+G+ EQHG HLP+ TD ++A  +AE +      
Sbjct: 1   MGSNRRMDHMTWPEFKEAKTRP-VIVPIGSTEQHGQHLPIGTDAVLATRVAEDLAER--- 56

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
            +  T +P    GY     S       GT  +     I     ++  +   G  KIV++N
Sbjct: 57  -IDGTVLPTLSYGYKSKPLSGGGPLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMN 115

Query: 116 AHGGNSPLVSIVSTEARMRFSMLV--VSTSWSRFTIPQGIISFPE-----TEIGIHGGEI 168
           AH  N   +             +   V T+W        I    +          H    
Sbjct: 116 AHFENEAFIVEAIDLVTRETGGVATIVETNWWDPVPQSVIDKVFDGLVFPGWALEHAAVT 175

Query: 169 ETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM 228
           ETS+ML  AP LV MD     +   ++    +   +                 G + N  
Sbjct: 176 ETSLMLHYAPELVHMDRMVEEAGATAKSYVRYPVRQGDVPA-----------HGGLANPA 224

Query: 229 DATVKKGEGLLSYFANCFIQLLND 252
            ++ ++G  +     +   ++  +
Sbjct: 225 GSSAERGRLIAEACVDAVAEICAE 248


>gi|289767011|ref|ZP_06526389.1| creatinine amidohydrolase [Streptomyces lividans TK24]
 gi|289697210|gb|EFD64639.1| creatinine amidohydrolase [Streptomyces lividans TK24]
          Length = 272

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 59/263 (22%), Positives = 103/263 (39%), Gaps = 18/263 (6%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP-- 63
             T+ +      A +  I +LP+G+ EQH  HLPM TDT++   + +R   +L    P  
Sbjct: 14  RLTELTWREVRRAGERGIALLPIGSQEQHAGHLPMGTDTLLVEEVVDRALDLLDREAPEA 73

Query: 64  ----------VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVI 113
                     +  +P  P G+S  H+      +L+ A        ++D++   G  +I++
Sbjct: 74  SEGSGAPVPEIVRLPALPFGHSPHHL-FAAAVSLSAATLGAVLDDVLDSLVTSGYHRIMV 132

Query: 114 LNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMM 173
           +N HGGN  ++ +      +R  + V + S+   T        P+   G H G  ETS+M
Sbjct: 133 VNGHGGNDEIMRLAVKRFALRARVTVAACSYWTLTAGGDDAGRPDVTPG-HAGWFETSLM 191

Query: 174 LALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVK 233
           LA  P LV+  +                +          W   D +      +A  A   
Sbjct: 192 LAAHPGLVRTPVPARTPVEPPPLFDRPPHPGLTVERHGEWERVDGSTD----DASGADAD 247

Query: 234 KGEGLLSYFANCFIQLLNDINSF 256
           +G  LL   A    + +   ++ 
Sbjct: 248 RGGRLLDDRARGLTRAIRAFDAA 270


>gi|322691625|ref|YP_004221195.1| creatininase [Bifidobacterium longum subsp. longum JCM 1217]
 gi|320456481|dbj|BAJ67103.1| creatininase [Bifidobacterium longum subsp. longum JCM 1217]
          Length = 252

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 53/264 (20%), Positives = 93/264 (35%), Gaps = 28/264 (10%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M         + P   +A+    V++P+G+ EQHG HLP+ TD ++A  +AE +      
Sbjct: 1   MGSNRRMDHMTWPEFKEAKTRP-VIVPIGSTEQHGQHLPIGTDAVLATRVAEDLAER--- 56

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
            +  T +P    GY     S       GT  +     I     ++  +   G  KIV++N
Sbjct: 57  -IDGTVLPTLSYGYKSKPLSGGGPLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMN 115

Query: 116 AHGGNSPLVSIVSTEARMRFSMLV--VSTSWSRFTIPQGIISFPE-----TEIGIHGGEI 168
           AH  N   +             +   V T+W        I    +          H    
Sbjct: 116 AHFENEAFIVEAIDLVIRETGGVATIVETNWWDPVPQSVIDKVFDGLVFPGWALEHAAVT 175

Query: 169 ETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM 228
           ETS+ML  AP LV MD     +   ++    +   +                 G + N  
Sbjct: 176 ETSLMLHYAPELVHMDRMVEEAGATAKSYVRYPVRQGDVPA-----------HGGLANPA 224

Query: 229 DATVKKGEGLLSYFANCFIQLLND 252
            ++ ++G  +     +   ++  +
Sbjct: 225 GSSAERGRLIAEACVDAVAEICAE 248


>gi|53713101|ref|YP_099093.1| putative amidase [Bacteroides fragilis YCH46]
 gi|60681368|ref|YP_211512.1| hypothetical protein BF1877 [Bacteroides fragilis NCTC 9343]
 gi|52215966|dbj|BAD48559.1| putative amidase [Bacteroides fragilis YCH46]
 gi|60492802|emb|CAH07576.1| conserved hypothetical protein [Bacteroides fragilis NCTC 9343]
          Length = 253

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 62/246 (25%), Positives = 98/246 (39%), Gaps = 14/246 (5%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV--TCMPVEPIG- 73
              K  +++LP GA E H  HLP  TD I+   +A     +   R  V    MP  P G 
Sbjct: 16  KELKYDVIILPWGATEPHNLHLPYLTDCILPHDIAVEAAELALSRSGVRCMVMPPVPFGA 75

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           ++     +       YA        I+ ++   G RK++IL+ HGGN+     +  +   
Sbjct: 76  HNPGQRELPFCIHTRYATQQAILEDIVSSLHVQGFRKLLILSGHGGNN--FKGMIRDLAF 133

Query: 134 RFSML-VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            +    + + +W     P+G     E EI  H GE ETS+M+   P LV +  A +  S+
Sbjct: 134 EYPDFLIAAANWFEVVSPKGYF---EAEIDDHAGESETSVMMHYHPELVNLAEAGDGESK 190

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
                   + +         W    +   GV GN   AT +KGE  +         L  +
Sbjct: 191 PFAIASLNEKVAW---VPRHWDKATV-DSGV-GNPKKATAEKGERYVKPIVEKLAGLFEE 245

Query: 253 INSFDV 258
           +   D+
Sbjct: 246 MAQHDL 251


>gi|126658416|ref|ZP_01729565.1| Creatininase [Cyanothece sp. CCY0110]
 gi|126620348|gb|EAZ91068.1| Creatininase [Cyanothece sp. CCY0110]
          Length = 243

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 44/251 (17%), Positives = 81/251 (32%), Gaps = 29/251 (11%)

Query: 10  NSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
            + P   D  K    +++P+G+ EQHGP   + TD I A  +A      +  +      P
Sbjct: 1   MTWPEVEDYLKTNTGMIIPIGSTEQHGPTGLIGTDAICAEAIA----KGVGEQTQTIVGP 56

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
              +G ++ H    G+ +L  +  I+  L  +  + + G      +N HGGN   +    
Sbjct: 57  TINVGMALHHTAFPGSMSLRPSTLIQVILDYLTYLTQAGFTHYFFINGHGGNISPLKAAF 116

Query: 129 TEARMRF---------SMLVVSTSWSRFTIP-QGIISFPETEIGIHGGEIETSMMLALAP 178
           +E               +     +W       Q        + G H    E ++   + P
Sbjct: 117 SETYTHLSSLNIPQSDRVRAKVGNWFMCRSVYQKAKELYGDQEGSHATPSEVAVTQFVYP 176

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEG 237
             +K                    + +          +   P G +G N   AT + G+ 
Sbjct: 177 DSIK-------------KADLSPDVASGYPIYGAADFRAHYPDGRMGSNPALATPEHGQQ 223

Query: 238 LLSYFANCFIQ 248
           L         +
Sbjct: 224 LYELAVKELSE 234


>gi|117165069|emb|CAJ88622.1| putative creatinase [Streptomyces ambofaciens ATCC 23877]
          Length = 273

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 58/257 (22%), Positives = 109/257 (42%), Gaps = 27/257 (10%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
             + D + P    A +   +V P+G  EQHGPHLP++ D  I   LA ++ + +      
Sbjct: 9   PRYGDLTSPEVPRALRGATLVWPVGGLEQHGPHLPLSVDMDIPEALARQVAAEVG----G 64

Query: 65  TCMPVEPIG-----YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             +P +P+       S   ++  GT  L  A  + +    + A+ ++G+ ++V++N H  
Sbjct: 65  LLLPGQPVSARSLPQSGGGLHFPGTVHLGGATFLAYLTDCLTALSRLGLGRLVVINGHYE 124

Query: 120 NSPLVSIVSTEA---RMRFSMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMM 173
           N  L+           +     VV+ SW        +        G    H G  ETS+M
Sbjct: 125 NEGLLFEAIDGCAPGTVFPDTEVVAFSWWSLVTEDWLGEHIPRFPGWHAEHAGLTETSLM 184

Query: 174 LALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVK 233
           + L P +V+ +   + S   +   R+   +              ++ +GV+ +A  A+V+
Sbjct: 185 MYLRPEVVRAERPSHASPPPAGVYRHPVDVGK------------ISNQGVLSSATGASVE 232

Query: 234 KGEGLLSYFANCFIQLL 250
            GE L  +  +  ++LL
Sbjct: 233 LGERLFWHLVDGIVELL 249


>gi|229494534|ref|ZP_04388297.1| creatinine amidohydrolase [Rhodococcus erythropolis SK121]
 gi|229318896|gb|EEN84754.1| creatinine amidohydrolase [Rhodococcus erythropolis SK121]
          Length = 250

 Score =  169 bits (427), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 62/250 (24%), Positives = 105/250 (42%), Gaps = 19/250 (7%)

Query: 10  NSLPLCADARKDWI--VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
            +     +A  D I  V+  +GA EQHGPHLP++TDT+I    +  + + +   +     
Sbjct: 1   MTWTQMQEAMNDGIRNVIFAVGATEQHGPHLPLSTDTLIGTATSLAVATRIGATM---VA 57

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P    G S  HM   GT +L  A  ++     + ++   G   I+++++HGGN   ++ +
Sbjct: 58  PTIAFGVSPHHMSFPGTVSLREATFLDVVEDYVRSLAAHGFDNILVISSHGGNFEPLAHL 117

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETE------IGIHGGEIETSMMLALAPHLV 181
                 R     +        +     +  E +       G H G+ ETS++LAL P LV
Sbjct: 118 IERVGPRIGETRIHAHTDLLQLLAAFEAVAEEDSISPEACGSHAGDFETSIVLALRPDLV 177

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
            M+ AE        FL  F   +   +  F    K L+  G++G+ + A   +GE  L  
Sbjct: 178 DMNAAEPG------FLGRFD--KDTATALFDGGTKALSVNGILGDPVAALASRGERYLES 229

Query: 242 FANCFIQLLN 251
                 +   
Sbjct: 230 LTTVVSEYFR 239


>gi|237737784|ref|ZP_04568265.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
 gi|229419664|gb|EEO34711.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
          Length = 239

 Score =  169 bits (427), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 54/246 (21%), Positives = 98/246 (39%), Gaps = 16/246 (6%)

Query: 15  CADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY 74
               +K+ I ++ +G+ E HG   P+ TD II   +       L  R  +  +P  P G 
Sbjct: 1   MELIKKEPIAMIAIGSVEYHGAQAPLGTDYIIPDYIVNE----LSMREDILALPPIPYGN 56

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
                   GT  +     I    +I+D++ K GI+K + +N HGGN   +  V  +   +
Sbjct: 57  CQSIKDFPGTINIGTENLIRVMNSIVDSLLKHGIKKFIFVNGHGGNIAALDQVGLDTYEK 116

Query: 135 FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
             ++     W    + + +    +   G HG   ETS+ +A+    V +   E       
Sbjct: 117 GGLIATIDWW---NLAKLLNPDYD---GGHGDIQETSVAMAVDEKSVNLAYCEPLQINDL 170

Query: 195 EFLRNFKYLR----AHGSHSFGWSMKDLNPKGVVG--NAMDATVKKGEGLLSYFANCFIQ 248
                 KY+      +G+     S KD+   G +G  +  ++T + GE +L        +
Sbjct: 171 SDKITNKYISLLNYKNGNVKIVRSFKDVVSNGWIGPYDPKNSTKELGERILKDVIQYINE 230

Query: 249 LLNDIN 254
            ++D  
Sbjct: 231 FIDDFK 236


>gi|119383770|ref|YP_914826.1| creatininase [Paracoccus denitrificans PD1222]
 gi|119373537|gb|ABL69130.1| Creatininase [Paracoccus denitrificans PD1222]
          Length = 263

 Score =  169 bits (427), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 64/269 (23%), Positives = 101/269 (37%), Gaps = 33/269 (12%)

Query: 1   MNP-LIIFTDNSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           M        + + P    A KD    +++P+G+ EQHG H+P++ D ++    A R+   
Sbjct: 1   MPQKSPFAAELAWPDYDAAVKDGATPILIPVGSMEQHGHHMPLHVDVLLPTEFARRVAL- 59

Query: 58  LPPRLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIV 112
                     P    GY     S    ++ GT +L  A  +     +I    + G+R+I 
Sbjct: 60  ---ETGGLVAPPFTYGYKSHQKSGGGNHLPGTTSLDGATLVSALRDVIKEFARHGVRRIC 116

Query: 113 ILNAHGGNSPL----VSIVSTEARMRF--SMLVVSTSWSRFTIPQGIISFPETEIGI--- 163
           ++N H  NS      + +   E R      M +V  S+  F     I             
Sbjct: 117 MVNGHYENSWFIIEGIDLALRELRWDGITGMKIVVLSYWDFVGEADISRLYPDGFPGWEL 176

Query: 164 -HGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKG 222
            HGGE+ETS+MLAL P LV +  A +    Q      +                     G
Sbjct: 177 EHGGELETSLMLALYPTLVDLSRAVDVEPAQFPPYDVYPAKPEWTPA-----------SG 225

Query: 223 VVGNAMDATVKKGEGLLSYFANCFIQLLN 251
            + +  DA+ +KGE LL       +  L 
Sbjct: 226 TLSSPKDASAEKGELLLEVCTKGIVAALR 254


>gi|253566771|ref|ZP_04844223.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|251944334|gb|EES84823.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|301162824|emb|CBW22371.1| conserved hypothetical protein [Bacteroides fragilis 638R]
          Length = 253

 Score =  169 bits (427), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 63/246 (25%), Positives = 100/246 (40%), Gaps = 14/246 (5%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV--TCMPVEPIG- 73
              K  +++LP GA E H  HLP  TD I+   +A     +   R  V    MP  P G 
Sbjct: 16  KELKYDVIILPWGATEPHNLHLPYLTDCILPHDIAVEAAELALSRSGVRCMVMPPVPFGA 75

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           ++     +       YA        I+ ++   G RK++IL+ HGGN+     +  +   
Sbjct: 76  HNPGQRELPFCIHTRYATQQAILEDIVSSLHVQGFRKLLILSGHGGNN--FKGMIRDLAF 133

Query: 134 RFSML-VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            +    + + +W     P+G     E EI  H GE ETS+M+   P LV +  A +  S+
Sbjct: 134 EYPDFLIAAANWFEVVSPKGYF---EAEIDDHAGESETSVMMHYHPELVNLAEAGDGESK 190

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
                   + + A     +  +  D    GV GN   AT +KGE  +         L  +
Sbjct: 191 PFAIASLNEKV-AWAPRHWDKATVD---SGV-GNPKKATAEKGERYVKPIVEKLAGLFEE 245

Query: 253 INSFDV 258
           +   D+
Sbjct: 246 MAQHDL 251


>gi|153806238|ref|ZP_01958906.1| hypothetical protein BACCAC_00493 [Bacteroides caccae ATCC 43185]
 gi|149130915|gb|EDM22121.1| hypothetical protein BACCAC_00493 [Bacteroides caccae ATCC 43185]
          Length = 251

 Score =  169 bits (427), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 62/244 (25%), Positives = 105/244 (43%), Gaps = 16/244 (6%)

Query: 14  LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIG 73
              D R D +  LP GA E H  HLP  TD I++  +A     I   +  V CM + PIG
Sbjct: 14  EVKDGRYDIVA-LPWGATEPHNLHLPYMTDCILSHDVAVSAALIAKQKYGVNCMVMPPIG 72

Query: 74  YS---IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
                     +       Y         I+ ++   GIRK+VI+N HGGN      +  +
Sbjct: 73  MGSQNPGQRELPFCIHTRYETQKAILTDIVSSLYVQGIRKLVIINGHGGN--TFKSMIRD 130

Query: 131 ARMRFSMLVVSTS-WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENF 189
             + +   ++++S W      +     P    G H  E+ETS+M+   P LV ++ A + 
Sbjct: 131 LSVDYPDFLIASSEWYTVLKVKDYFENP----GDHADEVETSVMMHYHPELVNLEEAGSG 186

Query: 190 SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
              ++  +++     A    ++G   KD    GV G+   A+ +KG+      A  + +L
Sbjct: 187 -EYKTFAVQSLNEKVAWIPRNWGKVSKD---TGV-GDPRGASAEKGKKFAEAVAEKYARL 241

Query: 250 LNDI 253
            +++
Sbjct: 242 FDEL 245


>gi|265763194|ref|ZP_06091762.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|263255802|gb|EEZ27148.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
          Length = 253

 Score =  168 bits (426), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 64/246 (26%), Positives = 101/246 (41%), Gaps = 14/246 (5%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM--PVEPIG- 73
              K  +++LP GA E H  HLP  TD I+   +A     +   R  V CM  P  P G 
Sbjct: 16  KELKYDVIILPWGATEPHNLHLPYLTDCILPHDIAVEAAELALSRSGVRCMVIPPVPFGA 75

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           ++     +       YA        I+ ++   G RK++IL+ HGGN+     +  +   
Sbjct: 76  HNPGQRELPFCIHTRYATQQAILEDIVSSLHVQGFRKLLILSGHGGNN--FKGMIRDLAF 133

Query: 134 RFSML-VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            +    + + +W     P+G     E EI  H GE ETS+M+   P LV +  A +  S+
Sbjct: 134 EYPDFLIAAANWFEVVSPKGYF---EAEIDDHAGESETSVMMHYHPELVNLAEAGDGESK 190

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
                   + + A     +  +  D    GV GN   AT +KGE  +         L  +
Sbjct: 191 PFAIASLNEKV-AWAPRHWDKATVD---SGV-GNPKKATAEKGERYVKPIVEKLAGLFEE 245

Query: 253 INSFDV 258
           +   D+
Sbjct: 246 MAQHDL 251


>gi|77458487|ref|YP_347992.1| creatininase [Pseudomonas fluorescens Pf0-1]
 gi|77382490|gb|ABA74003.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 249

 Score =  168 bits (426), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 50/258 (19%), Positives = 87/258 (33%), Gaps = 27/258 (10%)

Query: 11  SLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +    A   +    +V+P+G+ EQHGP   + TD +    +A   +        +   P 
Sbjct: 7   TWSEIAQFLERSRTIVIPIGSNEQHGPTGLLGTDWMCPEIIAHEAQKSAD----ILIAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             IG +  H+   GT +L  +  I        ++   G  KI  LN HGGN   +    +
Sbjct: 63  FNIGMAQHHLGFPGTISLRPSTFIAAIADWTRSLAAHGFEKIFFLNGHGGNIASIEAAFS 122

Query: 130 EARMRFS--------MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           E     S         L +   W    + +       T  GIH    E ++     P  +
Sbjct: 123 ELYAEASFARRKAGFALKLCNWWDLEGVNELAREQFPTGHGIHATPSEIAVTQWAYPDSI 182

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
           K                    +   G        +  +P G +G +   A+ +KG  L+ 
Sbjct: 183 K-------------SADYSPQIANWGPIREAADFRARHPDGRMGSDPAQASPEKGRQLVE 229

Query: 241 YFANCFIQLLNDINSFDV 258
             A   +Q +   +   +
Sbjct: 230 MAARGLVQEVQAFSRESL 247


>gi|256783129|ref|ZP_05521560.1| hypothetical protein SlivT_01420 [Streptomyces lividans TK24]
          Length = 263

 Score =  168 bits (426), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 59/263 (22%), Positives = 103/263 (39%), Gaps = 18/263 (6%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP-- 63
             T+ +      A +  I +LP+G+ EQH  HLPM TDT++   + +R   +L    P  
Sbjct: 5   RLTELTWREVRRAGERGIALLPIGSQEQHAGHLPMGTDTLLVEEVVDRALDLLDREAPEA 64

Query: 64  ----------VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVI 113
                     +  +P  P G+S  H+      +L+ A        ++D++   G  +I++
Sbjct: 65  SEGSGAPVPEIVRLPALPFGHSPHHL-FAAAVSLSAATLGAVLDDVLDSLVTSGYHRIMV 123

Query: 114 LNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMM 173
           +N HGGN  ++ +      +R  + V + S+   T        P+   G H G  ETS+M
Sbjct: 124 VNGHGGNDEIMRLAVKRFALRARVTVAACSYWTLTAGGDDAGRPDVTPG-HAGWFETSLM 182

Query: 174 LALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVK 233
           LA  P LV+  +                +          W   D +      +A  A   
Sbjct: 183 LAAHPGLVRTPVPARTPVEPPPLFDRPPHPGLTVERHGEWERVDGSTD----DASGADAD 238

Query: 234 KGEGLLSYFANCFIQLLNDINSF 256
           +G  LL   A    + +   ++ 
Sbjct: 239 RGGRLLDDRARGLTRAIRAFDAA 261


>gi|302546633|ref|ZP_07298975.1| putative creatinine amidohydrolase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302464251|gb|EFL27344.1| putative creatinine amidohydrolase [Streptomyces himastatinicus
           ATCC 53653]
          Length = 261

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 102/240 (42%), Gaps = 17/240 (7%)

Query: 11  SLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVE 70
           +           + VLP+G++EQHG +LP+ TDT+IA  +A  I +  P    V  +P  
Sbjct: 19  TTEEVRALGAG-VAVLPIGSFEQHGAYLPLVTDTVIACTIAREIAAAYP----VQLLPPV 73

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
            +  S EH    GT +++ A        I  ++R+ G+  ++++N HGGN  L +IV   
Sbjct: 74  TVSCSHEHADWPGTVSISAATLYSVVRDIAGSLRRSGVGSLILVNGHGGNYVLRNIVQES 133

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
           A     M +   S    T          +   +HGGE+ETS++L   P LV+        
Sbjct: 134 AGTGTRMALFPGSADWDTARTRAGVQTPSYSDMHGGEVETSILLHAHPELVRP------- 186

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
                       L     H     M +    GV+G    A+  KG+ LL+     F + L
Sbjct: 187 -----GYETSDCLADDRKHLLTLGMAEYTESGVIGRPSLASAAKGKELLAALTESFAEYL 241


>gi|33239716|ref|NP_874658.1| amidase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
 gi|33237241|gb|AAP99310.1| Predicted amidase [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
          Length = 266

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 52/266 (19%), Positives = 90/266 (33%), Gaps = 29/266 (10%)

Query: 2   NPLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           N  +     +         +   ++LP+G+ EQHGP   + TD + A  +A  +      
Sbjct: 16  NSSMRLDLWTWKEVEKYLVNCKGIILPIGSTEQHGPTGAIGTDAMTAEAVAREV----GI 71

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           R  V   P +P G +  H+   GT +L  +   +    ++ ++   G ++I I+N HGGN
Sbjct: 72  RTGVLVTPTQPYGMAEHHLGFPGTMSLRSSTLQKLIHDLLISLVMHGFQRIFIINGHGGN 131

Query: 121 SPLVSIVSTEAR----MRF-----SMLVVSTSWSRFTIP-QGIISFPETEIGIHGGEIET 170
              +    +E       R      S+     +W       +   +      G H    E 
Sbjct: 132 IASIKAAFSEVYNTASSRHLPVAKSLRFKLANWFMSPEVFRQARALYGEREGQHATPSEI 191

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ L L P L+                         G        +   P G +G +   
Sbjct: 192 ALTLHLEPSLL-------------AKQSELPDPAPAGPIYTYKDFRQRYPDGRMGSDPFL 238

Query: 230 ATVKKGEGLLSYFANCFIQLLNDINS 255
           A  + GE  L   A+     L D   
Sbjct: 239 AKAEDGEMFLDKAASALSNDLIDFLK 264


>gi|253998660|ref|YP_003050723.1| Creatininase [Methylovorus sp. SIP3-4]
 gi|253985339|gb|ACT50196.1| Creatininase [Methylovorus sp. SIP3-4]
          Length = 256

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 55/251 (21%), Positives = 95/251 (37%), Gaps = 18/251 (7%)

Query: 4   LIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
            + +++ +        A      +LP+GA EQHGPH+    D I+A  L   +       
Sbjct: 2   TMQWSETTWDELPAKLAAASGTAMLPIGATEQHGPHMGCGMDYILADILCREVAESTG-- 59

Query: 62  LPVTCMPVEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             V  +P  P G S+ H     GT  L+    I     I D     G+R++ I+N+H  N
Sbjct: 60  --VPMLPTMPYGCSVGHSRRWPGTIALSPITLINLVKEIGDWAYHSGVRRLFIINSHVTN 117

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           +  +       R     ++V+   +    P+            H  + ETS+ML  APH+
Sbjct: 118 AAPLRCALEMLRSEHDDMMVAVINTATMSPRVKQFHHADGDDWHANDAETSLMLEKAPHI 177

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+ D         ++       L       F   +   +  GV G    ++ +KG    +
Sbjct: 178 VRTDKL-----TLADDPDRTDDLV------FAHPVNRTSLNGVTGQPSISSAEKGAEWFA 226

Query: 241 YFANCFIQLLN 251
           +      +L+ 
Sbjct: 227 WMVEDLSELIR 237


>gi|113867739|ref|YP_726228.1| creatinine amidohydrolase [Ralstonia eutropha H16]
 gi|113526515|emb|CAJ92860.1| creatinine amidohydrolase [Ralstonia eutropha H16]
          Length = 249

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 51/258 (19%), Positives = 85/258 (32%), Gaps = 27/258 (10%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        ++   +V+P+G+ EQHGP   + TD +    +A   +        +   P 
Sbjct: 7   TWSEIEQFLKRSRTIVVPIGSNEQHGPTGLLGTDWLCPEIIARESEKSAD----ILVAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             IG +  H+   GT +L  +  I        ++   G  KI+ LN HGGN   +    +
Sbjct: 63  FNIGMAQHHLGFPGTISLRPSTFIAAIGDWTRSLVVHGFEKILFLNGHGGNVSSIDAAFS 122

Query: 130 EARMRFS--------MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           E     S         L V   W    + +       T  G H    E ++     P  V
Sbjct: 123 ELYAEASFARRRAGFALKVCNWWDLEGVGELARDQFPTGHGSHATPSEIAITQYAFPDSV 182

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
           K                    +   G        +   P G +G +   AT +KG  L+ 
Sbjct: 183 K-------------SADYAPPIAPTGPIREALDFRARFPDGRIGSDPGLATREKGRALVE 229

Query: 241 YFANCFIQLLNDINSFDV 258
             A   ++ L       +
Sbjct: 230 LAAQSLVRELEAFGREPM 247


>gi|291532941|emb|CBL06054.1| Uncharacterized protein, putative amidase [Megamonas hypermegale
           ART12/1]
          Length = 252

 Score =  168 bits (425), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 61/262 (23%), Positives = 110/262 (41%), Gaps = 18/262 (6%)

Query: 5   IIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           +     +      A  + D + ++P+G+ EQHGP  P+ TD +I    A      +  R 
Sbjct: 1   MYLAHLNWQQAKRAFAKDDLVAIIPIGSTEQHGPVGPLGTDFLIPDYFA----KQIEKRT 56

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            V  +P  P G +  H+   GT  + +         I+D + + G++K V LN HGGN+P
Sbjct: 57  EVLIVPTVPFGIATHHVEFSGTIDIGFDGLYAVIKGIVDGLSRHGVKKFVFLNGHGGNTP 116

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV- 181
            +  V+ EA  +  +      WS   +   +        G HG   E SM++A+   L+ 
Sbjct: 117 ALDKVALEANKKGCLCAQIDWWSLAPMLNPVWK------GGHGDGQEVSMIMAIDEGLIN 170

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNP---KGVVG--NAMDATVKKGE 236
           K DL E   +  S+ L+N          +    ++ ++     G  G  ++  A  + GE
Sbjct: 171 KDDLMETKVNHLSDKLKNIHLNAVDFKGATIKVIRSVDKVVNSGGYGGSDSYSANKQWGE 230

Query: 237 GLLSYFANCFIQLLNDINSFDV 258
            +     +  +  +N+  S  +
Sbjct: 231 DMKVALLDYIVDFVNEFKSVKL 252


>gi|87307228|ref|ZP_01089373.1| hypothetical protein DSM3645_16935 [Blastopirellula marina DSM
           3645]
 gi|87289968|gb|EAQ81857.1| hypothetical protein DSM3645_16935 [Blastopirellula marina DSM
           3645]
          Length = 266

 Score =  168 bits (425), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 59/263 (22%), Positives = 102/263 (38%), Gaps = 7/263 (2%)

Query: 1   MNPLIIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERI-KSI 57
           M+ +  +   S       +++   + VLPLGA E H  HLP  TD      + ERI  + 
Sbjct: 1   MSEMRPWI-LSEVNYGYVKENPYEVAVLPLGATEPHNLHLPYGTDMYEGTVIGERICAAA 59

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
                 V  +P  P G             +  +        ++ ++ + GIRK+V+LN+H
Sbjct: 60  HQQGAKVVLLPTMPYGTETNMNQFPLAMNVNPSTLFLLVTDLVKSLVESGIRKVVLLNSH 119

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
           GGN      +  E   +    +   +W R   P+      E  +  H GE+ETS+++A  
Sbjct: 120 GGNE--FKPLLRELYGKTEAQLFLCNWFRILSPEDYYEIFEH-MDDHAGEMETSLIMACQ 176

Query: 178 PHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
            HLV+ +     ++               G  S       L      G    +T +KGE 
Sbjct: 177 GHLVEKNADGTLNADAGSQRAMQFEALQQGWVSITRPWHLLTTNSGSGYPHASTAEKGEK 236

Query: 238 LLSYFANCFIQLLNDINSFDVSI 260
           LL        + L ++++ ++  
Sbjct: 237 LLEKMTERLAKFLVELSAAEIDE 259


>gi|322371351|ref|ZP_08045903.1| putative amidase [Haladaptatus paucihalophilus DX253]
 gi|320549341|gb|EFW91003.1| putative amidase [Haladaptatus paucihalophilus DX253]
          Length = 250

 Score =  168 bits (425), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 59/244 (24%), Positives = 101/244 (41%), Gaps = 16/244 (6%)

Query: 10  NSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP-RLPVTCM 67
            +     +A  D   VVLP G+ EQH  HLP+  DT+ A  L+  +    P   L +  +
Sbjct: 15  MTWEDAEEAIPDADFVVLPTGSVEQHSLHLPVTVDTLRAESLSRELVEAAPDRDLSMVRL 74

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P  P GYS  HM   GT TL+          I ++I + G  ++ I+N HGGN+  +++ 
Sbjct: 75  PTLPYGYSEHHMNYAGTVTLSSDTYQRVIEDIGESIAEHGAERLAIVNCHGGNNAPLTLA 134

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
           +   +    +      W+ F   +    F +     H G+ ETS++    P LVK +  E
Sbjct: 135 ADRIQRDHGVKTSLVHWTNFARDRLEERFGDEW--GHAGDHETSVIELFYPDLVKTEKKE 192

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
               +     R + Y              D+  +G  G+   +  +  E +++   +  +
Sbjct: 193 PQVRKARFEARKYTY------------FDDITEQGGRGDPTQSDPEFLEEVVAETTDIIL 240

Query: 248 QLLN 251
             L 
Sbjct: 241 SALK 244


>gi|284044394|ref|YP_003394734.1| creatininase [Conexibacter woesei DSM 14684]
 gi|283948615|gb|ADB51359.1| Creatininase [Conexibacter woesei DSM 14684]
          Length = 259

 Score =  168 bits (425), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 63/260 (24%), Positives = 104/260 (40%), Gaps = 10/260 (3%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
            +++   +         + + VLP+GA EQHGPHLP  TD ++A  +A      LP  + 
Sbjct: 3   TLLWERATRERLRALAPEAVAVLPVGAVEQHGPHLPTGTDALVAGAVARAACERLPDGVT 62

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               P    G S  H+   GT +L+ A        ++ ++R  G  + +I+NAHGGN+ +
Sbjct: 63  ALLAPTLAYGSSDHHLPFGGTLSLSPATLAAVLGDLLRSLRAGGCERALIVNAHGGNAEI 122

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
              V+  A +   ML  + S+ R + P    +        H G  ETS++LALA   V +
Sbjct: 123 CGAVAQAAAIEHDMLAAAVSYWRVSAP--PATLAGWPFPGHAGAYETSLVLALAGDDVDV 180

Query: 184 DLAENFSSRQSEFLRN------FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
                  +                   A    +   +   L   G   +  +A+   GE 
Sbjct: 181 AQLAPSPAVGGRGGERRVDGGAPADPLAGTVVADPRAWVRLG--GWTDDPREASAAAGED 238

Query: 238 LLSYFANCFIQLLNDINSFD 257
            L   AN    ++  +   D
Sbjct: 239 ALERAANAVADVIAALARRD 258


>gi|116754791|ref|YP_843909.1| creatininase [Methanosaeta thermophila PT]
 gi|116666242|gb|ABK15269.1| Creatininase [Methanosaeta thermophila PT]
          Length = 232

 Score =  168 bits (425), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 55/257 (21%), Positives = 96/257 (37%), Gaps = 28/257 (10%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +I  + S P      +K   V+LP+GA E+HGPHLP+ TDT  A  +A  +         
Sbjct: 1   MILGEMSWPEIEKGLKKTRTVILPVGAVEEHGPHLPVTTDTHQALEVAYEVARR----RE 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P    G         GT ++ +    ++   I+    +   R +++L+ H G   +
Sbjct: 57  VFVAPPVHYGICRSTRGFPGTVSVGFNALRDYVYDILLGFHESNFRYVMVLSGHAGGQHM 116

Query: 124 --VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +      A     + +   +               T    H G+IETS ML   P LV
Sbjct: 117 SSLKEACQSAVNNTDLRISLLTDFDLIRCD-------TPGDGHAGDIETSRMLLHRPDLV 169

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           +                 +  LR         S+++    G++G+   A+ +KG      
Sbjct: 170 R-----GLPPANHPKRPRYLILR---------SVREFMGNGIMGDPSSASAEKGVRYFEM 215

Query: 242 FANCFIQLLNDINSFDV 258
                ++ L+++  F V
Sbjct: 216 AVRGVLEALDELEGFSV 232


>gi|258514718|ref|YP_003190940.1| Creatininase [Desulfotomaculum acetoxidans DSM 771]
 gi|257778423|gb|ACV62317.1| Creatininase [Desulfotomaculum acetoxidans DSM 771]
          Length = 234

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 61/243 (25%), Positives = 100/243 (41%), Gaps = 21/243 (8%)

Query: 12  LPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEP 71
            P   D       +LP+G+ EQHG HLP++TD++IA GLA ++            +P+ P
Sbjct: 8   WPELTDVEF---AILPVGSIEQHGWHLPLSTDSLIANGLATKLAGKFNKS---YLLPLFP 61

Query: 72  IGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
              S EH    G+ +L  +        I+D++    I+K VI+N H GN   +  V  E 
Sbjct: 62  FTSSFEHSGFPGSVSLKVSTIAAVIEDILDSLEFSNIKKCVIVNGHQGN-HFLRNVVQEL 120

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPET-EIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
                 ++++ S S + I         T    +H GE ETS+++ L P  +     ++  
Sbjct: 121 NRFGPRVLLTPSKSAWDIAYQEAGISTTISKDMHAGEGETSLIMHLNPETINPSGVKDVD 180

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           S                       MK     G +G    AT +KG  LL+       +++
Sbjct: 181 SPSRPLFEVL-------------GMKRYTDTGAIGFPSRATEEKGVALLNILVKECEKVI 227

Query: 251 NDI 253
            + 
Sbjct: 228 MEF 230


>gi|23464642|ref|NP_695245.1| creatinine amidohydrolase; creatininase [Bifidobacterium longum
           NCC2705]
 gi|23325200|gb|AAN23881.1| creatinine amidohydrolase; creatininase [Bifidobacterium longum
           NCC2705]
          Length = 252

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 54/264 (20%), Positives = 94/264 (35%), Gaps = 28/264 (10%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M         + P   +A+    V++P+G+ EQHG HLP+ TD ++A  +AE +      
Sbjct: 1   MGSNRRMDHMTWPEFKEAKTRP-VIVPIGSTEQHGQHLPIGTDAVLATRVAEDLAER--- 56

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
            +  T +P    GY     S       GT  +     I     ++  +   G  KIV++N
Sbjct: 57  -IDGTVLPTLSYGYKSKPLSGGGPLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMN 115

Query: 116 AHGGNSPLVSIVSTEARMRFS--MLVVSTSWSRFTIPQGIISFPE-----TEIGIHGGEI 168
           AH  N   +                +V T+W        I    +          H    
Sbjct: 116 AHFENEAFIVEAIDLVTRETGGVATIVETNWWDPVPQSVIDKVFDGLVFPGWAMEHAAVT 175

Query: 169 ETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM 228
           ETS+ML  AP LV MD     +   ++    +   +            D+   G + N  
Sbjct: 176 ETSLMLHYAPELVHMDRMVEEAGATAKSYVRYPVRQG-----------DVPAHGGLANPA 224

Query: 229 DATVKKGEGLLSYFANCFIQLLND 252
            ++ ++G  +         ++  +
Sbjct: 225 GSSAERGRLIAEACVGAVAEICAE 248


>gi|302526436|ref|ZP_07278778.1| conserved hypothetical protein [Streptomyces sp. AA4]
 gi|302435331|gb|EFL07147.1| conserved hypothetical protein [Streptomyces sp. AA4]
          Length = 229

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 71/249 (28%), Positives = 109/249 (43%), Gaps = 28/249 (11%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +   D S P  A+ A    I+ +PLGA EQHGPHLP++TDT IA  L ER+ +    R  
Sbjct: 1   MRLADLSSPDVAEYAASGAILAVPLGATEQHGPHLPLSTDTDIATALCERLAA---ERSD 57

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G S EH    GT ++  A      + +  +  +   R+++ ++AHGGN+  
Sbjct: 58  VLVAPAVPYGSSGEHAGFAGTLSIGQAATELLLVELGRSAGET-FRRLLFVSAHGGNAAS 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           V+  +   R     + V                P  +   H G  ET++ LAL P  V++
Sbjct: 117 VTRAAATLRAESRDVSVF--------------EPRWQGDPHAGRPETALQLALRPEKVRL 162

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D A    +R    L     LR  G       ++ +   G++G+   AT  +G+ LL    
Sbjct: 163 DKAVPGDTRPLSEL--LPILRKGG-------VRAVTDTGILGDPTGATADEGQDLLDDLT 213

Query: 244 NCFIQLLND 252
                 + D
Sbjct: 214 AQLRAHVRD 222


>gi|113476481|ref|YP_722542.1| creatininase [Trichodesmium erythraeum IMS101]
 gi|110167529|gb|ABG52069.1| Creatininase [Trichodesmium erythraeum IMS101]
          Length = 248

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 44/258 (17%), Positives = 82/258 (31%), Gaps = 33/258 (12%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +         +   ++LP+G+ EQHGP   + TD I A  +       +   +     P 
Sbjct: 7   TWSEVEAYLNQSQSIILPIGSTEQHGPTGLIGTDAICAEAI----SKGVGETVQALVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L     I+     I  + K G  K   +N HGGN   +    +
Sbjct: 63  INVGMALHHTDFPGTISLRPTTMIQVIRDYIVCLTKSGFTKFFFINGHGGNISTLRAAFS 122

Query: 130 EARMRFSMLVVST---------SWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E     +   ++          +W   +    +       + G H    E ++   + P 
Sbjct: 123 ETYAHLADFNIANADQVKCKIGNWFMCSSVYKLAKELYGHQEGSHATPSEVALTQYIYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K        +                        +   P G +G N   AT + G+  
Sbjct: 183 AIKQATLSENVASGYSIYS-------------ATDFRRRYPDGRMGSNPALATPEHGKQF 229

Query: 239 LSYFANCFI----QLLND 252
            S           + ++D
Sbjct: 230 YSLAVKELSNSYLEFIHD 247


>gi|307265841|ref|ZP_07547391.1| Creatininase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919116|gb|EFN49340.1| Creatininase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 241

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 60/228 (26%), Positives = 99/228 (43%), Gaps = 18/228 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
            + +K  IV++P+G+ E HG HLP+ TD        E I+  +     V   P  P G S
Sbjct: 13  KNLKKSDIVIIPVGSVEAHGHHLPLGTDIFSPRLFCEMIERKIGD--YVWIAPEIPYGQS 70

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            +     GT  +      E+  A+  ++ + G++K++ LN HGGN   +++ S E  ++ 
Sbjct: 71  YDLSVYPGTIHVPSEVLAEYVYAVGKSLYENGLKKLIFLNGHGGNINALNLAS-EKLVQL 129

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
            M+V++ +W      + +     T+   H GE ETS +L     LV+MD A         
Sbjct: 130 GMVVLTINWWLDFTKEILTI---TQGQGHAGEDETSAILYYDERLVQMDKATKN------ 180

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
                   +      F    K L    + G+A  AT +KGE +     
Sbjct: 181 ------LKKPLYRIYFKDRGKILYENAMSGDATLATKEKGEKIFELLT 222


>gi|313200733|ref|YP_004039391.1| creatininase [Methylovorus sp. MP688]
 gi|312440049|gb|ADQ84155.1| Creatininase [Methylovorus sp. MP688]
          Length = 256

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 56/251 (22%), Positives = 95/251 (37%), Gaps = 18/251 (7%)

Query: 4   LIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
            + +++ +        A      +LP+GA EQHGPH+    D I+A  L   +       
Sbjct: 2   TMQWSETTWDELPAKLAAASGTAMLPIGATEQHGPHMGCGMDYILADILCREVAETTG-- 59

Query: 62  LPVTCMPVEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             V  +P  P G S+ H     GT  LT    I     I D     G+R++ I+N+H  N
Sbjct: 60  --VPMLPTMPYGCSVGHSRRWPGTIALTPITLINLVKEIGDWAYHSGVRRLFIINSHVTN 117

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           +  +       R     ++V+   +    P+            H  + ETS+ML  APH+
Sbjct: 118 AAPLRCALEMLRSEHDDMMVAVINTATMSPRVKQFHHADGDDWHANDAETSLMLEKAPHI 177

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+ D         ++       L       F   +   +  GV G    ++ +KG    +
Sbjct: 178 VRTDKL-----TLADDPDRTDDLV------FAHPVNRTSLNGVTGQPSISSAEKGAEWFA 226

Query: 241 YFANCFIQLLN 251
           +      +L+ 
Sbjct: 227 WMVEDLSELIR 237


>gi|260911249|ref|ZP_05917850.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260634622|gb|EEX52711.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 260

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 57/246 (23%), Positives = 95/246 (38%), Gaps = 19/246 (7%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL--PPRLPVTCMPVEPIG-YSIEHM 79
           +VVLP GA E H  HLP  TD I++  +A      L     +    MP   +G  +    
Sbjct: 22  LVVLPWGATEPHNYHLPYLTDCILSHDIAVDAAQRLLSKHGMHAMVMPPVTMGSQNPGQR 81

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML- 138
            +       Y         I+D++   G RK+VI+N HGGN      +  +   R+    
Sbjct: 82  ELPFCVHTRYETQKAILTDIVDSLYHQGFRKLVIVNGHGGN--TFKSMIRDLLTRYPDFL 139

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           + ++ W +    +     P    G H  EIETS+M+   P LV +  A    S       
Sbjct: 140 IAASDWFKMRKAKDFFDNP----GDHADEIETSVMMHYHPELVNLAKAGEAKSNAFAI-- 193

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV 258
                   G      +   ++    +G+   +T +KG+       + ++    D     +
Sbjct: 194 ---DALQEGRVWMPRNWTKVSKDTGIGSPALSTAEKGKRFADAVCDAYVDFFADF----I 246

Query: 259 SIFDKD 264
           S+ D+D
Sbjct: 247 SVKDED 252


>gi|119509487|ref|ZP_01628635.1| Creatininase [Nodularia spumigena CCY9414]
 gi|119465893|gb|EAW46782.1| Creatininase [Nodularia spumigena CCY9414]
          Length = 248

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 47/250 (18%), Positives = 80/250 (32%), Gaps = 29/250 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        +    ++LP+G+ EQHGP   + TD I A  +A  +             P 
Sbjct: 7   TWSEVEAYLQQSRGIILPIGSTEQHGPTGLIGTDAICAEAIARGV----GDATQALIGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  I+     I  + K G  K   +N HGGN   +    +
Sbjct: 63  INVGMALHHTAFPGTISLRPSTMIQVVRDYITCLTKAGFAKFYFINGHGGNIATLKAAFS 122

Query: 130 EARMRFSMLVVST---------SWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E       L +           +W        +       + G H    E ++   + P 
Sbjct: 123 ETYAHLEDLQIVNAQQVQCQVANWFMCGSVYKLAKELYGDQEGSHATPSEVALTQYIYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K       +S   E     +   A          +   P G +G N   AT + G+  
Sbjct: 183 SIKQ------ASLSPEVASGHRIYSAT-------DFRKSYPDGRMGSNPALATPEHGKQF 229

Query: 239 LSYFANCFIQ 248
                     
Sbjct: 230 YDLAVKELSN 239


>gi|239620717|ref|ZP_04663748.1| creatininase [Bifidobacterium longum subsp. infantis CCUG 52486]
 gi|312132330|ref|YP_003999669.1| amidase-like protein [Bifidobacterium longum subsp. longum BBMN68]
 gi|239516293|gb|EEQ56160.1| creatininase [Bifidobacterium longum subsp. infantis CCUG 52486]
 gi|291516223|emb|CBK69839.1| Uncharacterized protein, putative amidase [Bifidobacterium longum
           subsp. longum F8]
 gi|311773757|gb|ADQ03245.1| Amidase-like protein [Bifidobacterium longum subsp. longum BBMN68]
          Length = 252

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 53/264 (20%), Positives = 92/264 (34%), Gaps = 28/264 (10%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M         + P   +A+    V++P+G+ EQHG HLP+ TD ++A  +AE +      
Sbjct: 1   MGSNRRMDHMTWPEFKEAKTRP-VIVPIGSTEQHGQHLPIGTDAVLATRVAEDLAER--- 56

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
            +  T +P    GY     S       GT  +     I     ++  +   G  KIV++N
Sbjct: 57  -IDGTVLPTLSYGYKSKPLSGGGPLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMN 115

Query: 116 AHGGNSPLVSIVSTEARMRFSMLV--VSTSWSRFTIPQGIISFPE-----TEIGIHGGEI 168
           AH  N   +             +   V T+W        I    +          H    
Sbjct: 116 AHFENEAFIVEAIDLVTRETGGVATIVETNWWDPVPQSVIDKVFDGLVFPGWALEHAAVT 175

Query: 169 ETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM 228
           ETS+ML  AP LV MD     +   ++    +   +                 G + N  
Sbjct: 176 ETSLMLHYAPELVHMDRMVEEAGATAKSYVRYPVRQGDVPA-----------HGGLANPA 224

Query: 229 DATVKKGEGLLSYFANCFIQLLND 252
            ++ ++G  +         ++  +
Sbjct: 225 GSSAERGRLIAEACVGAVAEICAE 248


>gi|317481701|ref|ZP_07940733.1| creatinine amidohydrolase [Bifidobacterium sp. 12_1_47BFAA]
 gi|316916815|gb|EFV38205.1| creatinine amidohydrolase [Bifidobacterium sp. 12_1_47BFAA]
          Length = 252

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/264 (19%), Positives = 92/264 (34%), Gaps = 28/264 (10%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M         + P   + +    V++P+G+ EQHG HLP+ TD ++A  +AE +      
Sbjct: 1   MGSNRRMDHMTWPEFKEVKTHP-VIVPIGSTEQHGQHLPIGTDAVLATRVAEDLAER--- 56

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
            +  T +P    GY     S       GT  +     I     ++  +   G  KIV++N
Sbjct: 57  -IDGTVLPTLSYGYKSKPLSGGGPLFPGTIDMNGVTVITQMHDVLSELIADGFTKIVVMN 115

Query: 116 AHGGNSPLVSIVSTEARMRFS--MLVVSTSWSRFTIPQGIISFPE-----TEIGIHGGEI 168
           AH  N   +                +V T+W        I    +          H    
Sbjct: 116 AHFENEAFIVEAIDLVTRETGGVATIVETNWWDPVPQSVIDKVFDGLVFPGWALEHAAVT 175

Query: 169 ETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM 228
           ETS+ML  AP LV MD     +   ++    +   +                 G + N  
Sbjct: 176 ETSLMLHYAPELVHMDRMVEEAGATAKSYVRYPVRQGDVPA-----------HGGLANPA 224

Query: 229 DATVKKGEGLLSYFANCFIQLLND 252
            ++ ++G  +     +   ++  +
Sbjct: 225 GSSAERGRLIAEACVDAVAEICAE 248


>gi|296454591|ref|YP_003661734.1| amidase-like protein [Bifidobacterium longum subsp. longum JDM301]
 gi|296184022|gb|ADH00904.1| Amidase-like protein [Bifidobacterium longum subsp. longum JDM301]
          Length = 252

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/268 (19%), Positives = 93/268 (34%), Gaps = 29/268 (10%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M         + P   + +    V++P+G+ EQHG HLP+ TD ++A  +AE +      
Sbjct: 1   MGSNRRMDHMTWPEFKEVKTHP-VIVPIGSTEQHGQHLPIGTDAVLATRVAEDLAER--- 56

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
            +  T +P    GY     S       GT  +     I     ++  +   G  KIV++N
Sbjct: 57  -IDGTVLPTLSYGYKSKPLSGGGPLFPGTIDMNGVTVITQMHDVLSELIADGFTKIVVMN 115

Query: 116 AHGGNSPLVSIVSTEARMRFS--MLVVSTSWSRFTIPQGIISFPE-----TEIGIHGGEI 168
           AH  N   +                +V T+W        I    +          H    
Sbjct: 116 AHFENEAFIVEAIDLVTRETGGVATIVETNWWDPVPQSVIDKVFDGLVFPGWALEHAAVT 175

Query: 169 ETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM 228
           ETS+ML  AP LV MD     +   ++    +   +                 G + N  
Sbjct: 176 ETSLMLHYAPELVHMDRMVEEAGATAKSYVRYPVRQGDVPA-----------HGGLANPA 224

Query: 229 DATVKKGEGLLSYFANCFIQL-LNDINS 255
            ++ ++G  +     +   ++ + +   
Sbjct: 225 GSSAERGRLIAEACVDAVAEICVEEFAE 252


>gi|83593494|ref|YP_427246.1| creatininase [Rhodospirillum rubrum ATCC 11170]
 gi|83576408|gb|ABC22959.1| Creatininase [Rhodospirillum rubrum ATCC 11170]
          Length = 247

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 51/255 (20%), Positives = 85/255 (33%), Gaps = 29/255 (11%)

Query: 5   IIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +    ++ P  AD       V++P+G+ EQHGP   + TD I A  ++ R   +L     
Sbjct: 1   MRLQLSTWPEVADYLSTRRGVIIPIGSTEQHGPSGLIGTDAITAEVVSWRAGEVLD---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               P   +G +  HM   G+ TL  +  I      I A+   G  + + +N HGGN P 
Sbjct: 57  TLVAPTIAVGMAHHHMAFPGSMTLRPSTLIAVIRDTILALSSHGFTRFLFVNGHGGNIPS 116

Query: 124 VS----IVSTEARMRFSM-----LVVSTSWSRFTIPQGI-ISFPETEIGIHGGEIETSMM 173
           +         E R+              SW      + +         G H    E S+ 
Sbjct: 117 IQSAFYEAYEEMRVHHGDGAPDIACQLCSWFSSPAVEALAAEAFGDAEGSHATPSEVSVT 176

Query: 174 LALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATV 232
               P   +  + +   +               G  +     +   P G +G N   AT 
Sbjct: 177 WHAYPDQQRTPVLDPPVA-------------PQGRFTDSRDFRRAFPDGRIGSNPALATP 223

Query: 233 KKGEGLLSYFANCFI 247
           + G   +    +   
Sbjct: 224 ELGGRFVEVAVDYIA 238


>gi|220906393|ref|YP_002481704.1| Creatininase [Cyanothece sp. PCC 7425]
 gi|219863004|gb|ACL43343.1| Creatininase [Cyanothece sp. PCC 7425]
          Length = 259

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 47/250 (18%), Positives = 85/250 (34%), Gaps = 29/250 (11%)

Query: 11  SLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P      +    ++LP+G+ EQHGP   + TD I A  +A  +      +      P 
Sbjct: 19  TWPEVETYLQSSQGIILPIGSTEQHGPTGLIGTDAICAEAIARGV----GEQTHALVAPT 74

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    G+ +L  +  I      + ++ + G RK   +N HGGN   +    +
Sbjct: 75  INVGMALHHTAFPGSISLRPSTLILVIRDYLVSLARAGFRKFFFINGHGGNVATLKAAFS 134

Query: 130 EARMRFSML---------VVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E     + L             +W        +         G H    E ++   + PH
Sbjct: 135 ETYATLADLQLAHADQVQCQLCNWYMVRAVGKLAHELYGDREGSHATPSEVALTQFVYPH 194

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
           L+K       +    E   + +   A          +   P G +G +   AT + G+  
Sbjct: 195 LIKQ------APLSPEVNSDHRIYGAG-------DFRRRYPDGRMGSDPSLATPEHGQQF 241

Query: 239 LSYFANCFIQ 248
                    Q
Sbjct: 242 YDLAVAELSQ 251


>gi|269839013|ref|YP_003323705.1| creatininase [Thermobaculum terrenum ATCC BAA-798]
 gi|269790743|gb|ACZ42883.1| Creatininase [Thermobaculum terrenum ATCC BAA-798]
          Length = 265

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 68/253 (26%), Positives = 112/253 (44%), Gaps = 9/253 (3%)

Query: 5   IIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           + + + +     +A K+   + V+PL   E+HG HLP+ TD  I   +A R  +I P   
Sbjct: 1   MRWEELTGDRFPEAVKECGGVCVIPLSVIERHGHHLPLGTDMYIGREVANRAAAIEP--- 57

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
                P        E  +  GT ++     I+    +   + + G++KIV+LNAHGGN  
Sbjct: 58  -AIVFPDYIFTQIPEARHRAGTISIDPDLMIQLLDNVCREVARNGLKKIVLLNAHGGNFG 116

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           L+++ +          V+    +   +PQG+    +     H G  ETSM+LA+ P LV+
Sbjct: 117 LLALFNMLPLYSPRDYVIYIVHALGPLPQGVEVPWDASAEGHAGPGETSMILAIRPDLVR 176

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           MD        ++  L   + LR  G  +  W   D +P    G+A  A  + G+ LL   
Sbjct: 177 MDQVPTNDEGRA--LGRLRALREAGVQTGIWWYAD-HPTHYQGDARAADAEAGDRLLDAR 233

Query: 243 ANCFIQLLNDINS 255
           A    + L  I +
Sbjct: 234 AEQVARALRAIKA 246


>gi|260063609|ref|YP_003196689.1| hypothetical protein RB2501_02345 [Robiginitalea biformata
           HTCC2501]
 gi|88783054|gb|EAR14227.1| hypothetical protein RB2501_02345 [Robiginitalea biformata
           HTCC2501]
          Length = 253

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/261 (22%), Positives = 99/261 (37%), Gaps = 14/261 (5%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTI-IAAGLAERIKSILP 59
           M P I   + +     + R D + +LP GA E H  HLP  TD     A  A        
Sbjct: 1   MRPYI-LAETNWKALKETRFD-LAILPWGATEAHNYHLPYGTDNYEADALAAAAAAHAWE 58

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
               V  +P  P G +     +     L  +  +     +   + + GI+K+V+ N+HGG
Sbjct: 59  AGGRVVVLPTIPFGVNTGQADIYLDMNLNPSTQLAILDDVAATLHRHGIQKLVVFNSHGG 118

Query: 120 NSPLVSIVSTEARMRFSMLVVST-SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           N+     +  E  +R+  L V   +W R    +     P    G H  E ETS+ML L P
Sbjct: 119 NN--FKALLRELGLRYPDLFVCMTNWFRAMDRETYWEAP----GDHADEAETSLMLHLRP 172

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV    +    + +   +       A     +     +++    VG+   A+ +KG   
Sbjct: 173 DLVLPRESWGDGASRKFRIEGLNQDWAWAERKW----SEVSADTGVGDPSAASAEKGARF 228

Query: 239 LSYFANCFIQLLNDINSFDVS 259
               +      L +++  D +
Sbjct: 229 FRDVSRKIGAFLLELSRADPA 249


>gi|218283101|ref|ZP_03489191.1| hypothetical protein EUBIFOR_01777 [Eubacterium biforme DSM 3989]
 gi|218216122|gb|EEC89660.1| hypothetical protein EUBIFOR_01777 [Eubacterium biforme DSM 3989]
          Length = 249

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/258 (22%), Positives = 100/258 (38%), Gaps = 17/258 (6%)

Query: 5   IIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     S   C +  KD  +V+L  G+ E HG H P+ TDT+I   + E    ++  +  
Sbjct: 1   MRLERMSWKDCEEYFKDHDMVILTTGSTENHGIHNPLGTDTMIPNKILE----LVEKQSD 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G +  H    GT ++           I D +   G R  V LN HGGN+  
Sbjct: 57  VLIAPTLPYGDADFHTEYTGTISIGSDLLEMVMERISDRLYDCGARHFVFLNGHGGNTHA 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           +S V      + ++  +   W+                G HG   ET+ ML +   LV+ 
Sbjct: 117 LSKVCRHLYKKGAVGTIFDWWTIAG------KINPKWAGGHGAGQETAAMLYVDESLVQK 170

Query: 184 DLAENFSSRQSE---FLRNFKYLRAHG-SHSFGWSMKDLNPKGVVG--NAMDATVKKGEG 237
           D  E+ +  Q        N + +   G       S +  +  G  G  +   AT + G+ 
Sbjct: 171 DKIEDSNLNQFTSELTASNAQTVNFKGVDIPVPRSNRLSSDNGWFGKDHPKYATYEWGKE 230

Query: 238 LLSYFANCFIQLLNDINS 255
           ++   A+  ++ + +   
Sbjct: 231 MVEATADFLVEYMKEFQK 248


>gi|295111056|emb|CBL27806.1| Uncharacterized protein, putative amidase [Synergistetes bacterium
           SGP1]
          Length = 257

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 56/262 (21%), Positives = 102/262 (38%), Gaps = 29/262 (11%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
                + + P  A A KD ++++P+G+ EQH  HLP++ D II+   A     IL   + 
Sbjct: 6   KKFIQNITWPEYAKAAKDGVLIIPVGSTEQHSQHLPLSVDVIISENFA----RILTEEID 61

Query: 64  VTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
               P    GY     S       GT  L     +     I+      G +KI+++N+H 
Sbjct: 62  AYVAPSIAYGYKSNPTSGGGPLFPGTIDLKGNTLVTLTKDILLEFIADGWKKIILMNSHY 121

Query: 119 GNSPLVSIVST----EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI----HGGEIET 170
            N   ++  +     + +  F  +++++ W   +       F E         H    ET
Sbjct: 122 ENQAFLAEAADLTIGKQQEEFPKVILTSWWDNVSQDIIPAVFDERPFRGWDLEHAAVTET 181

Query: 171 SMMLALAPHLVKMDLA-ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMD 229
           S+ML  AP LVK++L  ++         + +   +                 G +  +M 
Sbjct: 182 SLMLYFAPELVKVELLSDDGIGDDVPRYQRYPVSKTLIP-----------KTGALYTSMT 230

Query: 230 ATVKKGEGLLSYFANCFIQLLN 251
           +T +KG+ +       F++ L 
Sbjct: 231 STAEKGKLITDDVIKNFLRFLK 252


>gi|258651016|ref|YP_003200172.1| creatininase [Nakamurella multipartita DSM 44233]
 gi|258554241|gb|ACV77183.1| Creatininase [Nakamurella multipartita DSM 44233]
          Length = 232

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 64/257 (24%), Positives = 108/257 (42%), Gaps = 25/257 (9%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           MN L      + P    + +  +++LPLG+ EQHGPHLP++TDT+IA  LA+   +  P 
Sbjct: 1   MNGLEPLAAATWPEVDRSPRR-VLLLPLGSTEQHGPHLPLSTDTVIATRLAQWAHARRPE 59

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V   PV P G S EH +  GT ++         +  +        R ++++N HGGN
Sbjct: 60  ---VGLAPVMPYGASGEHAHFPGTLSIGTEALATVLIEFVRHAAGS-WRHVLVVNGHGGN 115

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           +  +      +R     L V              +        H G+ ETS+ML L P  
Sbjct: 116 ADALRRAVEVSRYEGRSLHVHH-----------AASAGPRADPHAGDRETSLMLHLDPDR 164

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+MD A     + +        +   G       ++ ++P GV+G    A  ++G  + +
Sbjct: 165 VRMDRAVPG--QTAPIAELMPRISTDG-------IRAVSPTGVLGEPTGADAEEGRRVFA 215

Query: 241 YFANCFIQLLNDINSFD 257
                 +  +  + + D
Sbjct: 216 EMGGRLLATIARLLAPD 232


>gi|218440526|ref|YP_002378855.1| creatininase [Cyanothece sp. PCC 7424]
 gi|218173254|gb|ACK71987.1| Creatininase [Cyanothece sp. PCC 7424]
          Length = 250

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 45/250 (18%), Positives = 84/250 (33%), Gaps = 29/250 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P      ++   +++P+G+ EQHGP   + TD I A  +A      +         P 
Sbjct: 7   TWPEVETYLQESTGIIIPIGSTEQHGPIGLIGTDAICAEVIA----KGVGESTSAMVSPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  I+  L  I  + K G      +N HGGN   +    +
Sbjct: 63  LNVGMALHHTAFPGTISLRPSTLIQVVLDYITCLAKSGFTHFFFINGHGGNIATLKAAFS 122

Query: 130 EARMRFSML----------VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           E     + L           V+  +   ++ Q        + G H    E ++     P+
Sbjct: 123 ETYNHLAHLNIPGHEEIKCQVANWFMCRSVYQLAKELYGNQEGSHATPSEVAVTQFAYPN 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
           ++K                    + +        + +   P G +G N   AT + G+  
Sbjct: 183 MIKTAAL-------------NPEVASGFPIYGAVNFRRHYPDGRMGSNPALATPEHGQQF 229

Query: 239 LSYFANCFIQ 248
                     
Sbjct: 230 YDLAVKELSN 239


>gi|330507491|ref|YP_004383919.1| creatininase [Methanosaeta concilii GP-6]
 gi|328928299|gb|AEB68101.1| creatininase [Methanosaeta concilii GP-6]
          Length = 239

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 68/253 (26%), Positives = 101/253 (39%), Gaps = 25/253 (9%)

Query: 6   IFTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +  + S P   +  K    V+LP+GA E+HGPHLP  TDTI A   A  +      +  V
Sbjct: 3   LLEEMSWPEIEEGLKVTRTVILPVGATEEHGPHLPTITDTIQAMETARTVAQ----KREV 58

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL- 123
              P    G         GT T+ +     +   ++ +    G   ++IL  H G+  + 
Sbjct: 59  FLAPPIHYGVCRSTRGFPGTITVGHDALRSYVKEVLISFTDSGFENVLILTGHAGSQHMS 118

Query: 124 -VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            +      A       V   S      PQ      ET    H GEIETSMM+ +   LVK
Sbjct: 119 ALKEACQMALEEREFRVSLVSLFDLIDPQAA----ETPHDGHAGEIETSMMMVIRKDLVK 174

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
               E+F  R    +                 ++ L   G++GN   AT+KKG+  L+  
Sbjct: 175 GLPEEHFPPRPRFLIM--------------KDVRHLMGNGIMGNPAPATIKKGQNFLAMA 220

Query: 243 ANCFIQLLNDINS 255
           A   I+ L ++ S
Sbjct: 221 AEGLIEALEELES 233


>gi|298490737|ref|YP_003720914.1| creatininase ['Nostoc azollae' 0708]
 gi|298232655|gb|ADI63791.1| Creatininase ['Nostoc azollae' 0708]
          Length = 251

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 43/257 (16%), Positives = 76/257 (29%), Gaps = 29/257 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P      +    ++LP+G+ EQHGP   + TD I A  ++  +             P 
Sbjct: 7   TWPEVETYLQHSQGIILPIGSTEQHGPTGLIGTDAICAEAISRGV----GQATQAMVAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  I      I  + K G  K   +N HGGN   +    +
Sbjct: 63  INVGMALHHTAFPGTISLRPSTLILVVRDYITCLAKAGFTKFYFINGHGGNIATLKAAFS 122

Query: 130 EARMRFSML---------VVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E       L             +W        +       + G H    E ++     P 
Sbjct: 123 EIYAHLEDLQIPNASKVQCQVANWFMCGSVYKLAQELYSDQEGSHATPSEVAVTQYFYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K                    + +          +     G +G N   AT + G+  
Sbjct: 183 AIKKAYL-------------CPEVVSGHKIYGAVDFRLRYHDGRMGSNPALATPEHGKQF 229

Query: 239 LSYFANCFIQLLNDINS 255
                    +   +   
Sbjct: 230 YDLAVEELSKRYLEFVK 246


>gi|312194876|ref|YP_004014937.1| creatininase [Frankia sp. EuI1c]
 gi|311226212|gb|ADP79067.1| Creatininase [Frankia sp. EuI1c]
          Length = 253

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 70/263 (26%), Positives = 104/263 (39%), Gaps = 25/263 (9%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           P     +   P         IV+LPLG+ EQHGPHLP++TDT IA  +A  + + LP   
Sbjct: 9   PSRQLGELRWPEIDGPL--PIVLLPLGSTEQHGPHLPLDTDTRIAVAVAAAVAARLP--- 63

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
                P    G S EH    GT +L  A      + ++ +        +V++N HGGN+ 
Sbjct: 64  GALVAPPLGYGASGEHAGFPGTLSLGTAALEMALIELVRSADDTAAG-MVLVNGHGGNAT 122

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            +             ++V   W+        +  P     +H G  ETS+ML LAP LV+
Sbjct: 123 ALRGAVRLLTAEGRRVLV---WAPRAAVASAVGVPGAVGDLHAGRAETSLMLHLAPELVR 179

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
            D A    S     L     L              L+P GV+G+   A+  +G  LL   
Sbjct: 180 PDAATRGPSPALPDLVERGVLP-------------LSPSGVLGDPTGASAAEGVALLDAL 226

Query: 243 ANCFIQLLNDINSFDVSIFDKDV 265
                  ++ I S+  +      
Sbjct: 227 V---SDAVSTIESWPAARPSSRH 246


>gi|56750872|ref|YP_171573.1| hypothetical protein syc0863_d [Synechococcus elongatus PCC 6301]
 gi|81299476|ref|YP_399684.1| hypothetical protein Synpcc7942_0665 [Synechococcus elongatus PCC
           7942]
 gi|56685831|dbj|BAD79053.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81168357|gb|ABB56697.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 248

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 44/265 (16%), Positives = 86/265 (32%), Gaps = 29/265 (10%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++   ++ P      ++   +++P+G+ EQHGP   + TD I A  +A+ +      R  
Sbjct: 1   MLLQRSTWPEVEAYLQQSDGIIIPIGSTEQHGPTGLIGTDAICAEAIAQGVA----DRTQ 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               P   +G ++ H+   G+ +L  +  ++  +  + ++ + G R    +N HGGN   
Sbjct: 57  ALVGPTINVGMALHHLGFPGSVSLRPSTLLQVIVDYLSSLAQHGFRHFYFINGHGGNIAT 116

Query: 124 VSIVSTEARMRFS---------MLVVSTSWSRFTIP-QGIISFPETEIGIHGGEIETSMM 173
           V     E               +     +W       +        E G H    E ++ 
Sbjct: 117 VRAAFAEFYAVAGDRRCPEPDRLRCHLANWFMVPAVTKLARELYGDEEGSHATPSEVALT 176

Query: 174 LALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATV 232
             + P  +K                                 +   P G +G N   AT 
Sbjct: 177 QFIYPDSIKTAPLTVEVHSSHAIYA-------------ADDFRRRYPDGRMGSNPALATP 223

Query: 233 KKGEGLLSYFANCFIQLLNDINSFD 257
           + G+           Q      + D
Sbjct: 224 EHGQQFYESAVAELSQSYQAFLAAD 248


>gi|251773038|gb|EES53594.1| Creatininase [Leptospirillum ferrodiazotrophum]
          Length = 241

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 54/257 (21%), Positives = 92/257 (35%), Gaps = 20/257 (7%)

Query: 5   IIFTDNSLPLCADARKDWIVVL-PLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     + P      +   ++L P+G+ EQHGP+  + TD ++A  LA R+   L     
Sbjct: 1   MQIEHTNWPEVEKRLRSSTLLLLPVGSVEQHGPNGLIGTDHLVAEALARRVGEDLGE--- 57

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               P    G S  H+   GT +L+    I     I+    + G R+   +N HGGN   
Sbjct: 58  -LVAPTLAYGMSHHHLGFPGTSSLSPRTMILLVCDILSGFYRNGFRRFYFVNGHGGNDSS 116

Query: 124 VSIVSTEARMRFSM--LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           +    +E  +        +S  W    + +    F     G H    E ++   L PHL 
Sbjct: 117 LKAAFSEFLLDHPDARTALSNWWLLPEVTEQEKIFFGDSNGYHATCGEVAVTWHLYPHL- 175

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
                            +  +    G   F    + L P G +G +   +T +KGE L  
Sbjct: 176 -------ERPIAPGRAPDPHHEWPLGPERF----RTLYPDGRMGSDPSLSTAEKGEVLFG 224

Query: 241 YFANCFIQLLNDINSFD 257
                  + + +  +  
Sbjct: 225 IARRTIREKVREFAAAP 241


>gi|315497781|ref|YP_004086585.1| creatininase [Asticcacaulis excentricus CB 48]
 gi|315415793|gb|ADU12434.1| Creatininase [Asticcacaulis excentricus CB 48]
          Length = 256

 Score =  165 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 50/264 (18%), Positives = 90/264 (34%), Gaps = 30/264 (11%)

Query: 4   LIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
            +    ++ P      K    V++P+G+ EQHGP   + TD +    +A   +       
Sbjct: 8   AVHLAFSTWPEIEARLKTSKTVIIPIGSNEQHGPMGLLGTDWLCPEIIAHAAEKQ----G 63

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            +   P   IG +  H+   GT +L  +  +      + ++ + G  +I  LN HGGN  
Sbjct: 64  DILVAPTFNIGMAQHHLGFAGTISLRPSTFMAAIEDWVKSLARHGFERIYFLNGHGGNVA 123

Query: 123 LVSIVSTEARM-------RFSMLVVSTSWSRFTIPQGIIS-FPETEIGIHGGEIETSMML 174
            +    +E          R    +  ++W        + +       G H    E ++  
Sbjct: 124 SIEAAFSEIYSQWSWKGTRCPFALKLSNWWDLPGISPLCARLFPKGHGSHATPSEIALTW 183

Query: 175 ALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVK 233
           A  P  V+              L     +   G        +   P G +G ++  AT  
Sbjct: 184 AAYPDAVR-------------DLTMDPPIAPTGPIRDALDYRARFPDGRIGADSSLATRA 230

Query: 234 KGEGLLSYFANCFIQLLNDINSFD 257
            G+ +L          L DI  F+
Sbjct: 231 LGQQILEAAVPAL---LKDIAKFE 251


>gi|114777819|ref|ZP_01452750.1| Creatininase [Mariprofundus ferrooxydans PV-1]
 gi|114551810|gb|EAU54350.1| Creatininase [Mariprofundus ferrooxydans PV-1]
          Length = 244

 Score =  165 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 46/247 (18%), Positives = 80/247 (32%), Gaps = 26/247 (10%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        +    +++P+G+ EQHGP+  + TD I    +A  I         +   P 
Sbjct: 7   TWQEVERYLEHSTGIIIPIGSTEQHGPNGLIGTDAICPTRIAAGIAEQ----EQILIAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
              G S  HM   GT TL     I+  + ++ ++ + G      +N HGGN   V+   +
Sbjct: 63  INYGMSQHHMAFPGTVTLRPTTLIQVVIDVVTSLHRHGFTHFYFVNGHGGNIAPVTTAFS 122

Query: 130 EARMR------FSMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPHLVK 182
           E            +     +W R      +         G H    E S+     P  VK
Sbjct: 123 EIYADLQGDISHPVRCKLANWWRNDAITRLAKELYGDAEGYHATVSEVSLSYYAHPEAVK 182

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLSY 241
                         +     +   G        +   P G +G +   A++  GE   + 
Sbjct: 183 -------------DMPIHPAIAPTGDIYTAADFRRQFPDGRMGSSPQLASIAAGEQFCNL 229

Query: 242 FANCFIQ 248
             +    
Sbjct: 230 AVDALTA 236


>gi|295691400|ref|YP_003595093.1| Creatininase [Caulobacter segnis ATCC 21756]
 gi|295433303|gb|ADG12475.1| Creatininase [Caulobacter segnis ATCC 21756]
          Length = 250

 Score =  165 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 51/255 (20%), Positives = 84/255 (32%), Gaps = 26/255 (10%)

Query: 11  SLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        K    VV+P+G+ EQHGP   + TD +    +A            V   P 
Sbjct: 7   TWAEIEAYLKTSQTVVVPIGSNEQHGPTGLLGTDWLCPEIIAHEAHKRADK---VLVAPT 63

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             IG +  H+   GT  L  +  I      + ++   G ++I  LN HGGN   +    +
Sbjct: 64  FNIGMAQHHLAFPGTIFLRPSTFIAAIGDWVRSLGAHGFKRIYFLNGHGGNVASIEAAFS 123

Query: 130 EARMRF-------SMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPHLV 181
           E    +          +   +W        +  S   T  G H    E ++     P  +
Sbjct: 124 EIYADYSFRKERAPFALKLKNWWDLAGVNALANSQFPTGHGSHATPSEIAVTQWAYPQTI 183

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
           K    E               +   G        +     G +G +   AT +KG  L+ 
Sbjct: 184 KTAAYE-------------PRIAPTGPIREALDFRARYADGRMGSDPAQATPEKGGALVD 230

Query: 241 YFANCFIQLLNDINS 255
             A   I+ L   ++
Sbjct: 231 LAAKSLIEDLEAFSA 245


>gi|186682313|ref|YP_001865509.1| creatininase [Nostoc punctiforme PCC 73102]
 gi|186464765|gb|ACC80566.1| Creatininase [Nostoc punctiforme PCC 73102]
          Length = 248

 Score =  165 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 45/259 (17%), Positives = 84/259 (32%), Gaps = 29/259 (11%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        ++   ++ P+G+ EQHGP   + TD I A  +A    + +         P 
Sbjct: 7   TWQEVEAYLQQSKGIIFPIGSTEQHGPTGLIGTDAICAEAIA----AGVGDATGAIVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  I+     +  + K G  K   +N HGGN   +    +
Sbjct: 63  INVGMALHHTAFPGTISLRPSTLIQVVRDYVTCLAKAGFSKFYFINGHGGNIATLKAAFS 122

Query: 130 EARMRFSMLVVST---------SWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E       L ++          +W        +       + G H    E ++   + P 
Sbjct: 123 ETYAHLEDLQIANAQQVQCQVANWFMCGSVYKLAKELYGDQEGSHATPSEVALTQYVYPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K       +    E     +   A          +   P G +G N   AT + G+  
Sbjct: 183 AIKQ------APLSPEVASGHRIYSAA-------DFRVRYPDGRMGSNPGLATPEHGKQF 229

Query: 239 LSYFANCFIQLLNDINSFD 257
                        +  + D
Sbjct: 230 YDLAVKELSNGYLEFVNAD 248


>gi|323357094|ref|YP_004223490.1| amidase [Microbacterium testaceum StLB037]
 gi|323273465|dbj|BAJ73610.1| uncharacterized protein, putative amidase [Microbacterium testaceum
           StLB037]
          Length = 264

 Score =  165 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 110/242 (45%), Gaps = 2/242 (0%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A ++ + ++P+GA EQHGPHLP+ TDT IAA  A    +     +    +P  P G+S E
Sbjct: 11  AAREGVALVPIGATEQHGPHLPVTTDTTIAAAFATAAAARAAKEVATWVLPPLPFGFSPE 70

Query: 78  HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
           H    GT  L+    +     I   +   GIR+++ +N HGGN  L+ +   + R R  +
Sbjct: 71  HAGRPGTIALSPQTLLAIADDIGRGVAASGIRRLLFVNGHGGNPELLHVACRQLRERRGL 130

Query: 138 LVVSTS-WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
              +         P+        ++  H G  ETS++LAL P  V+MD A      +   
Sbjct: 131 AAFAVHVPGLALPPELAEGVTTGDLDAHAGHYETSVLLALDPAAVEMDAARADGLEEVRA 190

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
             +    R  G+ S  W + DL+  GV+G+   A  + GE   +  A     ++  + + 
Sbjct: 191 AAD-SLTRPFGAVSVPWHVDDLSRSGVIGDPTTADARWGERAFAAQAGALADIVRAVAAH 249

Query: 257 DV 258
            +
Sbjct: 250 PL 251


>gi|304445988|pdb|3NO4|A Chain A, Crystal Structure Of A Creatinine Amidohydrolase
           (Npun_f1913) From Nostoc Punctiforme Pcc 73102 At 2.00 A
           Resolution
 gi|304445989|pdb|3NO4|B Chain B, Crystal Structure Of A Creatinine Amidohydrolase
           (Npun_f1913) From Nostoc Punctiforme Pcc 73102 At 2.00 A
           Resolution
 gi|304445990|pdb|3NO4|C Chain C, Crystal Structure Of A Creatinine Amidohydrolase
           (Npun_f1913) From Nostoc Punctiforme Pcc 73102 At 2.00 A
           Resolution
          Length = 267

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 45/259 (17%), Positives = 83/259 (32%), Gaps = 29/259 (11%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        ++   ++ P+G+ EQHGP   + TD I A  +A    + +         P 
Sbjct: 26  TWQEVEAYLQQSKGIIFPIGSTEQHGPTGLIGTDAICAEAIA----AGVGDATGAIVGPT 81

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  I+     +  + K G  K   +N HGGN   +    +
Sbjct: 82  INVGXALHHTAFPGTISLRPSTLIQVVRDYVTCLAKAGFSKFYFINGHGGNIATLKAAFS 141

Query: 130 EARMRFSMLVVST---------SWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E       L ++          +W        +       + G H    E ++   + P 
Sbjct: 142 ETYAHLEDLQIANAQQVQCQVANWFXCGSVYKLAKELYGDQEGSHATPSEVALTQYVYPE 201

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K       +    E     +   A          +   P G  G N   AT + G+  
Sbjct: 202 AIKQ------APLSPEVASGHRIYSAA-------DFRVRYPDGRXGSNPGLATPEHGKQF 248

Query: 239 LSYFANCFIQLLNDINSFD 257
                        +  + D
Sbjct: 249 YDLAVKELSNGYLEFVNAD 267


>gi|148243306|ref|YP_001228463.1| amidase [Synechococcus sp. RCC307]
 gi|147851616|emb|CAK29110.1| Possible amidase [Synechococcus sp. RCC307]
          Length = 256

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 52/268 (19%), Positives = 87/268 (32%), Gaps = 29/268 (10%)

Query: 2   NPLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              I     S P      +    V++PLG+ EQHGP   + TD + A  +A  +      
Sbjct: 4   PEAIRLQLRSWPEVEAYLERCKGVIVPLGSTEQHGPTGAIGTDALTAEAVALEV----GR 59

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           R  V   P +  G +  H+   GT +L  +  +     ++ ++   G  ++ ++N HGGN
Sbjct: 60  RSGVLVTPTQAFGMAEHHLGFAGTVSLQPSTLLAVLRDVVLSLATHGFERVFVINGHGGN 119

Query: 121 SPLVSIVSTEARMRFS---------MLVVSTSWSRFT-IPQGIISFPETEIGIHGGEIET 170
                    EA              +     +W     + Q   +      G H    E 
Sbjct: 120 IATGRAAFAEAYGEARRRQLPVAPKLQCRMANWFMAGPVMQEARNLYGNREGHHATPSEI 179

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ L L P L  +                       G        +  +P G +G +   
Sbjct: 180 ALTLHLEPSLQDLQR-------------PLPEPAPAGPIHGPDDFRRRHPDGRMGSDPYL 226

Query: 230 ATVKKGEGLLSYFANCFIQLLNDINSFD 257
           A    GE  L   A    + L    + D
Sbjct: 227 AKADHGERFLDLAATALCKDLEQFLASD 254


>gi|156937482|ref|YP_001435278.1| creatininase [Ignicoccus hospitalis KIN4/I]
 gi|156566466|gb|ABU81871.1| Creatininase [Ignicoccus hospitalis KIN4/I]
          Length = 250

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 62/229 (27%), Positives = 103/229 (44%), Gaps = 16/229 (6%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPVTCMPVEPIGYSIEHMY 80
            +V+LP+G+ E+HG HLP+ TDT+IA  +A R+   L  +   V  +P    GY+    +
Sbjct: 19  DLVILPIGSIERHGNHLPLGTDTLIAEEVARRVAKKLSEKGYHVGLLPPIWYGYTWSLRH 78

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF--SML 138
           +DGT ++      +    I+  +    I +I+I+N HGGN   + +   EA  R    + 
Sbjct: 79  LDGTVSVEAENLAKFVEDILVTLPSPRIPRILIINGHGGNKEPLEVAVKEALNRLSPGIK 138

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
           + + SW      +  +    T +  H  EIETSM++A+    V +   E     + + LR
Sbjct: 139 IGAVSWWDMVPKEAFLQAFGT-LPSHACEIETSMVMAICEECVDLGDVEPVPPAERKLLR 197

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
           +    R   S             G +G+   A  ++GE LL   A    
Sbjct: 198 SLSETRRAFSR------------GYMGDPKRAKKEEGERLLEVAAEELA 234


>gi|29828334|ref|NP_822968.1| hypothetical protein SAV_1792 [Streptomyces avermitilis MA-4680]
 gi|29605437|dbj|BAC69503.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 266

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 62/239 (25%), Positives = 100/239 (41%), Gaps = 19/239 (7%)

Query: 11  SLPLCADARKDWI---VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           +     +     +    VLP+G++EQHG  LP+ TDT++A  +A  + +  P    V  +
Sbjct: 18  TTEDVRERGSGAVRQVAVLPVGSFEQHGAFLPLATDTLVACAIAREVAAAYP----VHLL 73

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P   I  S EH    GT +++          I D++R+ G+  +V++NAHGGN  L ++V
Sbjct: 74  PPVTISCSHEHAAWPGTVSISSVTLHAVVRDIADSLRRSGVETLVLVNAHGGNYVLGNVV 133

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
              A     M +           +           +H GEIETS++L   P LV+     
Sbjct: 134 QESAGSGTRMALFPAPEDWDAARERAGVQTSLLSDMHAGEIETSILLHTHPELVRP---- 189

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                         +L     H     M      GV+G    A+ +KG+ LL+   + F
Sbjct: 190 --------GYETTDFLVDDRRHLLTLGMSAYTESGVIGRPSLASAEKGKQLLAGLVDSF 240


>gi|329848306|ref|ZP_08263334.1| creatinine amidohydrolase family protein [Asticcacaulis
           biprosthecum C19]
 gi|328843369|gb|EGF92938.1| creatinine amidohydrolase family protein [Asticcacaulis
           biprosthecum C19]
          Length = 245

 Score =  165 bits (417), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 52/257 (20%), Positives = 93/257 (36%), Gaps = 30/257 (11%)

Query: 11  SLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P      +    V++P+G+ EQHGP   + TD +    +A            +   P 
Sbjct: 7   TWPEIDERLKSSRTVIIPIGSNEQHGPMGLLGTDWLCPEIIAHAA----EKSGDLLIAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             IG +  H+   GT +L  +  +      ++++ + G  +I  LN HGGN   +    +
Sbjct: 63  FNIGMAQHHLSFSGTISLRPSTFMAAISDWVNSLARHGFDRIYFLNGHGGNVATIEAAFS 122

Query: 130 EARMRFS--------MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           E    +S        +L +   W    I +       T  G H    E ++  A  P  V
Sbjct: 123 EIYSDYSYAAEPCPFILKLRNWWDLPGISRLCAKLYPTGHGTHATPSEIAVTFAAYPDRV 182

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
           K    E               +  +G        +     G +G ++  ATV+ G+ ++ 
Sbjct: 183 KSHTME-------------PQVAPNGPIRDALDYRARFTDGRIGSDSSLATVEDGQKIID 229

Query: 241 YFANCFIQLLNDINSFD 257
                    ++DI  FD
Sbjct: 230 AAVAGL---IDDIAKFD 243


>gi|219668090|ref|YP_002458525.1| creatininase [Desulfitobacterium hafniense DCB-2]
 gi|219538350|gb|ACL20089.1| Creatininase [Desulfitobacterium hafniense DCB-2]
          Length = 252

 Score =  165 bits (417), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 52/246 (21%), Positives = 98/246 (39%), Gaps = 12/246 (4%)

Query: 6   IFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
              + + P      R+  + ++P G+ EQHGPHLP  TD      +A ++       L  
Sbjct: 8   YLLELTQPEAEAILRRSQLAIIPNGSVEQHGPHLPCGTDHYCIMAIARKVA----SGLDG 63

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P    G +  H    GT TL     +   L    ++   G++KI+ +N H GN+  +
Sbjct: 64  LLLPFSHTGVTPFHASFAGTLTLRQETYVNLLLDTAVSVINHGVQKILFVNWHEGNTTSI 123

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           +  +++ +  + +  V    + +   Q      +     H G +E   ++A  P L+K++
Sbjct: 124 NYAASQLQKEYGVTCVVAQ-ACYITEQLYKGEADLT---HAGALEVLPVMAYRPDLLKLE 179

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSH-SFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
            A N      E  +    LR   S       ++ + P G  G+    + +K   L+   +
Sbjct: 180 RATN--PSPYEAAKEVDALRRSKSVYPILKDIRQIAPTGWYGDLDIVSEEKAAELVERVS 237

Query: 244 NCFIQL 249
              I  
Sbjct: 238 GEIITA 243


>gi|222055914|ref|YP_002538276.1| Creatininase [Geobacter sp. FRC-32]
 gi|221565203|gb|ACM21175.1| Creatininase [Geobacter sp. FRC-32]
          Length = 239

 Score =  165 bits (417), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 55/256 (21%), Positives = 97/256 (37%), Gaps = 21/256 (8%)

Query: 5   IIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +I  + ++    +  K    V +P G+ E+HG HLP++TDTI A  + +R   ++P    
Sbjct: 1   MIIENMTMGDFEEGLKRTQTVYIPFGSVEEHGYHLPLSTDTIQAYEVGKRAAELIP---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP- 122
           +   P    G         GT +++ A        I+ ++   G++  ++L  H G S  
Sbjct: 57  LFVAPPVHYGCCRSTARHPGTISISTATLKSFLKDIVRSLHSHGLKNFIVLTGHAGGSHK 116

Query: 123 -LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +     E       + ++         +      ET    H GEIETS ++   P LV
Sbjct: 117 MALQDAGEELIAEIYDIKMAVVTEYDLAKEEGRGLIETAGDAHAGEIETSRIMHSHPQLV 176

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
                  F +     L   K              +     GV G+   AT +KG  L + 
Sbjct: 177 TGTGEREFPTFPPGILVRNK--------------RQYWQNGVWGDPTKATAEKGAKLEAL 222

Query: 242 FANCFIQLLNDINSFD 257
            A   ++L   + + +
Sbjct: 223 VATKVVELARALEALE 238


>gi|89893713|ref|YP_517200.1| hypothetical protein DSY0967 [Desulfitobacterium hafniense Y51]
 gi|89333161|dbj|BAE82756.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 252

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 52/246 (21%), Positives = 98/246 (39%), Gaps = 12/246 (4%)

Query: 6   IFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
              + + P      R+  + ++P G+ EQHGPHLP  TD      +A ++       L  
Sbjct: 8   YLLELTQPEAEAILRRSQLAIIPNGSVEQHGPHLPCGTDHYCIMAIARKVA----SGLDG 63

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P    G +  H    GT TL     +   L    ++   G++KI+ +N H GN+  +
Sbjct: 64  LLLPFSHTGVTPFHASFAGTLTLRQETYVNLLLDTAVSVINHGVQKILFVNWHEGNTTSI 123

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           +  +++ +  + +  V    + +   Q      +     H G +E   ++A  P L+K++
Sbjct: 124 NYAASQLQKEYGVTCVVAQ-ACYITEQLYQGEADLT---HAGALEVLPVMAYRPDLLKLE 179

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSH-SFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
            A N      E  +    LR   S       ++ + P G  G+    + +K   L+   +
Sbjct: 180 RATN--PSPYEAAKEVDALRRSKSVYPILKDIRQIAPTGWYGDLDIVSEEKAAELVERVS 237

Query: 244 NCFIQL 249
              I  
Sbjct: 238 GEIITA 243


>gi|310820383|ref|YP_003952741.1| creatininase family protein [Stigmatella aurantiaca DW4/3-1]
 gi|309393455|gb|ADO70914.1| Creatininase family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 639

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 60/254 (23%), Positives = 95/254 (37%), Gaps = 21/254 (8%)

Query: 2   NPLIIFTDNSLPLCADARKDWI--VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
                    + P         +   VLPLGA EQHG HLP   DT IA  LAER  + + 
Sbjct: 381 PTERRLDRLTWPELEQLLASGVRTAVLPLGAVEQHGAHLPFAADTWIADALAERFCARVE 440

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             +     P  P+G S EHM   GT +L           ++ + R+ G  +  + + HGG
Sbjct: 441 EAIAC---PALPVGCSTEHMAFPGTLSLRTGTLRAVLEDLLASCRQHGFERAFLFSGHGG 497

Query: 120 NSPLVSI---VSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEI---GIHGGEIETSMM 173
           N   ++       EA     ++V +       +  G            G H GE ETS++
Sbjct: 498 NEGPLAECIGALREASAPMELIVFTDLARLTHLSHGASQEHGVGPECSGYHAGEFETSIL 557

Query: 174 LALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVK 233
             L    V++D  E    + ++      Y     +           P G VG+   +  +
Sbjct: 558 RGLRSETVRLDRLEPGFVKPTDRPSELFYPSLRVNA----------PNGTVGDPRPSAPE 607

Query: 234 KGEGLLSYFANCFI 247
           + E  L  + +  +
Sbjct: 608 RAERYLEVWVDVLV 621


>gi|115377420|ref|ZP_01464624.1| creatininase subfamily, putative [Stigmatella aurantiaca DW4/3-1]
 gi|115365577|gb|EAU64608.1| creatininase subfamily, putative [Stigmatella aurantiaca DW4/3-1]
          Length = 603

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 60/254 (23%), Positives = 95/254 (37%), Gaps = 21/254 (8%)

Query: 2   NPLIIFTDNSLPLCADARKDWI--VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
                    + P         +   VLPLGA EQHG HLP   DT IA  LAER  + + 
Sbjct: 345 PTERRLDRLTWPELEQLLASGVRTAVLPLGAVEQHGAHLPFAADTWIADALAERFCARVE 404

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
             +     P  P+G S EHM   GT +L           ++ + R+ G  +  + + HGG
Sbjct: 405 EAIAC---PALPVGCSTEHMAFPGTLSLRTGTLRAVLEDLLASCRQHGFERAFLFSGHGG 461

Query: 120 NSPLVSI---VSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEI---GIHGGEIETSMM 173
           N   ++       EA     ++V +       +  G            G H GE ETS++
Sbjct: 462 NEGPLAECIGALREASAPMELIVFTDLARLTHLSHGASQEHGVGPECSGYHAGEFETSIL 521

Query: 174 LALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVK 233
             L    V++D  E    + ++      Y     +           P G VG+   +  +
Sbjct: 522 RGLRSETVRLDRLEPGFVKPTDRPSELFYPSLRVNA----------PNGTVGDPRPSAPE 571

Query: 234 KGEGLLSYFANCFI 247
           + E  L  + +  +
Sbjct: 572 RAERYLEVWVDVLV 585


>gi|154251790|ref|YP_001412614.1| creatininase [Parvibaculum lavamentivorans DS-1]
 gi|154155740|gb|ABS62957.1| Creatininase [Parvibaculum lavamentivorans DS-1]
          Length = 269

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 54/270 (20%), Positives = 94/270 (34%), Gaps = 33/270 (12%)

Query: 3   PLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P ++   +S P      K    +V+P+G+ EQHGP+  + TD I    +A R        
Sbjct: 20  PPMLLHHSSWPEVEAYLKRSKGIVIPIGSTEQHGPNGLIGTDAICPEAIATRA----GAE 75

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
                 P   +G +  H+   GT TL  +  I      + ++ + G  +I   N HGGN 
Sbjct: 76  ADFLVGPTFNVGIAQHHLGFPGTLTLRPSTMIAALHDWVSSLARHGFERIYFFNGHGGNV 135

Query: 122 PLVSIV----------STEARMRFSMLVVSTSWSRFTIPQGIISFP-ETEIGIHGGEIET 170
             +             + +A  R  +     +W  F            +  G H    E 
Sbjct: 136 STIEAAFAEIYADASLAQDASNRGPVRCRRVNWWDFKPVMDFCKERYGSSHGAHATPSEV 195

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++   L P  +K              +     +   G ++   S +   P G +G +   
Sbjct: 196 AVTYFLQPQAIK-------------HVEMSPKVAPWGRYTDADSYRAAFPDGRIGSDPSL 242

Query: 230 ATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           A  K GE L++         + D   F+ +
Sbjct: 243 ADPKDGEKLIALSVAGL---IEDFRKFEAA 269


>gi|297154836|gb|ADI04548.1| creatininase [Streptomyces bingchenggensis BCW-1]
          Length = 294

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 61/271 (22%), Positives = 102/271 (37%), Gaps = 27/271 (9%)

Query: 3   PLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
             +++ + + P           V++P+GA EQHGPHLP+  DT I   +A  + ++    
Sbjct: 43  SPVLWEELTWPDAKSTAAGQNAVIIPVGATEQHGPHLPLAVDTRICEAVALGVSALTG-- 100

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
             V  +P    G S  H    GT  L     I     +ID++   GIR+ + LN H  N+
Sbjct: 101 --VPVLPPLSFGVSASHGDFAGTVALRPETMIAVVEDVIDSLYASGIRQFIQLNGHIWNN 158

Query: 122 PLVSIVSTEARMRFSMLVV--STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
             + + + + R+R     V      + +  P+           +H    ETS+ML LAP 
Sbjct: 159 GALDVSAEKLRVRHRDARVRALGYVTMYPGPEVDGHVTYGRALMHANYFETSVMLHLAPE 218

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
           LV+M+LA +     S                + + M  ++  GV G +  DA    G   
Sbjct: 219 LVRMELATSHVDLDSF---------------WDYRMDQVSETGVWGRDVTDADPTHGAAE 263

Query: 239 LSYFA----NCFIQLLNDINSFDVSIFDKDV 265
                          + +          +  
Sbjct: 264 FDRCVLTTARAVSAAVREPWPDPTHRPGRHA 294


>gi|188583122|ref|YP_001926567.1| creatininase [Methylobacterium populi BJ001]
 gi|179346620|gb|ACB82032.1| Creatininase [Methylobacterium populi BJ001]
          Length = 262

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 53/254 (20%), Positives = 95/254 (37%), Gaps = 18/254 (7%)

Query: 1   MNPLIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           M+  +++++ +         R     +LP+GA EQHGPHL    D ++A  L   + +  
Sbjct: 1   MSAPLLWSERTWEEIPGDLGRAAQAALLPVGATEQHGPHLGCGMDFVLADTLCREVSART 60

Query: 59  PPRLPVTCMPVEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
                V  +P  P G S+ H     GT  L      +    I       G+R++ ++N H
Sbjct: 61  G----VPMLPTLPYGCSLGHSRRWPGTIALDPLVMTDLVRQIGAQAYHSGVRRLFLVNGH 116

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
             N+  +       R     L+V+   +     +   +        H    ET++M ALA
Sbjct: 117 VTNAAPLRCALELLRAAHDDLMVALVNTATVSERVRAAHFADADDWHANRAETALMQALA 176

Query: 178 PHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
           P LV+     +      +     + L       F   +   +  GV G+   A+  +G  
Sbjct: 177 PALVREGRIVDA-----DDPDRTQDLV------FAHPVNRTSRNGVTGSPSQASAAEGAE 225

Query: 238 LLSYFANCFIQLLN 251
           L ++       L+ 
Sbjct: 226 LFAWMVEDLTALVR 239


>gi|224539279|ref|ZP_03679818.1| hypothetical protein BACCELL_04181 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224519101|gb|EEF88206.1| hypothetical protein BACCELL_04181 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 253

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 62/245 (25%), Positives = 103/245 (42%), Gaps = 12/245 (4%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL--PPRLPVTCMPVEPIG- 73
              K  +V+LP GA E H  HLP  TD I+   +A    ++      +    MP  P G 
Sbjct: 17  KDVKYDVVILPWGATEPHNLHLPYLTDCILPHDIAVDAAALALEHSGVRCMVMPPVPFGV 76

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           ++     +       Y+        I+ ++   G+RK++I++ HGGN     ++   A +
Sbjct: 77  HNPGQRELPFCIHTRYSTQQAILEDIVASLYAQGMRKLIIISGHGGN-NFKGMIRDLAFV 135

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
               L+++T W     P+G     E EI  H GE ETS+M+   P LV +D A +  S+ 
Sbjct: 136 YPDFLIIATDWFSIVSPKGYF---EAEIDDHAGESETSVMMHYHPELVNLDEAGDGESKP 192

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                  + +   G     W    +   GV GN   A+ +KG   +        QL  ++
Sbjct: 193 FAIPSLNEKV---GWAPRHWDKATI-DSGV-GNPRKASAEKGAHYVKPVIEKLAQLFTEV 247

Query: 254 NSFDV 258
              ++
Sbjct: 248 GQGEL 252


>gi|322419613|ref|YP_004198836.1| Creatininase [Geobacter sp. M18]
 gi|320126000|gb|ADW13560.1| Creatininase [Geobacter sp. M18]
          Length = 239

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/254 (22%), Positives = 100/254 (39%), Gaps = 21/254 (8%)

Query: 5   IIFTDNSLPLCADARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++  + ++   A   +    V LP G+ E+HG HLP++TDTI A  + +R    +P    
Sbjct: 1   MLIENITMEEFAQGLEVCKTVYLPFGSVEEHGSHLPLSTDTIEAYEVGKRAAERIP---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP- 122
           +   P    G         GT +++          I+ ++   G+   + L  H G S  
Sbjct: 57  LFVAPPVHYGCCRSTSRHPGTISISTGTLKALLKDIVRSLHAQGVMNFIALTGHAGGSHR 116

Query: 123 -LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +     E       + ++         +      ET    H GEIETS ++   PHLV
Sbjct: 117 MALQDAGEELIQELPEINMAVVTEYDLAKESGAHLIETRGDAHAGEIETSRIMHSHPHLV 176

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           K   A  + +  +  L   K              +   P GV G+   A+ +KG+ L S 
Sbjct: 177 KGMGAVEYPNFPTGILVRDK--------------RSFWPGGVWGDPTKASAEKGKLLESL 222

Query: 242 FANCFIQLLNDINS 255
            A+  ++L+  + S
Sbjct: 223 VADKVVELVKALES 236


>gi|291561148|emb|CBL39947.1| Uncharacterized protein, putative amidase [butyrate-producing
           bacterium SS3/4]
          Length = 242

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 89/239 (37%), Gaps = 15/239 (6%)

Query: 15  CADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY 74
                ++  V++P GA E +GP LPM +D I A  +AE +             P    G 
Sbjct: 14  MKRLAENPTVIIPTGACEIYGPQLPMGSDLIAAKRIAELVAEKTG----ALIAPTIEAGE 69

Query: 75  SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR 134
           S        T  +      +    ++  + K G +  V +  H GN   V+ +  +    
Sbjct: 70  SSALASFPCTFAMPRKILEDWLDWLVGKLIKDGAKNFVFITGHAGNVDTVNYIGKKYMNE 129

Query: 135 FSMLVVSTSWSRFTIPQG--IISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
             + +V   W RFT   G  I  +       H  E  TS+ + L P LV MD        
Sbjct: 130 HDIKLVQIDWWRFTNANGSDIFQYSGQMAHGHASECGTSVFMYLFPELVDMDELSRVEPL 189

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
            +    +F   +            +  P G +G+A  AT +KGE +++   +  +  + 
Sbjct: 190 PASEFPDFIGFQR---------FTEKTPNGTIGDATVATKEKGEKIVTRCVDRIVSYME 239


>gi|323702382|ref|ZP_08114047.1| Creatininase [Desulfotomaculum nigrificans DSM 574]
 gi|323532688|gb|EGB22562.1| Creatininase [Desulfotomaculum nigrificans DSM 574]
          Length = 324

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/267 (21%), Positives = 104/267 (38%), Gaps = 18/267 (6%)

Query: 2   NPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           N  I   + +     +  +K  ++++P+GA E HGPH  +  DT +   +AE +      
Sbjct: 17  NDGIYLQNMTWAQVEERLKKCDLIIIPIGATEAHGPHACLGEDTFLVTRMAELVAKKTG- 75

Query: 61  RLPVTCMPVEPIG-YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
               T       G +   HM + GT  L     I    +++      G RK+++LN HG 
Sbjct: 76  ---CTVSQPLWWGSHPYHHMGMPGTVILPEEIFIGVLKSVMAGYWNAGFRKMILLNGHGQ 132

Query: 120 NSPLVSIVST-EARMRFSMLVVSTSWSRFTIPQGIISFPETEIG---IHGGEIETSMMLA 175
              + + +       +  M+V + +W      Q  +           IH  E+ETS  LA
Sbjct: 133 EYVIPTAIHQFAKTYQVPMVVCNLNWYHAIQDQFKLKSEGGPYETSFIHADEVETSWSLA 192

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMK------DLN--PKGVVGNA 227
           L   ++ M  A +   +      +             W  +      +++  P+GVVG A
Sbjct: 193 LFQEMIDMSKAVDTKVQGYMPDGHVDKAGNLLHRPIAWYGQVGMGPIEVSAYPEGVVGKA 252

Query: 228 MDATVKKGEGLLSYFANCFIQLLNDIN 254
             A+ +K    +    +  ++L+ DI 
Sbjct: 253 TLASAEKAIPGIEKLLDYMVKLVEDIM 279


>gi|160889671|ref|ZP_02070674.1| hypothetical protein BACUNI_02098 [Bacteroides uniformis ATCC 8492]
 gi|317478712|ref|ZP_07937866.1| creatinine amidohydrolase [Bacteroides sp. 4_1_36]
 gi|156860663|gb|EDO54094.1| hypothetical protein BACUNI_02098 [Bacteroides uniformis ATCC 8492]
 gi|316905142|gb|EFV26942.1| creatinine amidohydrolase [Bacteroides sp. 4_1_36]
          Length = 253

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/240 (24%), Positives = 98/240 (40%), Gaps = 12/240 (5%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL--PPRLPVTCMPVEPIG- 73
              K  +V+LP GA E H  HLP  TD I+   +A    ++      +    MP  P G 
Sbjct: 17  KGVKYDVVILPWGATEPHNLHLPYLTDCILPHDIAVDAAALALQNSGVRCMVMPPVPFGA 76

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           ++     +       Y+        I+ ++   G+RK++IL+ HGGN     ++   A +
Sbjct: 77  HNPGQRELPFCIHTRYSTQQAILEDIVASLYAQGMRKLIILSGHGGN-NFKGMIRDLAFV 135

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
               L+++  W     P+      E  +  H GE ETS+M+   P LV +  A +  S+ 
Sbjct: 136 YPDFLIIAADWFSIVPPKDYF---EAVVDDHAGESETSVMMHYHPELVNLAEAGDGESQP 192

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                  + +   G     W    +   GV GN   A+ +KGE  +        +L  ++
Sbjct: 193 FAIPSLNEKV---GWAPRHWDKATV-DSGV-GNPKKASAEKGERYMKPVVEKLAKLFTEV 247


>gi|331000317|ref|ZP_08323999.1| creatininase [Parasutterella excrementihominis YIT 11859]
 gi|329572196|gb|EGG53857.1| creatininase [Parasutterella excrementihominis YIT 11859]
          Length = 256

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 50/252 (19%), Positives = 97/252 (38%), Gaps = 14/252 (5%)

Query: 11  SLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           S     +A  +   + ++P+G+ EQH  HLP+ TDT +A  +AE               P
Sbjct: 9   SWEEAKEAIVKSKGVAIVPIGSVEQHSYHLPLGTDTYVAMTIAEEAAEKTG----AVLTP 64

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG-GNSPLVSIV 127
               G+S  HM + GT T+      E    II+++   G+ KI+++N H   N   + I 
Sbjct: 65  PVWFGWSPHHMVLPGTVTIRPEVLSELTYDIIESLNAHGLNKIILINGHRIVNVVWMQIC 124

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
           +  A+ +    V     +  +  + I+         H  E+ETS M+A  P +V ++ A 
Sbjct: 125 AQRAQSKLGCTVKIFDPAYMS--KDIVKELGFGPVGHAEEVETSHMMARYPDMVHLEKAV 182

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPK-----GVVGNAMDATVKKGEGLLSYF 242
           +   + +                   ++           G  G    +  ++G+    + 
Sbjct: 183 DNPIKDTPLYSVDPTYEHDTLCYVPSTIDHARAAAKKSGGCTGEPSKSDARRGQIYHDHL 242

Query: 243 ANCFIQLLNDIN 254
               + ++  + 
Sbjct: 243 VKNLVSVVEQLQ 254


>gi|126433481|ref|YP_001069172.1| creatininase [Mycobacterium sp. JLS]
 gi|126233281|gb|ABN96681.1| Creatininase [Mycobacterium sp. JLS]
          Length = 249

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 99/244 (40%), Gaps = 18/244 (7%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           D S    +D R+  + ++P+GA EQHGPHLP+  DTIIA  + ER   +         +P
Sbjct: 13  DLSFTDVSDGRE--VGLVPVGAVEQHGPHLPVGADTIIATAMCERASELTG----APVLP 66

Query: 69  VEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
              +G S  H   + GT +LT A         +      G+R+++ +N H GN+  ++  
Sbjct: 67  AITLGVSFGHGTELPGTLSLTPALLAGIVEQYVHWAALSGLRRLLFVNGHMGNTAALNTA 126

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
           +   R+    + V          Q + +        H    ETS++LA+ P LV +D   
Sbjct: 127 TDRIRLERRDVRVGAVDWWTCDDQVLTAMMADAADAHANCAETSVLLAMRPDLVHLDRMR 186

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
           +                      F ++  +L+  GV G    AT + GE L    A    
Sbjct: 187 DADDEDR-----------TAGLVFRYTATELSRNGVTGKPSLATAELGEQLWKLAAEGIA 235

Query: 248 QLLN 251
             + 
Sbjct: 236 ARVR 239


>gi|16127808|ref|NP_422372.1| hypothetical protein CC_3578 [Caulobacter crescentus CB15]
 gi|221236629|ref|YP_002519066.1| creatinine amidohydrolase family protein [Caulobacter crescentus
           NA1000]
 gi|13425320|gb|AAK25540.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220965802|gb|ACL97158.1| creatinine amidohydrolase family protein [Caulobacter crescentus
           NA1000]
          Length = 251

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 51/250 (20%), Positives = 83/250 (33%), Gaps = 25/250 (10%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +     +  K    VV+P+G+ EQHGP   + TD +    +A         +  V   P 
Sbjct: 7   TWSEIEERLKSSTSVVVPIGSNEQHGPTGLLGTDWLCPEIIAHEASKRASDK--VLVAPT 64

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             IG +  H+   GT  L  +  I      + ++   G  +I  LN HGGN   +    +
Sbjct: 65  FNIGMAQHHLAFPGTIFLRPSTFIAAIGDWVRSLGAHGFTRIYFLNGHGGNVASIEAAFS 124

Query: 130 EARMRF-------SMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPHLV 181
           E    +          +   +W        +      T  G H    E ++     P  +
Sbjct: 125 EIYADYSFRQQRAPFALKLKNWWDLAGVNALANRQFPTGHGSHATPSEIAVTQWAYPETI 184

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
           K                    +   G        +     G +G +   AT +KG  L+S
Sbjct: 185 KT-------------AAYSPPIAPTGPIREALDFRARYADGRMGSDPAQATPEKGGELVS 231

Query: 241 YFANCFIQLL 250
             AN  I+ L
Sbjct: 232 MAANALIEDL 241


>gi|15643179|ref|NP_228223.1| creatinine amidohydrolase, putative [Thermotoga maritima MSB8]
 gi|4980918|gb|AAD35498.1|AE001720_12 creatinine amidohydrolase, putative [Thermotoga maritima MSB8]
          Length = 311

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 53/276 (19%), Positives = 103/276 (37%), Gaps = 19/276 (6%)

Query: 2   NPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              + F   ++    +  ++  ++++P+G+ E HGP+ P   DT +   +AE++      
Sbjct: 4   PTGVYFQTMTMKQIRERLKQCDLIIIPVGSTENHGPNAPTGEDTFLVTRMAEQVALKTG- 62

Query: 61  RLPVTCMPVEPIGY-SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
               T       GY    H+ + GT  +     I++ +++I      G RK ++LN HG 
Sbjct: 63  ---CTVAEPIWYGYHPYHHIGMPGTVPVKDEAFIDYLVSVIAGFWNTGFRKQILLNGHGQ 119

Query: 120 NSP-LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG---IHGGEIETSMMLA 175
                ++I       +   ++++ +W      +              IH  E+ETS  LA
Sbjct: 120 EFVIPIAIHKFAKIFQVPAIIINLNWYHAIQDKFKTKEEGGPYETPFIHADEVETSWSLA 179

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMK--------DLNPKGVVGNA 227
           L P  +  + A +   +      +             W              P+GVVG A
Sbjct: 180 LFPEFMHQEWAVDTEPKGFLPEGHIDKAGNLLHRPIAWYGHVGGGPIEVVAYPEGVVGKA 239

Query: 228 MDATVKKGEGLLSYFANCFIQLLNDIN-SFDVSIFD 262
             A+ +K +  +    +   +L+ DI   F      
Sbjct: 240 TLASAEKAKEGVEALLDYLEKLVRDIMERFPAGKLP 275


>gi|16331810|ref|NP_442538.1| hypothetical protein sll0596 [Synechocystis sp. PCC 6803]
 gi|1001770|dbj|BAA10608.1| sll0596 [Synechocystis sp. PCC 6803]
          Length = 244

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 40/246 (16%), Positives = 81/246 (32%), Gaps = 25/246 (10%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P   +  +    ++ P+G+ EQHGP   + TD I A  +A      +         P 
Sbjct: 7   TWPEVENYLQSSSGIIFPIGSTEQHGPTGLIGTDAICAEAIA----KGVGEATGAMVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H+   G+ +L  +  I+  +  + ++   G  +   +N HGGN   +    +
Sbjct: 63  INVGMALHHLAFPGSISLRPSTLIQVVMDYVSSLANAGFSRFYFINGHGGNIATLKAAFS 122

Query: 130 EARMRFS-----MLVVSTSWSRF-TIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           E           +     +W     + Q        + G H    E ++   + P  +K 
Sbjct: 123 ETYHHLGSHGQDVRCQVGNWFMARGVYQLAKELYSDQEGSHATPSEVAVTQFVYPEAIKT 182

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLSYF 242
                              + +  S       +     G +G N   AT + G+      
Sbjct: 183 -------------APLNSEVASGHSIYSAQDFRAHYSDGRMGSNPALATPEHGQRFYEVA 229

Query: 243 ANCFIQ 248
                +
Sbjct: 230 VKELSE 235


>gi|320102211|ref|YP_004177802.1| Creatininase [Isosphaera pallida ATCC 43644]
 gi|319749493|gb|ADV61253.1| Creatininase [Isosphaera pallida ATCC 43644]
          Length = 255

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 64/261 (24%), Positives = 99/261 (37%), Gaps = 11/261 (4%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           MNP     + +L          + VLPLGA E H  HLP  TDT     LAE        
Sbjct: 1   MNPHR-LEETNLAEIRRHPPVKVAVLPLGATEPHNLHLPYGTDTFQVRVLAELACRKARR 59

Query: 61  RLPVTC-MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
                  +P  P G     M       L  +        ++D++   G+   ++LN HGG
Sbjct: 60  EGAAVIELPAIPYGTESNLMRFPLAMNLQPSTLGRVVADLVDSLAAHGVPHCLLLNGHGG 119

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N   +  +  E   R  + +    W +  + +    F +   G H G +ETSM LA  P 
Sbjct: 120 N--DLKWLLRELTGRTPVNLFLCHWWKVGLDEAKRHFED--PGDHAGALETSMGLAHFPE 175

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV +D A++ ++ Q+ F    +      +  + W    L      GN  +A+   G  + 
Sbjct: 176 LVFLDQADDGATAQTRFTAINQGW-VEITRPWHW----LTTNSGAGNPREASADAGRAIT 230

Query: 240 SYFANCFIQLLNDINSFDVSI 260
              A+     L  + S  V  
Sbjct: 231 ERVASRVADFLIHLASEPVDE 251


>gi|282857194|ref|ZP_06266438.1| putative creatinine amidohydrolase [Pyramidobacter piscolens W5455]
 gi|282584980|gb|EFB90304.1| putative creatinine amidohydrolase [Pyramidobacter piscolens W5455]
          Length = 241

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 55/247 (22%), Positives = 104/247 (42%), Gaps = 18/247 (7%)

Query: 9   DNSLPLCADARKDWIV-VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           + +              +LP+GA+E  GPHLP+  DT++A  +A RI   +         
Sbjct: 6   EMNFVDYRTEIAKTRAMILPVGAFEVWGPHLPVGADTLVAEEIANRISEKIG----WVVG 61

Query: 68  PVEPIGYSIE-HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126
           P  P+GYS        GT T+       +   I+D++ + G+ +   +  H GN  +++ 
Sbjct: 62  PSVPVGYSESLFAPEGGTVTVRPESLRNYLYDIVDSLAETGVNRFCFVGPHLGNVSVITE 121

Query: 127 VSTEARMRFSMLVVSTSWSRFTIP--QGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           ++T  R   ++      W R   P  +GI+ +       H  E  TS  + L P LVK +
Sbjct: 122 IATHLRRTRNVKCCLIDWWRIIQPICRGILKYDGRPAHAHAAEAGTSTFMYLRPDLVKGE 181

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
             ++     +E+    +++             +  P+  VG+   A+ +KGE ++    +
Sbjct: 182 RLKDVGLVANEYPDIPQFI----------PFVETYPEAHVGDPTPASAEKGEQIVGKTVD 231

Query: 245 CFIQLLN 251
             ++ L 
Sbjct: 232 RVVEFLK 238


>gi|270293998|ref|ZP_06200200.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270275465|gb|EFA21325.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 253

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 100/243 (41%), Gaps = 18/243 (7%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL--PPRLPVTCMPVEPIG- 73
              K  +V+LP GA E H  HLP  TD I+   +A    ++      +    MP  P G 
Sbjct: 17  KGVKYDVVILPWGATEPHNLHLPYLTDCILPHDIAVDAAALALQNSGVRCMVMPPVPFGA 76

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           ++     +       Y+        I+ ++   G+RK++IL+ HGGN     ++   A +
Sbjct: 77  HNPGQRELPFCIHTRYSTQQAILEDIVASLYAQGMRKLIILSGHGGN-NFKGMIRDLAFV 135

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
               L+++  W     P+      E  +  H GE ETS+M+   P LV +  A +  S+ 
Sbjct: 136 YPDFLIIAADWFSIVPPKDYF---EAVVDDHAGESETSVMMHYHPELVNLAEAGDGESQ- 191

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGV---VGNAMDATVKKGEGLLSYFANCFIQLL 250
                   +     +   GW+ +  N   V   VGN   A+ +KGE  +        +L 
Sbjct: 192 -------PFAIPSLNEKVGWAPRHWNKATVDSGVGNPKKASAEKGERYMKPVVEKLSKLF 244

Query: 251 NDI 253
            ++
Sbjct: 245 TEV 247


>gi|262203638|ref|YP_003274846.1| creatininase [Gordonia bronchialis DSM 43247]
 gi|262086985|gb|ACY22953.1| Creatininase [Gordonia bronchialis DSM 43247]
          Length = 237

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 62/263 (23%), Positives = 106/263 (40%), Gaps = 28/263 (10%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M    +      P      +   V++PLGA EQHGPHLP++TDT IA  + + ++     
Sbjct: 1   MTGSSVLGQQCWPDL--DGRSVTVLVPLGALEQHGPHLPLDTDTRIATAVVDGVRGH--G 56

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              +   P    G S EH    GT ++ +    +  L    +  +    ++V +N HGGN
Sbjct: 57  DATLYRAPELAYGASGEHEGFPGTVSIGHEALYQVLLEYGRSACRW-ADRLVFVNGHGGN 115

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
            P +    T  R     +     W           F       H G  ETS++L+L+P L
Sbjct: 116 GPTLRSAVTRLRYEGRDVA----WFPCV-------FDGARADAHAGYTETSVLLSLSPQL 164

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+ D  E  +  ++        +R  G  +       ++  GV+G+   A+ + G  LL+
Sbjct: 165 VRQDRLEAGN--RASVATLLPAMREGGVAA-------VSANGVLGDPTTASAEDGTRLLA 215

Query: 241 YFANCFIQLLNDINSFDVSIFDK 263
                    L+   +++V    +
Sbjct: 216 ATIARCEAALD---AWNVDEQGR 235


>gi|189466268|ref|ZP_03015053.1| hypothetical protein BACINT_02642 [Bacteroides intestinalis DSM
           17393]
 gi|189434532|gb|EDV03517.1| hypothetical protein BACINT_02642 [Bacteroides intestinalis DSM
           17393]
          Length = 253

 Score =  162 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 60/245 (24%), Positives = 100/245 (40%), Gaps = 12/245 (4%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV--TCMPVEPIG- 73
              K   V+LP GA E H  HLP  TD I+   +A     +   R  V    MP  P G 
Sbjct: 17  KDVKYDAVILPWGATEPHNLHLPYLTDCILPHDIAVDAAMLALKRSGVRCMVMPPVPFGA 76

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           ++     +       YA        I+ ++   G+RK++I++ HGGN+     +  +   
Sbjct: 77  HNPGQRELPFCIHTRYATQQAILEDIVASLYAQGMRKLIIVSGHGGNN--FKGMIRDLAF 134

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
            +   ++  +     +P     + E EI  H GE ETS+M+   P LV ++ A +  S+ 
Sbjct: 135 SYPDFLIIATDWFSLVP--TKDYFEAEIDDHAGEQETSVMMHYHPELVNLNEAGDGDSKP 192

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                  + L   G     W    +   GV GN   A+ +KGE  +        +L  ++
Sbjct: 193 FAISSLNEKL---GWAPRHWDKATV-DSGV-GNPKKASAEKGERYVKPIIEKLAKLFTEV 247

Query: 254 NSFDV 258
              ++
Sbjct: 248 GQGEL 252


>gi|325675411|ref|ZP_08155095.1| creatininase [Rhodococcus equi ATCC 33707]
 gi|325553382|gb|EGD23060.1| creatininase [Rhodococcus equi ATCC 33707]
          Length = 230

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 65/257 (25%), Positives = 98/257 (38%), Gaps = 28/257 (10%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +       P     R D  V +P+G++EQHGPHLP++TDT IA  L   +   L     V
Sbjct: 1   MDLARTPWPDVP--RDDLTVAVPVGSFEQHGPHLPLDTDTRIATALTGAVAGAL---TGV 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P    G S EH    GT ++         +    +  +   R++V +N HGGN P +
Sbjct: 56  VTAPAITYGASGEHEGFAGTISIGTEALEALLVEYGRSACRW-ARRVVFVNGHGGNGPAL 114

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
                  R           W    +P             H G  ETS++L L+P  V MD
Sbjct: 115 VKTVELLRYEGRDAA----WLPCAVP---------GADAHAGRTETSLLLHLSPADVAMD 161

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
            AE  +   +        LR+ G       M    P G++G+   AT ++GE L +    
Sbjct: 162 RAEPGN--TAPIADLMPQLRSGG-------MLAATPNGILGDPTGATAEEGERLFADLVR 212

Query: 245 CFIQLLNDINSFDVSIF 261
              + + +         
Sbjct: 213 RAGKAIENWAPRPDGRL 229


>gi|239625805|ref|ZP_04668836.1| creatininase [Clostridiales bacterium 1_7_47_FAA]
 gi|239520035|gb|EEQ59901.1| creatininase [Clostridiales bacterium 1_7_47FAA]
          Length = 254

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 60/263 (22%), Positives = 99/263 (37%), Gaps = 29/263 (11%)

Query: 8   TDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
              +        ++ + ++LP+G+ EQHGP LP++TD I A  ++            +  
Sbjct: 9   AQMTWQEIEQCIKEGYGIILPIGSTEQHGPALPISTDAICAREVSLGAAE----NTKMLV 64

Query: 67  MPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
            P    GY     S       GT  L+    I     I++   +MG +K+V+L+ H  N 
Sbjct: 65  APTIQYGYRSRPLSGGGATFPGTTNLSGHTLICVIEDILEEFARMGFKKVVVLSMHMENQ 124

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIIS---FPETEIGI---HGGEIETSMMLA 175
             +   S     R   + +    S F   Q  I    FP+   G    H   +E S+ML 
Sbjct: 125 NFIYEGSYLVSRRHPDMKIMVMESAFGDIQENIMDVLFPDGFPGWAREHAACMEVSIMLY 184

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
             P LV  D A N +S +  F                   +     G + +A +AT++KG
Sbjct: 185 RHPELVHFDRAVNDNSEEYPFYDVLPP-----------DPRFFTKSGTLWHAREATIEKG 233

Query: 236 EGLLSYFANCFIQLLNDINSFDV 258
           + +           +N    F +
Sbjct: 234 KLIWEEIIKQAGAAIN--KEFPI 254


>gi|323486133|ref|ZP_08091464.1| hypothetical protein HMPREF9474_03215 [Clostridium symbiosum
           WAL-14163]
 gi|323400700|gb|EGA93067.1| hypothetical protein HMPREF9474_03215 [Clostridium symbiosum
           WAL-14163]
          Length = 244

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 56/249 (22%), Positives = 98/249 (39%), Gaps = 16/249 (6%)

Query: 7   FTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
             D S    A   K    ++LP GA E +GPH P+  D +    +A+++  +L  R+   
Sbjct: 5   LRDMSWSEFAQRSKTAKTIILPSGACEVYGPHNPLGADIL----VAKKMSEMLAERIDGI 60

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
             P   +G S       GT  ++       +  II    ++G +   I+N H  N+  ++
Sbjct: 61  VGPCLEVGQSKSLTSFPGTIAISGETLKAVYSEIIAEFVRLGFKNFFIVNNHLHNTQPLN 120

Query: 126 IVSTEARMRFSM-LVVSTSWSRFTIPQGIISFPETEIGI-HGGEIETSMMLALAPHLVKM 183
            V  +AR++  +       W             ET     H  E +TS+++ L P LV M
Sbjct: 121 EVLEDARIKNGIKYAQVGVWQYLPAVSDKTGMWETPAPHAHASEAQTSVLMYLFPELVDM 180

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
             A N     +  + + ++     S  +      +   G +GNA  AT +KGE  +    
Sbjct: 181 SKAPN-----TPMMFDDRWPAIMKSVPY----SSMTDSGTLGNAQSATAEKGERAVELML 231

Query: 244 NCFIQLLND 252
                 + +
Sbjct: 232 AEMEDCVRN 240


>gi|78222868|ref|YP_384615.1| creatininase [Geobacter metallireducens GS-15]
 gi|78194123|gb|ABB31890.1| Creatininase [Geobacter metallireducens GS-15]
          Length = 239

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 60/252 (23%), Positives = 95/252 (37%), Gaps = 21/252 (8%)

Query: 8   TDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
              ++    +  K    V +P G+ E+HG HLP++TDTI A  + ++        + +  
Sbjct: 4   ETMTMVEFEEGLKRTRTVFVPFGSVEEHGCHLPLSTDTIQAYEVGKKAALQ----ISLFV 59

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP--LV 124
            P    G         GT ++T A        I+ ++   G+R  +IL  H G S    +
Sbjct: 60  APPIHYGSCRSTSCHPGTISITTATLKCLMKDIVRSLYAQGMRNFIILTGHAGGSHRMAL 119

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
                E       + ++         +      ETE   H GEIETS +L   PHLV+  
Sbjct: 120 QDAGEELLPEIPDIRIAVVTEYELASREGKGIIETEGDAHAGEIETSRILHTHPHLVQGR 179

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
               F S  +  L   K              +   P GV G+   AT +KG+ L      
Sbjct: 180 GEREFPSFPTGILVRNK--------------RKYWPNGVWGDPAKATAEKGKRLEELVVK 225

Query: 245 CFIQLLNDINSF 256
             ++L   +  F
Sbjct: 226 KIVELAAALEQF 237


>gi|134294090|ref|YP_001117826.1| creatininase [Burkholderia vietnamiensis G4]
 gi|134137247|gb|ABO58361.1| Creatininase [Burkholderia vietnamiensis G4]
          Length = 259

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 59/259 (22%), Positives = 98/259 (37%), Gaps = 20/259 (7%)

Query: 1   MNPLIIFTDNSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +   +     +    A A       VV+P GA EQHGPHLP++ D   A  LA  I ++L
Sbjct: 6   LPETLHLARMTYEDVAAALATQFDRVVIPCGAIEQHGPHLPLSMDADHADALAVEIATLL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              L     P   +G S  HM   GT +L              ++   G + I + +AH 
Sbjct: 66  GRTL---IAPTIRVGCSKHHMAFPGTISLQEHTYAALCHDYCVSLAAHGFKCIYLFSAHV 122

Query: 119 GNSPLVSIVSTEARMR--FSMLVVSTSWSRFTIPQGIISFPETEI-----GIHGGEIETS 171
           GN   +  +  E R      + V++ +  +  + +  ++  E        G H    ETS
Sbjct: 123 GNFNALHAMLPELRQAVGPDVQVLAYTDHQAWLREWRLAVEEAGGDPESVGGHADIAETS 182

Query: 172 MMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDAT 231
           +M+ L P  V++          +        +   G  S       ++  GV+G+A  ++
Sbjct: 183 LMIHLDPDSVRLARLTTGH-VGAMTTEQLNRMWKEGVAS-------ISRNGVLGDARGSS 234

Query: 232 VKKGEGLLSYFANCFIQLL 250
            + GE  L   A       
Sbjct: 235 REIGEACLRATARLLASAF 253


>gi|291436032|ref|ZP_06575422.1| creatininase [Streptomyces ghanaensis ATCC 14672]
 gi|291338927|gb|EFE65883.1| creatininase [Streptomyces ghanaensis ATCC 14672]
          Length = 270

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 65/245 (26%), Positives = 103/245 (42%), Gaps = 23/245 (9%)

Query: 11  SLPLCA---DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           +         +    + VLP+G+YEQHGP LP+ TDT++A  +A  I    P    V  +
Sbjct: 22  TTEDVRTRGASVSRQVAVLPVGSYEQHGPFLPLATDTLVACAVAREIADAYP----VHLL 77

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P   I  S EH    GT +L+          I D++R+ G+  +V++N HGGN  L ++V
Sbjct: 78  PPVTISCSHEHAAWPGTVSLSSVTLHAVVRDIADSLRRSGVEALVLVNGHGGNYVLGNVV 137

Query: 128 ST--EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
                   R ++      W       G+++   T   +H GEIETS++L   P L++   
Sbjct: 138 QESSARGERTALFPAPEDWETARRRAGVVTSLLT--DMHAGEIETSILLHTHPELLRP-- 193

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
                            +     H     M      GV+G     + +KG+ LL+  A+ 
Sbjct: 194 ----------GYETSDSVADDRRHLLSLGMAAYTDSGVIGRPSLGSAEKGKKLLASLADS 243

Query: 246 FIQLL 250
           F    
Sbjct: 244 FGAYF 248


>gi|11282018|pir||T44251 creatininase (EC 3.5.2.10) [validated] - Arthrobacter sp.  (strain
           TE1826)
 gi|3116224|dbj|BAA25929.1| creatininase [Arthrobacter sp.]
          Length = 258

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 55/267 (20%), Positives = 96/267 (35%), Gaps = 30/267 (11%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
           + ++ +     D      ++LP+G+ EQHGPHLP+  D +I+   +  I   L       
Sbjct: 4   LISNMTWNEYQDKVDKGFLILPVGSTEQHGPHLPLGVDAVISTQFSLAIARELNAA---- 59

Query: 66  CMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             PV   GY     S       GT  L  +        +++     G +KI+I +AH  N
Sbjct: 60  VAPVLSYGYKSLPASGGGPMFPGTIDLKGSTLTSLVYDLLEEFIADGWKKILIFSAHFEN 119

Query: 121 SPLVSIVS----TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI----HGGEIETSM 172
              +S          +  F  +++   W   +       F E         H    ETS+
Sbjct: 120 EAFLSEACDLLLRNQKEEFPKVLICNWWDNLSAETMSKVFDEVRFPGWALEHAAISETSL 179

Query: 173 MLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATV 232
           M+  +P LVK DL  +         ++F   +                 G + +A  ++ 
Sbjct: 180 MMHFSPELVKEDLITDEGVNNPPTYQSFPPSKTLIPA-----------SGCLHSAYSSSA 228

Query: 233 KKGEGLLSYFANCFIQLLNDINSFDVS 259
           +KG+ +        +  L  I  F + 
Sbjct: 229 EKGKLIALDATKNIVSFL--IKEFSLE 253


>gi|331696779|ref|YP_004333018.1| Creatininase [Pseudonocardia dioxanivorans CB1190]
 gi|326951468|gb|AEA25165.1| Creatininase [Pseudonocardia dioxanivorans CB1190]
          Length = 263

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 56/256 (21%), Positives = 91/256 (35%), Gaps = 12/256 (4%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     S     +A  ++ +V+LP GA E HG H+P + DT  A  +A  +   L     
Sbjct: 1   MKIAHMSWRQVQEAIDREALVILPTGATEAHGAHMPNDADTHQAEHVATLVAERLG---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               P  P G S       GT +L+     E    +  A+ K G R+++ILN +  N   
Sbjct: 57  AVVAPPLPYGISKTFESFTGTISLSVPLYQELVYEVGTALIKQGFRRLLILNGNRPNGTA 116

Query: 124 VSIVSTEARMRF-----SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
              V+              +   + W         +   E     HG E ETS  LA+ P
Sbjct: 117 NDAVARRLIDDLDTTYAPTVTAVSYWEPAAARIHALRRSEVGGMGHGCEFETSFQLAVRP 176

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV M   E  ++    +  +                   N   + G+   A+ + G   
Sbjct: 177 ELVDMAAIEGVATPLVGW--DLVAPVTPSRTYTTRPSPATNDTSIFGDPHVASAESGRAF 234

Query: 239 LSYFANCFIQLLNDIN 254
           L    +  + ++ DI 
Sbjct: 235 LDAVVDELVAMMTDIR 250


>gi|108803308|ref|YP_643245.1| creatininase [Rubrobacter xylanophilus DSM 9941]
 gi|108764551|gb|ABG03433.1| Creatininase [Rubrobacter xylanophilus DSM 9941]
          Length = 268

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 60/261 (22%), Positives = 96/261 (36%), Gaps = 29/261 (11%)

Query: 4   LIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
             I ++ + P   +A +    V LP+G+ EQHG HLP+ TD I+   LA  +   L    
Sbjct: 6   TRILSEMTWPEVREAIERGAGVFLPVGSTEQHGYHLPLATDVILPTELALAVADELD--- 62

Query: 63  PVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
                P    GY     S       GT +L     +     ++  + + G  +I ++N H
Sbjct: 63  -FLVAPPVAYGYRSRPLSGGGQGFVGTISLQARTLMSLVEDVLSELIRQGFERIAVVNWH 121

Query: 118 GGNSPLVSIVSTEARMRF-----SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIE 169
             N   V   +  A  R       +LV    ++  +       FPE   G    H   +E
Sbjct: 122 FENQNFVYEAACLALERHRGSSARILVAEHPFAELSEATMKTLFPEGFPGWDYEHASIME 181

Query: 170 TSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMD 229
           TS+ML L P LV  D A + +S++  +                         G +  A  
Sbjct: 182 TSLMLHLRPELVLFDRAVDDASKRHPWYDVLPVPEDFVPA-----------SGTLWKATQ 230

Query: 230 ATVKKGEGLLSYFANCFIQLL 250
           A+ +KG          F + +
Sbjct: 231 ASEEKGRITWEEIVAQFREAV 251


>gi|77919240|ref|YP_357055.1| putative amidase [Pelobacter carbinolicus DSM 2380]
 gi|77545323|gb|ABA88885.1| putative amidase [Pelobacter carbinolicus DSM 2380]
          Length = 239

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 65/256 (25%), Positives = 102/256 (39%), Gaps = 21/256 (8%)

Query: 5   IIFTDNSLPL-CADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +I  D ++P   A   K   V +P GA E+HGPHLP++TDT+ A  +  R+    P    
Sbjct: 1   MIIEDMTMPEFIAGLEKTRTVYIPFGATEEHGPHLPLSTDTLQAKAVGYRLAERRP---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG--NS 121
           +   P    G         GT T+T          I+ ++ K G+R  ++L  H G  ++
Sbjct: 57  IFVAPAVSYGVCRSTSQHPGTLTITTGTLKALTCDIVASLYKHGLRNFILLTGHAGGTHN 116

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +     E   RF+ L ++         +      ET    H GEIETS +L   P LV
Sbjct: 117 AALIDAGEELLERFADLKIAVLTEYQLAAEEGKGLIETAGDSHAGEIETSRVLYSHPQLV 176

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           K      F S     L   K              +   P GV G+   AT +KG  +   
Sbjct: 177 KGQAEREFPSFPMGMLVRNK--------------QKYWPGGVWGDPTKATAQKGAQIERL 222

Query: 242 FANCFIQLLNDINSFD 257
             +   + ++   +++
Sbjct: 223 VVDALERFVDKFEAWE 238


>gi|159902798|ref|YP_001550142.1| hypothetical protein P9211_02571 [Prochlorococcus marinus str. MIT
           9211]
 gi|159887974|gb|ABX08188.1| Uncharacterized protein, putative amidase [Prochlorococcus marinus
           str. MIT 9211]
          Length = 265

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 46/264 (17%), Positives = 84/264 (31%), Gaps = 33/264 (12%)

Query: 6   IFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
                +         K   ++LP+G+ EQHGP   + TD + A  +A  +         V
Sbjct: 19  RLDLCTWAEVEQYLTKCKGIILPIGSTEQHGPTGAIGTDALTAEAVALEVGKRAG----V 74

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P +  G +  H+   GT +L  +  +     ++ ++ + G  ++ ++N HGGN   V
Sbjct: 75  LVAPTQAYGMAEHHLGFPGTMSLQSSTLLNVVHDLLLSLARHGFERVFVVNGHGGNIATV 134

Query: 125 SIVSTEAR---------MRFSMLVVSTSWSRFTIP-QGIISFPETEIGIHGGEIETSMML 174
               ++A          +         SW       +   +      G H    E ++ L
Sbjct: 135 KAAFSQAYKTVLNLKLPVAAGFRCKLVSWFMVPDVFKEAKARYGNLEGQHATPSEIAVTL 194

Query: 175 ALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVK 233
            L P+L                          G        +   P G +G +   A   
Sbjct: 195 FLEPNLQSKQR-------------QLPEPAPAGPIYDYQDFRQRYPDGRMGSDPFLAKPD 241

Query: 234 KGEGLLS----YFANCFIQLLNDI 253
            GE  L           +  L ++
Sbjct: 242 HGEIFLDKAAIALTEDLLNFLKEL 265


>gi|22298935|ref|NP_682182.1| hypothetical protein tlr1392 [Thermosynechococcus elongatus BP-1]
 gi|22295116|dbj|BAC08944.1| tlr1392 [Thermosynechococcus elongatus BP-1]
          Length = 249

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 41/259 (15%), Positives = 80/259 (30%), Gaps = 29/259 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P           +++P+G+ EQHGP   M TD + A  +A      +         P 
Sbjct: 8   TWPEVEAYLNTSKGMIIPIGSTEQHGPMGLMGTDALCAEAIA----KGVGEITQALVGPT 63

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  +      + ++ + G ++   +N HGGN   +     
Sbjct: 64  ISVGMALHHTAFPGTISLRPSTLMLVIRDYLVSLVRAGFQRFFFINGHGGNIATLKAAFA 123

Query: 130 EARMRFSMLVV----------STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           E     + L +          +  +   ++ Q          G H    E ++   L P 
Sbjct: 124 ETYAILTDLQIPEADQVRCELANWFMCPSVVQLARELYGDREGSHATPSEVAVTQFLYPE 183

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K        +                        +   P G +G ++  AT + G+  
Sbjct: 184 AIKRVPLNPEVNSSHAIYS-------------AADFRRRYPDGRMGSDSSLATPEHGQQF 230

Query: 239 LSYFANCFIQLLNDINSFD 257
                             D
Sbjct: 231 YQRAVQELSDRYRQFLQAD 249


>gi|223986108|ref|ZP_03636131.1| hypothetical protein HOLDEFILI_03439 [Holdemania filiformis DSM
           12042]
 gi|223961913|gb|EEF66402.1| hypothetical protein HOLDEFILI_03439 [Holdemania filiformis DSM
           12042]
          Length = 258

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 54/259 (20%), Positives = 103/259 (39%), Gaps = 17/259 (6%)

Query: 9   DNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           + S P   A  + +  V++  G+ E HG H P+  DT++   LA+RI+        +  +
Sbjct: 5   ETSWPDVQAYFKTNDSVMIITGSLECHGVHNPLGVDTLVPEALAQRIEKQ----TEILVL 60

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P  P G         GT +L+          I+D++R  G R+ + LN HGGN P +  V
Sbjct: 61  PALPFGSCDYLRGFPGTVSLSTETLRRVLQEIVDSMRAHGARRFLFLNGHGGNLPALEQV 120

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
           + +   +  + +++  W                        ET+ MLA+ P  V  +   
Sbjct: 121 ALKLNSQGDLGIIANWWQMAKEIDPAWGGGHGG------GEETAAMLAICPQAVHRERCR 174

Query: 188 NFSSRQSEF---LRNFKYLRAHG-SHSFGWSMKDLNPKGVVG--NAMDATVKKGEGLLSY 241
             + +          FK ++  G + +    +  +   G  G  +   A+   GE +L  
Sbjct: 175 ESTLKPLSENITTTGFKTVQFKGVTLTMPQPIAAICDNGWTGPDHPAAASASWGETMLEA 234

Query: 242 FANCFIQLLNDINSFDVSI 260
            +   +QL++++    +  
Sbjct: 235 ISQLLVQLIDELKHIPLGE 253


>gi|323692989|ref|ZP_08107210.1| hypothetical protein HMPREF9475_02073 [Clostridium symbiosum
           WAL-14673]
 gi|323502990|gb|EGB18831.1| hypothetical protein HMPREF9475_02073 [Clostridium symbiosum
           WAL-14673]
          Length = 244

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 54/249 (21%), Positives = 93/249 (37%), Gaps = 16/249 (6%)

Query: 7   FTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
             D S    A   K    ++LP GA E +GPH P+  D +    +A+++  +L  R+   
Sbjct: 5   LRDMSWSEFAQRSKTAKTIILPSGACEVYGPHNPLGADIL----VAKKMSEMLAERIDGI 60

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
             P   +G S       GT  ++       +  II    ++G +   I+N H  N+  ++
Sbjct: 61  VGPCLEVGQSKSLTSFPGTIAISGETLKAVYSEIIAEFVRLGFKNFFIVNNHLHNTQPLN 120

Query: 126 IVSTEARMRFSM-LVVSTSWSRFTIPQGIISFPETEIGI-HGGEIETSMMLALAPHLVKM 183
            V  +AR++  +       W             ET     H  E +TS+++ L P LV M
Sbjct: 121 EVLEDARIKNGIKYAQVGVWQYLPAVSDNTGMWETPAPHAHASEAQTSVLMYLFPELVDM 180

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
             A N      +          +           +   G +GNA  AT +KG+  +    
Sbjct: 181 SKAPNTPMMFDDRWPAIMKSVPY---------SSMTDSGTLGNAQSATAEKGKRAVELML 231

Query: 244 NCFIQLLND 252
                 + +
Sbjct: 232 AEMEDCVRN 240


>gi|331698972|ref|YP_004335211.1| Creatininase [Pseudonocardia dioxanivorans CB1190]
 gi|326953661|gb|AEA27358.1| Creatininase [Pseudonocardia dioxanivorans CB1190]
          Length = 235

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 106/244 (43%), Gaps = 17/244 (6%)

Query: 11  SLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVE 70
           +    A    D + VLP+G++EQHG HLP+ TD +IA  +AER+ +       +  +P  
Sbjct: 6   TSHEVAQTNPD-VAVLPVGSFEQHGGHLPLTTDALIATAIAERVATEHG----LLLLPAI 60

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
             G S EH    GT ++           + +++R  G+ K+V++NAHGGN  L ++V   
Sbjct: 61  TFGCSHEHADFAGTVSVRATTLYAIVNDVAESLRAAGVGKLVVVNAHGGNYVLGNVVQEA 120

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
                 M +   S       +           +HGGE ETS++LA  P +V+        
Sbjct: 121 NAGEIRMALFPQSADWADARKHAGLTTSNHEDMHGGEAETSILLARWPEVVR-------- 172

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
               +  R   +L     H     ++  +  GV+G    AT  KG  LL  F+      L
Sbjct: 173 ----DSYRTADHLADDRRHLNMLGVRGYSEDGVIGLPSLATADKGTLLLDAFSTSVAAAL 228

Query: 251 NDIN 254
           + + 
Sbjct: 229 DVLR 232


>gi|254414299|ref|ZP_05028066.1| creatininase subfamily [Microcoleus chthonoplastes PCC 7420]
 gi|196178974|gb|EDX73971.1| creatininase subfamily [Microcoleus chthonoplastes PCC 7420]
          Length = 248

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 79/256 (30%), Gaps = 29/256 (11%)

Query: 10  NSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
            +     +  K    ++LP+G+ EQHGP   + TD I A  +A  +             P
Sbjct: 6   MTWIEVEEYLKRSPGIILPIGSTEQHGPTGLIGTDAICAEAIARGV----GEATNAIVSP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
              +G ++ H    GT +L  +  I      + ++ + G  +   +N HGGN   V    
Sbjct: 62  TISVGMALHHTGFPGTISLKPSTLIHVIQDYLVSLTRAGFTRFFFINGHGGNVATVKAAF 121

Query: 129 TEARMRF---------SMLVVSTSWSRFTIPQGIISFP-ETEIGIHGGEIETSMMLALAP 178
           +E+              +     +W        +       + G H    E ++   L P
Sbjct: 122 SESYAYLWDLNIPNSDQVRCRLANWFTCKSVYQLAKQWYGDQEGSHATPSEVALTQYLYP 181

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEG 237
             +K        +                        +   P G +G N   A  + G+ 
Sbjct: 182 EAIKNAPLAPNVASGHPIYG-------------ATDFRRRYPDGRMGSNPALAKPEHGQQ 228

Query: 238 LLSYFANCFIQLLNDI 253
           L         Q   + 
Sbjct: 229 LYEMAVKEMSQAYLEF 244


>gi|218514494|ref|ZP_03511334.1| putative creatininase protein [Rhizobium etli 8C-3]
          Length = 229

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 98/155 (63%), Positives = 123/155 (79%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           VLPLGA+EQHGPHLP  TDT+IA G+A R+K+ LP  LPVT +P E +GYSIEHM V+GT
Sbjct: 22  VLPLGAHEQHGPHLPFETDTLIAEGIAGRLKTALPAGLPVTFLPAESVGYSIEHMDVEGT 81

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSW 144
           KTL + EA+  WL I + + +  IRK V+LNAHGGNSPL++IV+TEAR+RF+ML V+TSW
Sbjct: 82  KTLAFDEAVNRWLGIAERLAEQKIRKFVMLNAHGGNSPLMTIVATEARIRFAMLAVATSW 141

Query: 145 SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           +RF +P G+I   E  IGIHGG+IETS+MLAL P 
Sbjct: 142 TRFGLPDGVIRPQEKAIGIHGGDIETSVMLALHPD 176


>gi|118469315|ref|YP_891073.1| creatinine amidohydrolase [Mycobacterium smegmatis str. MC2 155]
 gi|118170602|gb|ABK71498.1| creatinine amidohydrolase [Mycobacterium smegmatis str. MC2 155]
          Length = 274

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 58/257 (22%), Positives = 92/257 (35%), Gaps = 11/257 (4%)

Query: 5   IIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
                 +         D  + VLP+GA EQHG HLP+ TD ++   + +R    L     
Sbjct: 4   RQLASLTRGAVRTLATDGAVAVLPIGAVEQHGDHLPLGTDFLLVEAVCDRALQQLEDDRT 63

Query: 64  VTC-MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
               +P    G+S  H+      +L      +    ++D++ + G R+IVI+N HGGN  
Sbjct: 64  TWVRVPTMTFGHSPHHL-FAAAVSLQAGTLTDVLADVLDSLAQTGFRRIVIVNGHGGNDE 122

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG---IHGGEIETSMMLALAPH 179
           LV +      +       + S+   T      +           H G  ETS+MLA+ P 
Sbjct: 123 LVRLAVKAHSLHAEGTAAACSYWTLTAQTTAEAAATERPDRTPGHAGWFETSLMLAVHPE 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV  D      S                     W        G   +A +A+ + G  LL
Sbjct: 183 LVADDRPFT-PSDPPPLFNRSPAPGLTVERHGEWPRV----GGTTDDAREASAETGRLLL 237

Query: 240 SYFANCFIQLLNDINSF 256
                  +  L  ++  
Sbjct: 238 GRRVAGLVAALQSLDRA 254


>gi|46190377|ref|ZP_00121574.2| COG1402: Uncharacterized protein, putative amidase [Bifidobacterium
           longum DJO10A]
          Length = 246

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 53/257 (20%), Positives = 94/257 (36%), Gaps = 28/257 (10%)

Query: 8   TDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
              + P   +A+    V++P+G+ EQHG HLP+ TD ++A  +AE +       +  T +
Sbjct: 2   DHMTWPEFKEAKTRP-VIVPIGSTEQHGQHLPIGTDAVLATRVAEDLAER----IDGTVL 56

Query: 68  PVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P    GY     S       GT  +     I     ++  +   G  KIV++NAH  N  
Sbjct: 57  PTLSYGYKSKPLSGGGPLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMNAHFENEA 116

Query: 123 LVSIVSTEARMRFS--MLVVSTSWSRFTIPQGIISFPE-----TEIGIHGGEIETSMMLA 175
            +                +V T+W        I    +          H    ETS+ML 
Sbjct: 117 FIVEAIDLVTRETGGVATIVETNWWDPVPQSVIDKVFDGLVFPGWALEHAAVTETSLMLH 176

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
            AP LV MD     +   ++    +   +            D+   G + N   ++ ++G
Sbjct: 177 YAPELVHMDRMVEEAGATAKSYVRYPVRQG-----------DVPAHGGLANPAGSSAERG 225

Query: 236 EGLLSYFANCFIQLLND 252
             +     +   ++  +
Sbjct: 226 RLIAEACVDAVAKICAE 242


>gi|189424906|ref|YP_001952083.1| creatinase [Geobacter lovleyi SZ]
 gi|189421165|gb|ACD95563.1| Creatininase [Geobacter lovleyi SZ]
          Length = 241

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 98/251 (39%), Gaps = 22/251 (8%)

Query: 5   IIFTDNSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           ++  + ++P    A       V +P GA E+HGPHLP++TDTI A  + +R   ++P   
Sbjct: 1   MLLEELTMPQVEAALAAGCRTVYIPFGALEEHGPHLPLSTDTIQAYQVGKRAAELVP--- 57

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            +   P  P G         GT +++          ++ +  + G+  +V+L  H G + 
Sbjct: 58  -LFVAPPIPYGNCRSTSCHPGTVSISTTTLRCLLKDLVRSFYRQGMHNVVVLTGHAGGAH 116

Query: 123 --LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
              +     E       L ++                ET    H GEIETS ++   PHL
Sbjct: 117 RLALQDAGEELLDELPELRIAVVTEYELAKDEGRGIIETPGDAHAGEIETSRIMHSHPHL 176

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+    E + +  +  L   K              +   P GV G+   AT  KG  +  
Sbjct: 177 VQGTAPEEYPTFPTGILVRDK--------------RRYWPGGVWGDPAKATADKGARIEE 222

Query: 241 YFANCFIQLLN 251
             A   ++L+ 
Sbjct: 223 LVARKVVELVR 233


>gi|307151821|ref|YP_003887205.1| Creatininase [Cyanothece sp. PCC 7822]
 gi|306982049|gb|ADN13930.1| Creatininase [Cyanothece sp. PCC 7822]
          Length = 248

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 45/250 (18%), Positives = 81/250 (32%), Gaps = 29/250 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P   +       +++P+G+ EQHGP   + TD I A  +A      +         P 
Sbjct: 7   TWPEVENYLSYSTGIIIPIGSTEQHGPTGLIGTDAICAEVIA----KGVGEATAAMVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  I+  +  I  +   G R+   +N HGGN   +     
Sbjct: 63  LHLGMALHHTAFSGTISLRPSTLIQVVMDYITCLAVSGFRRFFWINGHGGNIATLKAAFA 122

Query: 130 EARMRFSMLVVST---------SWSRFTIP-QGIISFPETEIGIHGGEIETSMMLALAPH 179
           E     + L +           +W       Q        + G H    E ++   + P 
Sbjct: 123 ETYYHLANLNIPHADEIRCEIANWFMCREVYQLAKKLYGDQEGSHATPSEVALTQFVYPD 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
           L+K    +   +                        +   P G +G N   AT ++G+  
Sbjct: 183 LIKTATLDTQVAS-------------GYPIYGAADFRRHYPDGRMGSNPALATPEQGQQF 229

Query: 239 LSYFANCFIQ 248
                     
Sbjct: 230 YQLAVKELSN 239


>gi|288921117|ref|ZP_06415406.1| Creatininase [Frankia sp. EUN1f]
 gi|288347493|gb|EFC81781.1| Creatininase [Frankia sp. EUN1f]
          Length = 235

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 57/236 (24%), Positives = 97/236 (41%), Gaps = 17/236 (7%)

Query: 11  SLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVE 70
           +           + VLP+G++EQHG  LP+ TDT+IA+ +A RI         +  +P  
Sbjct: 9   TTTDIRALNPR-VAVLPVGSFEQHGDFLPLTTDTLIASAIARRIA----DDYGLFLLPPI 63

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
               S EH    GT +++    I     I  ++   G+ ++VI+N HGGN  L +IV   
Sbjct: 64  TFSCSHEHASYPGTVSISARTLIALIDDITASLSASGVDRLVIVNGHGGNYVLSNIVQEA 123

Query: 131 ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
                 M++           +      +    +H GE+E S++L   P  V+        
Sbjct: 124 NIGGPRMILFPGKTDWTRAREAAGMETDHSEDMHAGELEVSVLLHTTPEQVR-------- 175

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
               +  ++  ++     H     M      GV+G    A+  KG  LL+  ++ F
Sbjct: 176 ----DSYKSGDHIANERPHLLSVGMPTYTSTGVIGRPSLASSIKGGHLLAGLSSAF 227


>gi|294632321|ref|ZP_06710881.1| creatinine amidohydrolase [Streptomyces sp. e14]
 gi|292835654|gb|EFF94003.1| creatinine amidohydrolase [Streptomyces sp. e14]
          Length = 257

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 105/240 (43%), Gaps = 21/240 (8%)

Query: 11  SLPLCA---DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           +          R   + VLP+G++EQHG HLP+ TDT++A  +A  I +  P    V  +
Sbjct: 21  TTEDVRTRGAGRARQVAVLPVGSFEQHGAHLPLATDTLVACAIAGEIAAAYP----VHPL 76

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P   I  S EH    GT +++          I D++R+ G+  +V++N HGGN  ++  V
Sbjct: 77  PPVTISCSHEHAAWPGTVSISAVTLHAVVRDIADSLRRSGVDALVVVNGHGGNY-VLGNV 135

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEI-GIHGGEIETSMMLALAPHLVKMDLA 186
             E+  R   + +  +   +   +       + +  +H GEIETS++L   P LVK    
Sbjct: 136 VQESSARGEHIALFPAAEDWETARERAGVRTSLLTDMHAGEIETSILLHAHPELVK---- 191

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                   E      ++     H     M      GV+G       +KG+ LL+  A+ F
Sbjct: 192 --------EGYEKADFVADDRRHLLTVGMSAYTESGVIGRPSLGDAEKGKELLASLADSF 243


>gi|111023040|ref|YP_706012.1| hypothetical protein RHA1_ro06077 [Rhodococcus jostii RHA1]
 gi|110822570|gb|ABG97854.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 240

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 61/265 (23%), Positives = 96/265 (36%), Gaps = 32/265 (12%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M       D   P      +   VV+P+G+ EQHGPHLP++TDT IA  +   +      
Sbjct: 1   MPHSGHLDDAVWPEL--VSRVSTVVVPVGSLEQHGPHLPLDTDTAIADAVCRAL------ 52

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V   P    G S EH    GT +L         +    +  +    +++ +N HGGN
Sbjct: 53  -PHVLVAPPIAYGASGEHEGFPGTVSLGSEALETVLVEYGRSACRW-ADRVLFVNGHGGN 110

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
            P +       R     +     W    +P             H G  ETS++L L+P  
Sbjct: 111 GPALVKAVALLRYEARDVA----WVPCAVP---------GADAHAGRTETSLLLHLSPAR 157

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V++  AE  ++     L     LR  G       M  ++  GV+G+   AT  +G  +  
Sbjct: 158 VRLSRAEAGNTEPVARL--MPRLREGG-------MVAVSANGVLGDPTGATAAEGAQIFG 208

Query: 241 YFANCFIQLLNDINSFDVSIFDKDV 265
              +   + L             + 
Sbjct: 209 VLVHAVTKALARWEPGPDGRLRSEP 233


>gi|288927373|ref|ZP_06421220.1| putative amidase [Prevotella sp. oral taxon 317 str. F0108]
 gi|288330207|gb|EFC68791.1| putative amidase [Prevotella sp. oral taxon 317 str. F0108]
          Length = 260

 Score =  161 bits (408), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 59/245 (24%), Positives = 101/245 (41%), Gaps = 17/245 (6%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS---IEHM 79
           +VVLP GA E H  HLP  TD I++  +A      L  +  +  M + P+G         
Sbjct: 22  LVVLPWGATEPHNYHLPYLTDCILSHDIAVDAAQRLLTKHGLHAMVMPPVGMGSQNPGQR 81

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
            +       Y         I+D++   G RK+VI+N HGGN    S++          L+
Sbjct: 82  ELPFCVHTRYETQKAILTDIVDSLYHQGFRKLVIVNGHGGNG-FKSMIRDLLTCYPDFLI 140

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
            ++ W +    +     P    G H  EIETS+M+   P LV +  A    S     +  
Sbjct: 141 AASDWFKMRNAKDFFDNP----GDHADEIETSVMMYYHPELVNLADAGEGKSNAFA-IDA 195

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
            +  R     ++G     ++    +G+   +T +KG+G      + ++    D     ++
Sbjct: 196 LQEGRVWMPRNWGK----VSKDTGIGSPKQSTAEKGKGFADAVCDAYVDFFADF----IA 247

Query: 260 IFDKD 264
           + D+D
Sbjct: 248 VKDED 252


>gi|323344557|ref|ZP_08084782.1| hypothetical protein HMPREF0663_11318 [Prevotella oralis ATCC
           33269]
 gi|323094684|gb|EFZ37260.1| hypothetical protein HMPREF0663_11318 [Prevotella oralis ATCC
           33269]
          Length = 255

 Score =  161 bits (408), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 92/244 (37%), Gaps = 15/244 (6%)

Query: 15  CADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR--LPVTCMPVEPI 72
            A      +V+LP GA E H  HLP  TD I++  +A         R  +    MP   +
Sbjct: 14  IARQYDYSVVLLPWGATEPHNLHLPYMTDCILSHDIAVDAAQQTFERYGIRCMVMPPVNM 73

Query: 73  G-YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
           G  +     +       Y         I+ ++   G RK++I+N HGGN      +  + 
Sbjct: 74  GSQNPGQRELSFCVHARYETQKAILTDIVASLNYQGFRKLLIVNGHGGN--TFKNMIRDL 131

Query: 132 RMRFSMLVVSTS-WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFS 190
            + +   VV+TS W +    +     P    G H  E+ETS+M+     LV +D A    
Sbjct: 132 SVEYPHFVVATSEWFKLMPAKEFFDTP----GDHADEVETSVMMHYHQELVNLDEAGAGD 187

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           ++              G      +   ++    +G+   +T +KG       A  + + +
Sbjct: 188 AKSFAIPA-----LQEGRVWIPRAWNRVSVDTGIGDPRGSTAEKGRIFAEAVAAKYAEFI 242

Query: 251 NDIN 254
            D  
Sbjct: 243 RDFA 246


>gi|282896392|ref|ZP_06304413.1| Creatininase [Raphidiopsis brookii D9]
 gi|281198680|gb|EFA73560.1| Creatininase [Raphidiopsis brookii D9]
          Length = 248

 Score =  161 bits (408), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 40/259 (15%), Positives = 81/259 (31%), Gaps = 29/259 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P      +    +++P+G+ EQHGP   + TD + A  ++  +             P 
Sbjct: 7   TWPEVEKYLESSSGIIIPIGSTEQHGPTGLIGTDAVCAEFISHGV----GEATQAMVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    GT +L  +  I      + ++ K G  K   +N HGGN   +    +
Sbjct: 63  INVGMALHHTAFPGTISLRPSTLILVVKDYVSSLAKAGFTKFYFINGHGGNIATLKTAFS 122

Query: 130 EARMRFSML---------VVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPH 179
           E       +             +W   +    +       + G H    E ++   + P 
Sbjct: 123 ETYAYLEDIQAKNFQKVQCQLGNWFTCSSVYKLAQELYGDKEGSHATPSEVALTQYIYPQ 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K        +                        +   P G +G +   AT + G+  
Sbjct: 183 AIKQSFLAPEVATGHRIYGPS-------------DFRLRYPDGRMGSHPDLATPEHGKQF 229

Query: 239 LSYFANCFIQLLNDINSFD 257
                       ++  + D
Sbjct: 230 YDLAVEELSAAYSNFLNQD 248


>gi|170699448|ref|ZP_02890492.1| Creatininase [Burkholderia ambifaria IOP40-10]
 gi|170135648|gb|EDT03932.1| Creatininase [Burkholderia ambifaria IOP40-10]
          Length = 249

 Score =  161 bits (408), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 50/258 (19%), Positives = 84/258 (32%), Gaps = 27/258 (10%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +         +   +V+P+G+ EQHGP   + TD +    +A   +        +   P 
Sbjct: 7   TWSEIEQFLTRSRTIVVPIGSNEQHGPTGLLGTDWLCPEIIAREAEKSAD----ILVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             IG +  H+   GT +L  +  I        ++   G  KI+ LN HGGN   +    +
Sbjct: 63  FNIGMAQHHLGFPGTISLRPSTFIAAIGDWTRSLVAHGFEKILFLNGHGGNISSIDAAFS 122

Query: 130 E-------ARMRFSMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPHLV 181
           E       AR R    +   +W        +      T  G H    E ++     P  +
Sbjct: 123 ELYAEASFARRRAGFALKLCNWWDLEGVGELAREQFPTGHGAHATPSEIAITQWAFPDSI 182

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
           K                    +   G        +   P G +G +   AT +KG  L+ 
Sbjct: 183 K-------------SADYAPPIANTGPIRDALDFRARFPDGRIGSDPGLATREKGRALVE 229

Query: 241 YFANCFIQLLNDINSFDV 258
             A    + L       +
Sbjct: 230 LAAQSLARELEAFGREPM 247


>gi|148269645|ref|YP_001244105.1| creatininase [Thermotoga petrophila RKU-1]
 gi|147735189|gb|ABQ46529.1| Creatininase [Thermotoga petrophila RKU-1]
          Length = 311

 Score =  161 bits (408), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 51/268 (19%), Positives = 101/268 (37%), Gaps = 18/268 (6%)

Query: 2   NPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              + +   ++    +  ++  ++++P+G+ E HGP+ P   DT +   +AE++      
Sbjct: 4   PTGVYYQTMTMKQIKERLKECDLIIIPVGSTENHGPNAPTGEDTFLVTRMAEQVALKTG- 62

Query: 61  RLPVTCMPVEPIGY-SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
               T       GY    H+ + GT  +     I++ +++I      G RK ++LN HG 
Sbjct: 63  ---CTVAEPIWYGYHPYHHIGMPGTVPVKDEAFIDYLVSVIAGFWNTGFRKQILLNGHGQ 119

Query: 120 NSPLVSIVST-EARMRFSMLVVSTSWSRFTIPQGIISFPETEIG---IHGGEIETSMMLA 175
              +   +       +   ++++ +W      +              IH  E+ETS  LA
Sbjct: 120 EFVIPVAIHKFAKIFQVPAIIINLNWYHAIQDKFKTKEEGGPYETPFIHADEVETSWSLA 179

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMK--------DLNPKGVVGNA 227
           L P L+  + A +   +      +             W              P+GVVG A
Sbjct: 180 LFPELMHQEWAVDTEPKGFLPEGHIDKAGNLLHRPIAWYGHVGGGPIEVVAYPEGVVGKA 239

Query: 228 MDATVKKGEGLLSYFANCFIQLLNDINS 255
             A+  K +  +    +   +L+ DI  
Sbjct: 240 TLASADKAKEGVEALLDYLEKLVRDIME 267


>gi|83945664|ref|ZP_00958009.1| Creatininase [Oceanicaulis alexandrii HTCC2633]
 gi|83850865|gb|EAP88725.1| Creatininase [Oceanicaulis alexandrii HTCC2633]
          Length = 245

 Score =  161 bits (408), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 52/262 (19%), Positives = 93/262 (35%), Gaps = 30/262 (11%)

Query: 5   IIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++    S P      K    +++P+G+ EQHGP+  + TD I    +A            
Sbjct: 1   MLLHTASWPEVEAYLKTSKGIIIPIGSTEQHGPNGLVGTDAICPEVIAREA----GAEAG 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +   P   +G +  H+   G+ TL     I      ID++ + G  KI  LN HGGN   
Sbjct: 57  ILVGPTFNVGVAQHHLGFPGSMTLRPTTMIAAINDWIDSLARHGFEKIYFLNGHGGNIAT 116

Query: 124 VSIVSTEARMR-------FSMLVVSTSWSR-FTIPQGIISFPETEIGIHGGEIETSMMLA 175
           ++    E+              +   +W     +     S      G H    E S+   
Sbjct: 117 IAAAFAESYANWSYDGEACPYELKQMNWWELPGVMDVCRSLFPVGEGSHATASEVSVTYY 176

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKK 234
             P  VK              +     +  +G  +   + +   P G +G +   AT +K
Sbjct: 177 AYPEHVKT-------------VEMSPKIAPNGRFTDADNYRKSFPDGRIGSDPAQATPEK 223

Query: 235 GEGLLSYFANCFIQLLNDINSF 256
           G  +++         ++D+ +F
Sbjct: 224 GATIVAAARKAL---ISDVKTF 242


>gi|317968660|ref|ZP_07970050.1| hypothetical protein SCB02_03893 [Synechococcus sp. CB0205]
          Length = 258

 Score =  161 bits (408), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 53/264 (20%), Positives = 88/264 (33%), Gaps = 29/264 (10%)

Query: 2   NPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              I     S P       +   V++PLG+ EQHGP   + TD + A  +A  +   L  
Sbjct: 6   TEDIRLQLRSWPEVEAYLTQKKGVIIPLGSTEQHGPTGAIGTDALTAEAVALEVGRRLG- 64

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V   P +  G +  H+   GT +L  +  +     +I ++ + G  +I ++N HGGN
Sbjct: 65  ---VLVTPAQAFGMAEHHLGFAGTMSLQPSTLLAVLHDLILSLARHGFERIYVINGHGGN 121

Query: 121 SPLVS---------IVSTEARMRFSMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIET 170
                           +        +     +W   +   G+       + G H    E 
Sbjct: 122 IATCKAAFAQAYGTAAARGLPNAARLRCKLANWFMTSEAMGLARELYGDKEGHHATPSEI 181

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ LAL P L                 +        G        +  +P G +G +   
Sbjct: 182 AITLALEPSL-------------ESKQQPLPDPAPAGPIHSPEDFRRRHPDGRMGSHPSL 228

Query: 230 ATVKKGEGLLSYFANCFIQLLNDI 253
           AT K G   L   A   +  L   
Sbjct: 229 ATAKDGRRFLDVAATGLVADLERF 252


>gi|73538948|ref|YP_299315.1| creatininase [Ralstonia eutropha JMP134]
 gi|72122285|gb|AAZ64471.1| Creatininase [Ralstonia eutropha JMP134]
          Length = 251

 Score =  161 bits (408), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 51/253 (20%), Positives = 86/253 (33%), Gaps = 25/253 (9%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        ++   +V+P+G+ EQHGP   + TD +    +A   +        +   P 
Sbjct: 7   TWAEIEQFLKRSRTIVIPIGSNEQHGPTGLLGTDWLCPEIIAREAEREKAAD--ILVGPT 64

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             IG +  H+   GT +L  +  I        ++   G  KI+ LN HGGN   +    +
Sbjct: 65  FNIGMAQHHLGFPGTISLRPSTFIAAIGDWTRSLVGHGFEKILFLNGHGGNIASIEAAFS 124

Query: 130 EARMRFS--------MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           E     S         L +   W    + +       T  G H    E ++     P  +
Sbjct: 125 EIYAEASFAGRRAGFALKLCNWWDLEGVGELAREQFPTGHGSHATPSEIAITQWAFPAAI 184

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
           K+                   +   G        +   P G +G +   AT +KGE L+ 
Sbjct: 185 KL-------------ADYAPKIAPSGPIREAHDFRARFPDGRIGSDPGLATPEKGEALVR 231

Query: 241 YFANCFIQLLNDI 253
             A    Q L+  
Sbjct: 232 LAARSLAQELDSF 244


>gi|186471828|ref|YP_001863146.1| creatininase [Burkholderia phymatum STM815]
 gi|184198137|gb|ACC76100.1| Creatininase [Burkholderia phymatum STM815]
          Length = 249

 Score =  161 bits (407), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 48/258 (18%), Positives = 85/258 (32%), Gaps = 27/258 (10%)

Query: 11  SLPLCADARKDWIVVL-PLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        K    ++ P+G+ EQHGP   + TD +    +A            +   P 
Sbjct: 7   TWAEIEQYLKRSRAIVVPIGSNEQHGPTGLLGTDWLCPEIIAREA----EKTADILVAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             IG +  H+   GT +L  +  I      I ++   G ++I+ LN HGGN   +    +
Sbjct: 63  FNIGMAQHHLGFPGTISLRPSTFIAAIGDWIRSLATHGFQQILFLNGHGGNIASIEAAFS 122

Query: 130 EAR-------MRFSMLVVSTSWSRFTIPQGIISF-PETEIGIHGGEIETSMMLALAPHLV 181
           EA              +   +W        +         G H    E ++     P  +
Sbjct: 123 EAYVEASFAKRHAGFAMKLCNWWDLEGVGELARKQFPEGHGSHATPSEIAITQWAYPDAI 182

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
           K                    +   G        +   P G +G +   A+ +KG  L+ 
Sbjct: 183 K-------------SADYSPKIAPSGPIREALDFRARYPDGRMGSDPAQASPEKGGELVR 229

Query: 241 YFANCFIQLLNDINSFDV 258
             A+  ++ LN   S  +
Sbjct: 230 MAASSLVRELNAFASEPL 247


>gi|302555376|ref|ZP_07307718.1| creatininase [Streptomyces viridochromogenes DSM 40736]
 gi|302472994|gb|EFL36087.1| creatininase [Streptomyces viridochromogenes DSM 40736]
          Length = 242

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 58/243 (23%), Positives = 99/243 (40%), Gaps = 19/243 (7%)

Query: 11  SLPLCA---DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           +              + VLP+G++EQHGP+LP+ TDT++A  +A  I    P    V  +
Sbjct: 9   TTEDVRTRSAGVSRQVAVLPVGSFEQHGPYLPLATDTLVACAVAREIAGAYP----VHLL 64

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P   I  S EH    GT +++          I  ++R+ G+  +V++N HGGN  L ++V
Sbjct: 65  PPVTISCSHEHAGWPGTVSISSVTLHAVVRDIAASLRRSGVDALVVVNGHGGNYVLGNVV 124

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
              +     M +   +       +           +H GEIETS++L   P +++     
Sbjct: 125 QESSARGERMALFPAAEDWEAARERAGVVTSLLTDMHAGEIETSILLHAHPEMLRP---- 180

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
                         ++     H     M      GV+G     + +KG+ LL+  A+ F 
Sbjct: 181 --------GYETSDFVADDRRHLLTLGMSGYTDSGVIGRPSLGSAEKGKELLASLADSFG 232

Query: 248 QLL 250
              
Sbjct: 233 AYF 235


>gi|298247041|ref|ZP_06970846.1| Creatininase [Ktedonobacter racemifer DSM 44963]
 gi|297549700|gb|EFH83566.1| Creatininase [Ktedonobacter racemifer DSM 44963]
          Length = 254

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 48/253 (18%), Positives = 84/253 (33%), Gaps = 18/253 (7%)

Query: 4   LIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
              F D +       A++ W+ ++P G  EQ GPHLP++ DT  A  L            
Sbjct: 8   SKRFGDLTYQEIGKRAQQGWLAIIPTGCTEQQGPHLPVDFDTWFAEALMVAAAEKAAQDS 67

Query: 63  PV--TCMPVEPIGYSIEHMYVD-GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
            V    +P  P G + EH     G   +  +       A + ++   G +++VI    GG
Sbjct: 68  AVQAVVLPAMPFGPTPEHRNFGSGFIDVPVSLHDALVEATLTSLVTQGFKRMVIWRGCGG 127

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
               ++ V      R+     +                      H     TS+ L L P 
Sbjct: 128 --HALNGVVERFNQRYQGKAQAFLPPHPFHEIWCRLADPVIPVGHADSFTTSISLYLRPE 185

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            V+ +   N  S + ++                      +  GV+G+   A+ + G+ L 
Sbjct: 186 TVRQEWITNPHSTEVDWNDPN------------LDFARYSSTGVIGDPTYASAELGKRLW 233

Query: 240 SYFANCFIQLLND 252
                    +L +
Sbjct: 234 EAVVEEAAHMLQE 246


>gi|115358012|ref|YP_775150.1| creatininase [Burkholderia ambifaria AMMD]
 gi|115283300|gb|ABI88816.1| Creatininase [Burkholderia ambifaria AMMD]
          Length = 249

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 50/258 (19%), Positives = 84/258 (32%), Gaps = 27/258 (10%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +         +   +V+P+G+ EQHGP   + TD +    +A   +        +   P 
Sbjct: 7   TWSEIEQFLTRSRTIVVPIGSNEQHGPTGLLGTDWLCPEIIAREAEKSAD----ILVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             IG +  H+   GT +L  +  I        ++   G  KI+ LN HGGN   +    +
Sbjct: 63  FNIGMAQHHLGFPGTISLRPSTFIAAIGDWTRSLVAHGFEKILFLNGHGGNVSSIDAAFS 122

Query: 130 E-------ARMRFSMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPHLV 181
           E       AR R    +   +W        +      T  G H    E ++     P  +
Sbjct: 123 ELYAEASFARRRAGFALKLCNWWDLEGVGELAREQFPTGHGAHATPSEIAITQWAFPDSI 182

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
           K                    +   G        +   P G +G +   AT +KG  L+ 
Sbjct: 183 K-------------SADYAPPIANTGPIRDALDFRARFPDGRIGSDPGLATREKGRALVE 229

Query: 241 YFANCFIQLLNDINSFDV 258
             A    + L       +
Sbjct: 230 LAAQSLARELEAFGREPM 247


>gi|329891216|ref|ZP_08269559.1| creatinine amidohydrolase family protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328846517|gb|EGF96081.1| creatinine amidohydrolase family protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 259

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 52/263 (19%), Positives = 88/263 (33%), Gaps = 34/263 (12%)

Query: 11  SLPLCADARKD-----WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
           S P   +  K        V++P+G+ EQHGP   + TD +    +A   +        + 
Sbjct: 7   SWPEIDERLKSGALLSKTVIVPIGSNEQHGPTGLLGTDWLCPEIIAHAAEK---GDDSLI 63

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
             P   IG +  H+   GT TL  +  +      + ++ + G  +I  LN HGGN   + 
Sbjct: 64  VTPTFNIGMAQHHLAFPGTITLRPSTFMAAIADWVSSLTRHGFERIYFLNGHGGNVATIE 123

Query: 126 IVSTE-----------ARMRFSMLVVSTSWSRFTIPQGIISF-PETEIGIHGGEIETSMM 173
               E              R   ++   +W      Q +      T  G H    E ++ 
Sbjct: 124 AAFAEIYADWSFTPEPWAERPPFVLKLRNWWDLPGVQKLCEDIFPTGHGSHATPSEIAVT 183

Query: 174 LALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATV 232
            A  P  +K                    +   G        +   P G +G +   AT 
Sbjct: 184 QAGYPDRIKT-------------ADYEPKIAPFGPIRDANDYRARFPDGRIGSDPAQATP 230

Query: 233 KKGEGLLSYFANCFIQLLNDINS 255
           +KG+ ++       I+ L D   
Sbjct: 231 EKGQRIIDAAVPALIRDLTDFAQ 253


>gi|39996821|ref|NP_952772.1| creatinine amidohydrolase [Geobacter sulfurreducens PCA]
 gi|39983709|gb|AAR35099.1| creatinine amidohydrolase [Geobacter sulfurreducens PCA]
 gi|298505830|gb|ADI84553.1| creatinine amidohydrolase superfamily protein [Geobacter
           sulfurreducens KN400]
          Length = 239

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 62/255 (24%), Positives = 100/255 (39%), Gaps = 21/255 (8%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +I    ++    +  R    V++P G+ E+HG HLP++TDTI A  + ++   ++P    
Sbjct: 1   MIIETMTMVEFEEGLRATRTVLVPFGSVEEHGSHLPLSTDTIQAYEVGKKAARLIP---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP- 122
           +   P    G         GT ++T          I+ ++ + G+R ++IL  H G S  
Sbjct: 57  LFVAPPVHYGSCRSTSCHPGTISITTGTLKSLMKDIVRSLYQQGLRNVIILTGHAGGSHR 116

Query: 123 -LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +     E       L ++             S  ETE   H GEIETS ++   P LV
Sbjct: 117 MALQDAGEELLPELPELNIAVVTEYELAYHEGKSIIETEGDSHAGEIETSRIMHSHPDLV 176

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           K      F S     L   K              +   P GV G+   A+V+KG  +   
Sbjct: 177 KGCAEREFPSFPPGLLVRNK--------------RKYWPGGVWGDPSKASVEKGRLIEDL 222

Query: 242 FANCFIQLLNDINSF 256
                +QL   + +F
Sbjct: 223 VVAKIVQLARTLEAF 237


>gi|54025178|ref|YP_119420.1| hypothetical protein nfa32090 [Nocardia farcinica IFM 10152]
 gi|54016686|dbj|BAD58056.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 233

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 97/242 (40%), Gaps = 28/242 (11%)

Query: 8   TDNSLPLCADARKDWIVV-LPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
            D + P         +++ +P GA EQHGPHLP++TDT IA  L   + +       V  
Sbjct: 3   ADITSPEAGAYAAAGVILAIPFGATEQHGPHLPLSTDTDIAVALCAELAARRGD---VLV 59

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126
            P  P G S EH    GT ++         + +  +       +I++++ HGGN   +  
Sbjct: 60  APPVPYGSSGEHAGFPGTLSIGQRALELLVVELCRSATDT-FARILLVSGHGGNLEPLHR 118

Query: 127 VSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
                R     + V                P      H G  ET++ LAL PH V+MD A
Sbjct: 119 AQALLRSESRDVRVY--------------LPRWRGDAHAGRAETALQLALTPHRVRMDRA 164

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
           E   +R    +     LRA G       ++ ++  GV+G+   A  + G  LL+   +  
Sbjct: 165 EPGDTRPLPEI--LPLLRAGG-------VRAVSGNGVLGDPTGADAEHGRALLAALGDDL 215

Query: 247 IQ 248
             
Sbjct: 216 FD 217


>gi|85704740|ref|ZP_01035841.1| creatinine amidohydrolase; creatininase [Roseovarius sp. 217]
 gi|85670558|gb|EAQ25418.1| creatinine amidohydrolase; creatininase [Roseovarius sp. 217]
          Length = 287

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 60/273 (21%), Positives = 102/273 (37%), Gaps = 33/273 (12%)

Query: 3   PLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
             +   + + P      AR    +++PLG+ EQHG H+PM+ D ++    A R    +  
Sbjct: 25  DTVFAAELAWPEYQRRVARGAVPILIPLGSMEQHGHHMPMHVDVLLPTEFARRAAVEVG- 83

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
                  P    GY     S    +  GT +L  A  +     +I    + G R+I I+N
Sbjct: 84  ---GLVAPPFTYGYKSQQKSGGGNFFPGTTSLDGASLVNALKDVIREFARHGNRQICIVN 140

Query: 116 AHGGNSPLVSIVSTEARMRFSM-------LVVSTSWSRFTIPQGIISFPETEIGI---HG 165
            H  NS  ++     A             +VV + W           +PE  +G    HG
Sbjct: 141 GHFENSWFIAEGIDLALRELGWSGIHDTKVVVLSYWDFVDQAAIAKLYPEGFLGWDIEHG 200

Query: 166 GEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG 225
           G +ETS+ML L P LV ++ A + +         +                     G + 
Sbjct: 201 GVLETSLMLRLYPDLVSLERAVDHAPASFPPYDVYPPHPEWTPA-----------SGTLS 249

Query: 226 NAMDATVKKGEGLLSYFANCFIQLLN-DINSFD 257
           +  +A+ +KG+ L+       +  L  +  + D
Sbjct: 250 SPKNASAEKGDILIDVCTRGIVAALRTEFATRD 282


>gi|167644085|ref|YP_001681748.1| creatininase [Caulobacter sp. K31]
 gi|167346515|gb|ABZ69250.1| Creatininase [Caulobacter sp. K31]
          Length = 249

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/255 (20%), Positives = 85/255 (33%), Gaps = 26/255 (10%)

Query: 11  SLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P           VV+P+G+ EQHGP   + TD +    ++     +      V   P 
Sbjct: 7   TWPEIEAYLATSKTVVVPIGSNEQHGPTGLLGTDWLCPEIISHEASKLSD---TVLVAPT 63

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G +  H+   GT  L  +  I      + ++   G  KI  LN HGGN   +    +
Sbjct: 64  FNVGMAQHHLAFPGTIFLRPSTFIAAIGDWVRSLGAHGFEKIYFLNGHGGNVASIEAAFS 123

Query: 130 EARMRFS--------MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           E    +S         L +   W    +         T  G H    E ++     P  +
Sbjct: 124 EIYADYSFRKARAPFALKLKNWWDLRGVLSLANQQFPTGHGSHATPSEIAVTQWAYPGSI 183

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
           K                    +   G        +     G +G +   AT +KG  L++
Sbjct: 184 KT-------------ADYEPKIAPTGPIREALDFRARYADGRMGSDPAQATPEKGGALVA 230

Query: 241 YFANCFIQLLNDINS 255
             A   I+ L D ++
Sbjct: 231 QAAKSLIEDLADFSA 245


>gi|163795833|ref|ZP_02189797.1| hypothetical protein BAL199_20505 [alpha proteobacterium BAL199]
 gi|159178866|gb|EDP63402.1| hypothetical protein BAL199_20505 [alpha proteobacterium BAL199]
          Length = 248

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 50/264 (18%), Positives = 91/264 (34%), Gaps = 32/264 (12%)

Query: 5   IIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     +     A  + +  +++P+G+ EQHGP   + TD I    +AER    L     
Sbjct: 1   MRLQHMTWMEVDAYLKDNKGIIVPIGSTEQHGPIGLIGTDAICPEVIAERAAETL----N 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               P   +G +  H+   G+  L  +  I      + ++ + G  +   LN HGGN   
Sbjct: 57  CIIGPTISVGMAQHHLAFAGSIALRPSTLILVIRDYVLSLARNGFERFYFLNGHGGNIAT 116

Query: 124 VSIVSTEARMRFSM---------LVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMM 173
                +E     S+              +W  F     +         G H    E ++ 
Sbjct: 117 TQAAFSEIYAETSLNPGWQRPHIRCKLANWFGFPPVTALCKELYGDRDGSHATASEVAVT 176

Query: 174 LALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATV 232
               P  +K    +    R   FL                  + ++P G +G ++  AT 
Sbjct: 177 QFAYPEHIKSVPMDPAPPRPRGFLD-------------ADDYRSIHPDGRIGADSFLATP 223

Query: 233 KKGEGLLSYFANCFIQLLNDINSF 256
           + G  L++  A     ++ D  +F
Sbjct: 224 EAGGRLVAASA---ASVIEDYAAF 244


>gi|218130725|ref|ZP_03459529.1| hypothetical protein BACEGG_02316 [Bacteroides eggerthii DSM 20697]
 gi|217987069|gb|EEC53400.1| hypothetical protein BACEGG_02316 [Bacteroides eggerthii DSM 20697]
          Length = 253

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 64/245 (26%), Positives = 100/245 (40%), Gaps = 12/245 (4%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV--TCMPVEPIG- 73
              K  +V+LP GA E H  HLP  TD I+   +A    ++   R  V    MP  P G 
Sbjct: 17  KDVKYDVVILPWGATEPHNLHLPYLTDCILPHDIAVDAATLALERSGVRCMVMPPVPFGA 76

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           ++     +       Y         I+ ++   GIRK+VIL  HGGN+     +  +  +
Sbjct: 77  HNPGQRELPFCIHTRYTTQQAILEDIVASLYVQGIRKLVILGGHGGNN--FKGMIRDLAV 134

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
            +   ++  +     IP     + E +I  H GE ETS M+   P LV +  A + +SR 
Sbjct: 135 TYPDFLIMATDWFSIIP--TKGYFEADIDDHAGESETSAMMYYHPELVNLAEAGDGASRP 192

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                  + + A     +  +  D    GV GN   A+ +KGE  L         L  ++
Sbjct: 193 FAIASLNEKV-AWTPRHWDKATVD---SGV-GNPKKASAEKGERYLKPVIEKLATLFAEV 247

Query: 254 NSFDV 258
              D+
Sbjct: 248 GQHDL 252


>gi|254421441|ref|ZP_05035159.1| creatininase subfamily [Synechococcus sp. PCC 7335]
 gi|196188930|gb|EDX83894.1| creatininase subfamily [Synechococcus sp. PCC 7335]
          Length = 249

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 28/248 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +     +       ++ P+G+ EQHGP   + TD I A  +A      +         P 
Sbjct: 7   TWLEVEEYLTQSRGIIFPIGSTEQHGPTGLIGTDAICAEAVA----KGVGEATGALVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H+   G+ +L  +  I      +  + + G  +   +N HGGN   +    +
Sbjct: 63  INVGMALHHLAFPGSVSLRPSTLIALIQDYVKPLARHGFERFYFVNGHGGNVASMKAAFS 122

Query: 130 EARM---------RFSMLVVSTSWSRFTIPQGIIS-FPETEIGIHGGEIETSMMLALAPH 179
           E               +     +W        +       + G H    E ++   + P+
Sbjct: 123 ETYAVIADANLPNAGRIRCKIANWYGSKAIAALSEQLYGNQEGSHATPSEVALTQFVYPN 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K        +                S       +   P G +G N   AT + G+  
Sbjct: 183 DIKQASLSPAIAPS------------GRSIYNPTDFRAFYPDGRMGSNPKLATPEHGKQF 230

Query: 239 LSYFANCF 246
                   
Sbjct: 231 YEVAVKDL 238


>gi|115361250|ref|YP_778387.1| creatininase [Burkholderia ambifaria AMMD]
 gi|115286578|gb|ABI92053.1| Creatininase [Burkholderia ambifaria AMMD]
          Length = 259

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 56/259 (21%), Positives = 92/259 (35%), Gaps = 20/259 (7%)

Query: 1   MNPLIIFTDNSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +   +     +    A A       V++P GA EQHGPHLP++ D   A  LA  I + L
Sbjct: 6   LPETLHLARMTYEDVAAALATQFDRVIIPCGAIEQHGPHLPLSMDADHADALAVEIATSL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              L     P    G S  HM   GT +L              ++   G ++I + +AH 
Sbjct: 66  GRTL---IAPTIQAGCSKHHMAFPGTISLQEHTYAALCHDYCVSLATHGFKRIYLFSAHV 122

Query: 119 GNSPLVSIVSTEARMRFS----MLVVSTSWSRFTIPQGIISFPETE---IGIHGGEIETS 171
           GN   +  +    R        +L  +   +     +  +     +   +G H    ETS
Sbjct: 123 GNFNALHAMLPGLRQAVGPDVQVLAYTNHQAWLREWRLAVEKAGGDPASVGGHADIAETS 182

Query: 172 MMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDAT 231
           +M+ L P  V++                   +   G  S       ++  GV+G+A  ++
Sbjct: 183 LMIHLHPDSVRLAQLTAGH-VGVMTTEQLNRMWKEGVAS-------ISRNGVLGDARGSS 234

Query: 232 VKKGEGLLSYFANCFIQLL 250
            + GE  L   A       
Sbjct: 235 REIGEACLRATARLLASAF 253


>gi|312140952|ref|YP_004008288.1| amidase [Rhodococcus equi 103S]
 gi|311890291|emb|CBH49609.1| putative amidase [Rhodococcus equi 103S]
          Length = 230

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 64/257 (24%), Positives = 97/257 (37%), Gaps = 28/257 (10%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +       P     R D  V +P+G++EQHGPHLP++TDT IA  L   +   L     V
Sbjct: 1   MDLARTPWPDVP--RDDLTVAVPVGSFEQHGPHLPLDTDTRIATALTGAVAGAL---TGV 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P    G S EH    GT ++         +    +  +   R++V +N HGGN P +
Sbjct: 56  VTAPAITYGASGEHEGFAGTISIGTEALEALLVEYGRSACRW-ARRVVFVNGHGGNGPAL 114

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
                  R           W    +P             H G  ETS++L L+P  V M 
Sbjct: 115 VKTVELLRYEGRDAA----WLPCAVP---------GADAHAGRTETSLLLHLSPADVTMG 161

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
            AE  +   +        LR+ G       M    P G++G+   AT ++GE L +    
Sbjct: 162 RAEPGN--TAPIADLMPQLRSGG-------MLAATPNGILGDPTGATAEEGERLFADLVR 212

Query: 245 CFIQLLNDINSFDVSIF 261
              + + +         
Sbjct: 213 RAGKAIENWAPRPDGRL 229


>gi|225850043|ref|YP_002730277.1| creatininase [Persephonella marina EX-H1]
 gi|225646136|gb|ACO04322.1| creatininase [Persephonella marina EX-H1]
          Length = 245

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 54/255 (21%), Positives = 92/255 (36%), Gaps = 18/255 (7%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++  + S         +  I+++P+G+ EQH P+  + TD I A  +A  +   +     
Sbjct: 1   MLLENLSYVEVEAYLVEKDIILIPIGSVEQHSPYGLIGTDFITAEAIAREVGRRMD---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +   P    G S  H    GT TL+    I     II+++   G R+I+ +N HGGN   
Sbjct: 57  ILVAPTITYGMSQHHSAFKGTVTLSPVTLINLVKDIINSLLNQGFRRIIFINGHGGNINA 116

Query: 124 VSIVSTEARMRF-SMLVVSTSWSRFTIPQGI-ISFPETEIGIHGGEIETSMMLALAPHLV 181
           V     + +      +    SW      Q +     E + G H    E S+   L P   
Sbjct: 117 VKTAFEQLKYENKPGIYEIISWFLLPEIQEMERDIFEDKNGFHATPSEVSVTKFLRPEAF 176

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV-GNAMDATVKKGEGLLS 240
           +    E     + +                G   K L P G +      A  K G+ ++ 
Sbjct: 177 ETKPKEKKKIEKPDGYFPLS----------GEEFKKLYPDGRMESAPWLAKEKYGKLIME 226

Query: 241 YFANCFIQLLNDINS 255
                 I+ + +I  
Sbjct: 227 EAVRIIIERVKEIAK 241


>gi|172062820|ref|YP_001810471.1| creatininase [Burkholderia ambifaria MC40-6]
 gi|171995337|gb|ACB66255.1| Creatininase [Burkholderia ambifaria MC40-6]
          Length = 249

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/258 (19%), Positives = 84/258 (32%), Gaps = 27/258 (10%)

Query: 11  SLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +         +   +V+P+G+ EQHGP   + TD +    +A   +        +   P 
Sbjct: 7   TWSEIEQLLTRSRTIVVPIGSNEQHGPTGLLGTDWLCPEIIAREAEKSAD----ILVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             IG +  H+   GT +L  +  I        ++   G  KI+ LN HGGN   V    +
Sbjct: 63  FNIGMAQHHLGFPGTISLRPSTFIAAIGDWTRSLVAHGFEKILFLNGHGGNVSSVDAAFS 122

Query: 130 E-------ARMRFSMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPHLV 181
           E       AR R    +   +W        +      T  G H    E ++     P  +
Sbjct: 123 ELYAEASFARRRAGFALKLCNWWDLEGVGELARDQFPTGHGSHATPSEIAITQWAFPDSI 182

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
           K                    +   G        +   P G +G +   AT +KG  L+ 
Sbjct: 183 K-------------SADYAPPIANTGPIRDALDFRARFPDGRIGSDPGLATREKGRALVQ 229

Query: 241 YFANCFIQLLNDINSFDV 258
             A    + L       +
Sbjct: 230 LAAQSLARELEAFGREPM 247


>gi|116748108|ref|YP_844795.1| creatininase [Syntrophobacter fumaroxidans MPOB]
 gi|116697172|gb|ABK16360.1| Creatininase [Syntrophobacter fumaroxidans MPOB]
          Length = 247

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 54/255 (21%), Positives = 95/255 (37%), Gaps = 21/255 (8%)

Query: 5   IIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
            +  + ++   A+ RK    V+LP GA E+HG HLP+ TD + A  LA  +  +      
Sbjct: 2   PLIENVTMSAFAEGRKTCRTVILPCGAVEEHGTHLPLGTDALHAVALAGEVARVAG---- 57

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P    G         GT  +  +        I+    + G+  +++L+ H G + +
Sbjct: 58  VWVAPPIYYGLCRSGSRHPGTIGIRGSTLQCLVEDILRGFHQQGLLNVLVLSGHAGWTHM 117

Query: 124 --VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             ++         F  L ++                ET    H GE+ETS+ML L P  V
Sbjct: 118 AALADACERVLFEFDDLRIAVLSVLDIGAAVWTDLIETPGDSHAGEVETSLMLHLHPECV 177

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
                E + +     L   K              +   P GV GN      +KG+  +  
Sbjct: 178 TGRAPEEYPTFPRHILVRNK--------------QAFWPGGVWGNPAAGNAEKGKLFMER 223

Query: 242 FANCFIQLLNDINSF 256
                ++++  + ++
Sbjct: 224 SVKALVEIIEKLENW 238


>gi|87301900|ref|ZP_01084734.1| hypothetical protein WH5701_01205 [Synechococcus sp. WH 5701]
 gi|87283468|gb|EAQ75423.1| hypothetical protein WH5701_01205 [Synechococcus sp. WH 5701]
          Length = 272

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/263 (19%), Positives = 86/263 (32%), Gaps = 29/263 (11%)

Query: 3   PLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
             I     S P   +  +    V++PLG+ EQHGP   + TD + A  +A  +       
Sbjct: 24  EAIRLQLRSWPEVEEYLRGCKGVIVPLGSTEQHGPTGAIGTDALTAEAVALEVGRRTG-- 81

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
             V   PV+  G +  H+   GT +L  +  +     ++ ++ + G  +I ++N HGGN 
Sbjct: 82  --VLVTPVQAFGMAEHHLGFAGTISLQPSTLLAVIHDVVLSLARHGFERIFVINGHGGNI 139

Query: 122 PLVS---------IVSTEARMRFSMLVVSTSWSRFT-IPQGIISFPETEIGIHGGEIETS 171
                          S        +     +W     + +          G H    E +
Sbjct: 140 ATTRAAFAEAYATAASRGLAGAPGLRCQLANWFMAGPVMREARERYGKREGHHATPSEIA 199

Query: 172 MMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDA 230
           + L L P LV                         G        +  +P G +G +   A
Sbjct: 200 LTLHLEPSLVAKQR-------------PLPEPAPAGPIHGPEDFRRRHPDGRMGSDPFLA 246

Query: 231 TVKKGEGLLSYFANCFIQLLNDI 253
           +   G+  L   A    Q L   
Sbjct: 247 SADDGQRFLELAAEALSQDLETF 269


>gi|302557196|ref|ZP_07309538.1| creatinine amidohydrolase [Streptomyces griseoflavus Tu4000]
 gi|302474814|gb|EFL37907.1| creatinine amidohydrolase [Streptomyces griseoflavus Tu4000]
          Length = 266

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 62/243 (25%), Positives = 103/243 (42%), Gaps = 25/243 (10%)

Query: 11  SLPLCA---DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           +              I VLP+G++EQHGP+LP++TDT+    +A  I   +    PV  +
Sbjct: 25  TTEDVRNRGAGVSRQIAVLPVGSFEQHGPYLPLSTDTL----VACAIARAIADARPVHLL 80

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P   I  S EH    GT +L+          + D++R+ G+  +V++N HGGN  ++   
Sbjct: 81  PPVTISCSHEHAAWPGTVSLSSVTLHAVIRDVADSLRRSGVDALVLVNGHGGNY-VLGNA 139

Query: 128 STEARMRFSMLVVST---SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             E+  R   + +      W    +  G+ +   T   +H GEIETS++L   P L++  
Sbjct: 140 VQESSARGERMALFPAAEDWETARVRAGVATSLLT--DMHAGEIETSILLHTHPELLRP- 196

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
                            ++     H     M      GV+G    A+ +KG+ LL    +
Sbjct: 197 -----------GYETSDHIADDRRHLLTSGMSTYTDSGVIGRPSLASAEKGKKLLESLTD 245

Query: 245 CFI 247
            F 
Sbjct: 246 SFA 248


>gi|222099230|ref|YP_002533798.1| Creatinine amidohydrolase [Thermotoga neapolitana DSM 4359]
 gi|221571620|gb|ACM22432.1| Creatinine amidohydrolase [Thermotoga neapolitana DSM 4359]
          Length = 323

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/268 (19%), Positives = 101/268 (37%), Gaps = 18/268 (6%)

Query: 2   NPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              + +   ++    +  ++  ++++P+G+ E HGP+ P   DT +   +AE++      
Sbjct: 16  PTGVYYQTMTMKQIRERLKECDLIIIPVGSTENHGPNAPTGEDTFLVTRMAEQVALKTG- 74

Query: 61  RLPVTCMPVEPIGY-SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
               T       GY    H+ + GT  +     I++ +++I      G RK ++LN HG 
Sbjct: 75  ---CTVAEPIWYGYHPYHHIGMPGTVPVKDEAFIDYLVSVIAGFWNTGFRKQILLNGHGQ 131

Query: 120 NSPLVSIVST-EARMRFSMLVVSTSWSRFTIPQGIISFPETEIG---IHGGEIETSMMLA 175
              +   +       +   ++++ +W      +              IH  E+ETS  LA
Sbjct: 132 EFVIPVAIHKFAKIFQVPAIIINLNWYHAIQDKFKTKEEGGPYETPFIHADEVETSWSLA 191

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMK--------DLNPKGVVGNA 227
           L P L+  + A +   +      +             W              P+GVVG A
Sbjct: 192 LFPELMHQEWAVDTEPKGFLPEGHIDKAGNLLHRPIAWYGHVGGGPIEVVAYPEGVVGKA 251

Query: 228 MDATVKKGEGLLSYFANCFIQLLNDINS 255
             A+  K +  +    +   +L+ DI  
Sbjct: 252 TLASADKAKEGVEALLDYLEKLVRDIME 279


>gi|320108812|ref|YP_004184402.1| Creatininase [Terriglobus saanensis SP1PR4]
 gi|319927333|gb|ADV84408.1| Creatininase [Terriglobus saanensis SP1PR4]
          Length = 305

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 60/259 (23%), Positives = 99/259 (38%), Gaps = 14/259 (5%)

Query: 4   LIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
            + + + + P    A  +     +LP+G  E+HGPHLP+ +D I A   A          
Sbjct: 41  SVHWEELTGPDFVTAIHQSQSTCILPIGIMEKHGPHLPIGSDLINARYAAIHAAQQ---- 96

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
                 P    G   E  +  GT + +    +    A  D + + G +KI+I+N HGGN+
Sbjct: 97  SYAVVFPEYYFGQISEARHEPGTVSYSRDLQLALLQATTDEMSRNGCKKILIVNGHGGNT 156

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            L+   +     +    VV         P       ++    H GE ETS ++   P LV
Sbjct: 157 SLLPYFAQSQLDKPHDYVV--YLFSQRTPTSGGPKKKSTNDQHAGESETSKLMITRPDLV 214

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
             + A      Q             G ++  W      P    G+   AT + GE  + +
Sbjct: 215 HPERA-----TQESGADQHHLNLPEGVYTGIWWYASF-PDHYAGDGSVATHELGEYQMKW 268

Query: 242 FANCFIQLLNDINSFDVSI 260
           + +   + L  I + DVS+
Sbjct: 269 WVDSVTKSLIAIKADDVSL 287


>gi|317474263|ref|ZP_07933539.1| creatinine amidohydrolase [Bacteroides eggerthii 1_2_48FAA]
 gi|316909573|gb|EFV31251.1| creatinine amidohydrolase [Bacteroides eggerthii 1_2_48FAA]
          Length = 253

 Score =  160 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 64/245 (26%), Positives = 99/245 (40%), Gaps = 12/245 (4%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV--TCMPVEPIG- 73
              K  +V+LP GA E H  HLP  TD I+   +A     +   R  V    MP  P G 
Sbjct: 17  KDVKYDVVILPWGATEPHNLHLPYLTDCILPHDIAVDAAMLALERSGVRCMVMPPVPFGA 76

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           ++     +       Y         I+ ++   GIRK+VIL  HGGN+     +  +  +
Sbjct: 77  HNPGQRELPFCIHTRYTTQQAILEDIVASLYVQGIRKLVILGGHGGNN--FKGMIRDLAV 134

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
            +   ++  +     IP     + E +I  H GE ETS M+   P LV +  A + +SR 
Sbjct: 135 TYPDFLIMATDWFSIIP--TKGYFEADIDDHAGESETSAMMYYHPELVNLAEAGDGASRP 192

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                  + + A     +  +  D    GV GN   A+ +KGE  L         L  ++
Sbjct: 193 FAIASLNEKV-AWTPRHWDKATVD---SGV-GNPKKASAEKGERYLKPVIEKLATLFAEV 247

Query: 254 NSFDV 258
              D+
Sbjct: 248 GQHDL 252


>gi|281411645|ref|YP_003345724.1| Creatininase [Thermotoga naphthophila RKU-10]
 gi|281372748|gb|ADA66310.1| Creatininase [Thermotoga naphthophila RKU-10]
          Length = 323

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 51/268 (19%), Positives = 101/268 (37%), Gaps = 18/268 (6%)

Query: 2   NPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              + +   ++    +  ++  ++++P+G+ E HGP+ P   DT +   +AE++      
Sbjct: 16  PTGVYYQTMTMKQIKERLKECDLIIIPVGSTENHGPNAPTGEDTFLVTRMAEQVALKTG- 74

Query: 61  RLPVTCMPVEPIGY-SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
               T       GY    H+ + GT  +     I++ +++I      G RK ++LN HG 
Sbjct: 75  ---CTVAEPIWYGYHPYHHIGMPGTVPVKDEAFIDYLVSVIAGFWNTGFRKQILLNGHGQ 131

Query: 120 NSPLVSIVST-EARMRFSMLVVSTSWSRFTIPQGIISFPETEIG---IHGGEIETSMMLA 175
              +   +       +   ++++ +W      +              IH  E+ETS  LA
Sbjct: 132 EFVIPVAIHKFAKIFQVPAIIINLNWYHAIQDKFKTKEEGGPYETPFIHADEVETSWSLA 191

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMK--------DLNPKGVVGNA 227
           L P L+  + A +   +      +             W              P+GVVG A
Sbjct: 192 LFPELMHQEWAVDTEPKGFLPEGHIDKAGNLLHRPIAWYGHVGGGPIEVVAYPEGVVGKA 251

Query: 228 MDATVKKGEGLLSYFANCFIQLLNDINS 255
             A+  K +  +    +   +L+ DI  
Sbjct: 252 TLASADKAKEGVEALLDYLEKLVRDIME 279


>gi|290790290|pdb|3LUB|A Chain A, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790291|pdb|3LUB|B Chain B, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790292|pdb|3LUB|C Chain C, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790293|pdb|3LUB|D Chain D, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790294|pdb|3LUB|E Chain E, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790295|pdb|3LUB|F Chain F, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790296|pdb|3LUB|G Chain G, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790297|pdb|3LUB|H Chain H, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790298|pdb|3LUB|I Chain I, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790299|pdb|3LUB|J Chain J, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790300|pdb|3LUB|K Chain K, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
 gi|290790301|pdb|3LUB|L Chain L, Crystal Structure Of Putative Creatinine Amidohydrolase
           (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At
           2.11 A Resolution
          Length = 254

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 60/246 (24%), Positives = 93/246 (37%), Gaps = 14/246 (5%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV--TCMPVEPIG- 73
              K  +++LP GA E H  HLP  TD I+   +A     +   R  V     P  P G 
Sbjct: 17  KELKYDVIILPWGATEPHNLHLPYLTDCILPHDIAVEAAELALSRSGVRCXVXPPVPFGA 76

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           ++     +       YA        I+ ++   G RK++IL+ HGGN+        +   
Sbjct: 77  HNPGQRELPFCIHTRYATQQAILEDIVSSLHVQGFRKLLILSGHGGNN--FKGXIRDLAF 134

Query: 134 RFSML-VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
            +    + + +W     P+G     E EI  H GE ETS+     P LV +  A +  S+
Sbjct: 135 EYPDFLIAAANWFEVVSPKGYF---EAEIDDHAGESETSVXXHYHPELVNLAEAGDGESK 191

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
                   + +         W    +   GV GN   AT +KGE  +         L  +
Sbjct: 192 PFAIASLNEKVAW---VPRHWDKATV-DSGV-GNPKKATAEKGERYVKPIVEKLAGLFEE 246

Query: 253 INSFDV 258
               D+
Sbjct: 247 XAQHDL 252


>gi|329903955|ref|ZP_08273640.1| Creatininase [Oxalobacteraceae bacterium IMCC9480]
 gi|327548185|gb|EGF32895.1| Creatininase [Oxalobacteraceae bacterium IMCC9480]
          Length = 261

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 59/264 (22%), Positives = 96/264 (36%), Gaps = 30/264 (11%)

Query: 3   PLIIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           P +     S     +  +D   +V LP+GA EQHGPHLP+ TD ++AA +A  +   +  
Sbjct: 2   PHVQMDHLSWIAYEERLRDPHAVVFLPVGALEQHGPHLPLGTDALLAAAVAHSVAEQVG- 60

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
                  P    GY          +  GT +L           ++  + + G+R +V+++
Sbjct: 61  ---GIVAPTINYGYKSQPKCGGGQHFPGTTSLDGGTLSAITCDVLAELGRHGVRNVVVMS 117

Query: 116 AHGGNSPLVSIVSTEARMRFS-----MLVVSTSWSRFTIPQGIISFPETEIGI---HGGE 167
            H  N   +      AR R        ++    W   T       FP+   G    H   
Sbjct: 118 GHYENQWFLIEGIDLARRRLGPGSTLNIMRLEYWDFLTEATLAGVFPDGFPGFALEHAAV 177

Query: 168 IETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNA 227
           +ETSMML   P LV++D   +           +                     GV+ +A
Sbjct: 178 METSMMLHYFPQLVQLDKLPDEPPADFPPYDMYPTHTHWVP-----------SSGVLSSA 226

Query: 228 MDATVKKGEGLLSYFANCFIQLLN 251
             AT +KG+ +    A      + 
Sbjct: 227 RGATAEKGKLMADDVATRIAAAVR 250


>gi|149201021|ref|ZP_01877996.1| Creatininase [Roseovarius sp. TM1035]
 gi|149145354|gb|EDM33380.1| Creatininase [Roseovarius sp. TM1035]
          Length = 266

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 61/273 (22%), Positives = 102/273 (37%), Gaps = 33/273 (12%)

Query: 3   PLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
             +   + + P      AR    +++PLG+ EQHG H+PM+ D ++    A R    +  
Sbjct: 4   DTVFAAELAWPEYQRRVARGGVPILIPLGSMEQHGHHMPMHVDVLLPTEFARRAAVEVG- 62

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
                  P    GY     S    +  GT +L  A  +     +I    + G R+I I+N
Sbjct: 63  ---GLVAPPFTYGYKSQQKSGGGNFFPGTTSLDGASLVNALKDVIREFARHGNRQICIVN 119

Query: 116 AHGGNSPLVSIVSTEARMRFSM-------LVVSTSWSRFTIPQGIISFPETEIGI---HG 165
            H  NS  ++     A             +VV + W           +PE  +G    HG
Sbjct: 120 GHFENSWFIAEGIDLALRELGWSGIHDTKVVVLSYWDFVDQAAIAKLYPEGFLGWDIEHG 179

Query: 166 GEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG 225
           G +ETS+ML L P LV ++ A + +         +                     G + 
Sbjct: 180 GVLETSLMLRLYPDLVSLERAVDHAPASFPPYDVYPPHPEWTPA-----------SGTLS 228

Query: 226 NAMDATVKKGEGLLSYFANCFIQLLN-DINSFD 257
           +  +AT +KG+ L+       +  L  +  + D
Sbjct: 229 SPKNATAEKGDILIDVCTRGIVAALRTEFATRD 261


>gi|107027248|ref|YP_624759.1| creatininase [Burkholderia cenocepacia AU 1054]
 gi|116691358|ref|YP_836891.1| creatininase [Burkholderia cenocepacia HI2424]
 gi|105896622|gb|ABF79786.1| Creatininase [Burkholderia cenocepacia AU 1054]
 gi|116649358|gb|ABK09998.1| Creatininase [Burkholderia cenocepacia HI2424]
          Length = 259

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 58/259 (22%), Positives = 98/259 (37%), Gaps = 20/259 (7%)

Query: 1   MNPLIIFTDNSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +   +     +    A A       V++P GA EQHGPHLP++ D   A  LA  I ++L
Sbjct: 6   LPETLHLARMTYEGVAAALATQFDRVIIPCGAIEQHGPHLPLSMDADHADALAVEIATLL 65

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              L     P   +G S  HM   GT +L              ++   G + I + +AH 
Sbjct: 66  GRTL---IAPTIRVGCSKHHMAFPGTISLQEHTYAALCHDYCVSLAAHGFKCIYLFSAHV 122

Query: 119 GNSPLVSIVSTEARMR--FSMLVVSTSWSRFTIPQGIISFPETEI-----GIHGGEIETS 171
           GN   +  +  E R      + V++ +  +  + +  ++  E        G H    ETS
Sbjct: 123 GNFNALHAMLPELRQAVGPDVQVLAYTDHQAWLREWRLAVEEAGGDPESVGGHADIAETS 182

Query: 172 MMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDAT 231
           +M+ L P  V++          +        +   G  S       ++  GV+G+A  ++
Sbjct: 183 LMIHLDPDSVRLARLTAGH-VGAMTTEQLNRMWKEGVAS-------ISRNGVLGDARGSS 234

Query: 232 VKKGEGLLSYFANCFIQLL 250
            + GE  L   A       
Sbjct: 235 REIGEACLRATARLLASAF 253


>gi|120402608|ref|YP_952437.1| creatininase [Mycobacterium vanbaalenii PYR-1]
 gi|119955426|gb|ABM12431.1| Creatininase [Mycobacterium vanbaalenii PYR-1]
          Length = 247

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 69/249 (27%), Positives = 94/249 (37%), Gaps = 19/249 (7%)

Query: 5   IIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
             + D S    ADA R   + VLP+GA EQHG HLP  TDT++A        +       
Sbjct: 2   PNWGDLSRDEVADAARSGAVAVLPVGAIEQHGAHLPTGTDTLLATAAVSAATARTGD--- 58

Query: 64  VTCMPVEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
              +P    G S+ H  +  GT +L+ +        I   +   G RK+VI+NAH  N P
Sbjct: 59  -VGLPAVSYGCSLGHTAHWPGTLSLSVSTMTALVTDIGRWVYTSGFRKLVIVNAHATNGP 117

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
                    R  F  L    +      PQ    +       H    ETSM+L LA  LV 
Sbjct: 118 PTQGALLTLRHEFPSLRTCFASLYDITPQARSGYFSDADDPHANVAETSMLLHLAAGLVA 177

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
           +D A +   R +                  ++M D+   GVVG    A    G  L    
Sbjct: 178 LDRAVDEEDRTA-------------RRVLTYAMPDVTRSGVVGRPTTADAGSGARLFDAI 224

Query: 243 ANCFIQLLN 251
            +    LL 
Sbjct: 225 VDGVTHLLR 233


>gi|318042703|ref|ZP_07974659.1| hypothetical protein SCB01_13399 [Synechococcus sp. CB0101]
          Length = 258

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 53/270 (19%), Positives = 89/270 (32%), Gaps = 29/270 (10%)

Query: 2   NPLIIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              I     S P      ++   V++PLG+ EQHGP   + TD + A  +A  +      
Sbjct: 6   TEEIRLQLRSWPEVETYLQRCKGVIVPLGSTEQHGPTGAIGTDALTAEAVALEV----GR 61

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           R  V   P +  G +  H+   GT +L  +  +     ++ ++ + G  +I ++N HGGN
Sbjct: 62  RSGVLVTPAQAFGMAEHHLGFAGTMSLQPSTLLAVMHDLVLSLARHGFERIYVINGHGGN 121

Query: 121 SPLVSIVSTEAR---------MRFSMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIET 170
                    +A             ++     +W       G+       + G H    E 
Sbjct: 122 IATTKAAFAQAYGTAVSRGLPNAAALRCKLANWFMAPEAMGLARELYGDKEGHHATPSEI 181

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ LAL P L                          G        +  +P G +G +   
Sbjct: 182 AITLALEPSLQSKQR-------------PLPEAAPAGPIHGPDDFRRRHPDGRMGSDPSL 228

Query: 230 ATVKKGEGLLSYFANCFIQLLNDINSFDVS 259
           AT + G   L   A      L        S
Sbjct: 229 ATAEHGSRFLDVAATALTADLQRFLEEPSS 258


>gi|240172706|ref|ZP_04751365.1| creatininase [Mycobacterium kansasii ATCC 12478]
          Length = 246

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/247 (27%), Positives = 106/247 (42%), Gaps = 24/247 (9%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           D +    A   K  I VLP+GA+EQHGP+LP+ TDT+IA  +   I         V  +P
Sbjct: 8   DLTTTDPAATSK--IAVLPVGAFEQHGPYLPLGTDTLIACAVTTAITKHH----RVLQLP 61

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
               G S EH    GT ++  A        I  ++    IR ++++NAHGGN+ L ++V 
Sbjct: 62  PVTFGCSHEHAAYPGTVSIGAATLTAIVTDITQSLTHQQIRGLIVVNAHGGNAVLTNVVQ 121

Query: 129 T----EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
                  +++  +      W+      G+ S       +H GE+ETS++LA  P  ++  
Sbjct: 122 HANQSAHQLKLGLYPSREDWAEARTAAGVTSSNH--DDMHAGELETSILLAAHPDYLR-- 177

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
              +  +       + +YL   G            P GV+G    AT  KG   L +   
Sbjct: 178 ---DGWASSDHSATDRRYLTTLGIGP-------YTPTGVIGYPSQATAAKGRAALDHLGR 227

Query: 245 CFIQLLN 251
               L++
Sbjct: 228 NVATLID 234


>gi|331699420|ref|YP_004335659.1| Creatininase [Pseudonocardia dioxanivorans CB1190]
 gi|326954109|gb|AEA27806.1| Creatininase [Pseudonocardia dioxanivorans CB1190]
          Length = 241

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 60/253 (23%), Positives = 101/253 (39%), Gaps = 31/253 (12%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
            +  + + P   DAR    +V+P+G+ EQHGPHLP++TD  IA  +A     +L     +
Sbjct: 2   PLLRELTWPDLRDAR--PTLVVPVGSVEQHGPHLPLDTDVRIADAVA---AGLLAAEPAL 56

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P    G + EH    GT ++ +       +    +  +    +++ +N HGGN   +
Sbjct: 57  VVAPAVAYGAAGEHEGFPGTVSIGHEALRSLLVEYGRSACRW-AARLLFVNGHGGNVATL 115

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
                  R     +             G I         H G  ETS++ ALAP  V+ D
Sbjct: 116 VEAVDLLRYEGRDV-------------GWIPCAAPGADAHAGRTETSLLAALAPDAVRGD 162

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
            A   +   +        LRA G          ++  GV+G+   A+  +G  LL+   +
Sbjct: 163 RAAPGA--TAPLAELLPALRAGG-------TAAVSANGVLGDPTGASGDEGRALLATVVD 213

Query: 245 CFIQLLNDINSFD 257
                L  + ++D
Sbjct: 214 ---TALAALRAWD 223


>gi|33596750|ref|NP_884393.1| putative creatinine amidohydrolase [Bordetella parapertussis 12822]
 gi|33573451|emb|CAE37436.1| putative creatinine amidohydrolase [Bordetella parapertussis]
          Length = 264

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 54/246 (21%), Positives = 94/246 (38%), Gaps = 10/246 (4%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   +++P+GA EQ+G HL   T+  I  G+A  I      R  +   P+ P+ YS
Sbjct: 13  AYLGKHDTILIPVGAVEQYGAHLATGTELRICEGIATEI----GARTGLAVAPIVPVNYS 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
              +   GT ++      ++   I D++   G R    +N H G+   +  V    R R+
Sbjct: 69  AMFLDYPGTLSVEMRTIEDYLKEIGDSLAGQGFRHFFFINIHAGSLGPIESVCRHLRRRY 128

Query: 136 SMLVVSTS-WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSS--- 191
             +      +S                  H  E+ TS+ LA  P LV M+ A    S   
Sbjct: 129 DAVGGLIDVFSIMRDMAAGRLKTRQSPSGHASEMVTSVALAKFPELVFMERARAAQSLRS 188

Query: 192 --RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
                  + + K      S S    + D +P G  G+   A+ ++G+ +     +   + 
Sbjct: 189 FTEGVNTVSSGKVTLGGSSFSVFSDISDYSPIGTQGDPTQASAEQGQAIWDATVDYMSEA 248

Query: 250 LNDINS 255
               ++
Sbjct: 249 ARKFSA 254


>gi|253570804|ref|ZP_04848212.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251839753|gb|EES67836.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 254

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 98/242 (40%), Gaps = 17/242 (7%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV--TCMPVEPIG-YSIEH 78
            + +LP GA E H  HLP  TD I++  +A         R  V    MP   +G  +   
Sbjct: 21  DLAILPWGAIEPHNLHLPYLTDCILSHDIAVDAALKAWERYGVRCMVMPFVSMGSQNPGQ 80

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
             +       Y         ++ ++   G+R++VI+N HGGN      +  +  + +   
Sbjct: 81  RELPFCVHSRYETQKAILTDVVSSLYTQGMRRLVIVNGHGGN--SFKNMIRDLSVDYPDF 138

Query: 139 VVSTS-WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
           ++++S W R    Q     P    G H  E+ETS+ML     +V M+LA N         
Sbjct: 139 LIASSEWFRVLPVQDYFECP----GDHADEVETSVMLHYHSEMVDMELAGNGK------Y 188

Query: 198 RNFKYLRAHGSHSF-GWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
             F       + ++   + + ++    +GN   AT  KG+      +  + QL  ++   
Sbjct: 189 TPFAINSLRTNVAWIPRNWQKVSTDTGIGNPQSATANKGKRFAEAISERYAQLFKELVRD 248

Query: 257 DV 258
           ++
Sbjct: 249 EL 250


>gi|298384194|ref|ZP_06993754.1| amidase [Bacteroides sp. 1_1_14]
 gi|298262473|gb|EFI05337.1| amidase [Bacteroides sp. 1_1_14]
          Length = 254

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 55/241 (22%), Positives = 99/241 (41%), Gaps = 15/241 (6%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV--TCMPVEPIG-YSIEH 78
            + +LP GA E H  HLP  TD I++  +A         R  V    MP   +G  +   
Sbjct: 21  DLAILPWGAIEPHNLHLPYLTDCILSHDIAVDAALKAWERYGVRCMVMPFVSMGSQNPGQ 80

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
             +       Y         ++ ++   G+R++VI+N HGGN      +  +  + +   
Sbjct: 81  RELPFCVHSRYETQKAILTDVVSSLYTQGMRRLVIVNGHGGN--SFKNMIRDLSVDYPDF 138

Query: 139 VVSTS-WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFL 197
           ++++S W R    Q     P    G H  E+ETS+ML     +V M+LA N        +
Sbjct: 139 LIASSEWFRVLPVQDYFECP----GDHADEVETSVMLHYHSEMVDMELAGNGK-YTPFAI 193

Query: 198 RNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
            + +   A    ++    + ++    +GN   AT  KG+      +  + QL  ++   +
Sbjct: 194 NSLRTNVAWVPRNW----QKVSTDTGIGNPQSATANKGKRFAEAISERYAQLFKELVRDE 249

Query: 258 V 258
           +
Sbjct: 250 L 250


>gi|33600518|ref|NP_888078.1| putative creatinine amidohydrolase [Bordetella bronchiseptica RB50]
 gi|33568117|emb|CAE32030.1| putative creatinine amidohydrolase [Bordetella bronchiseptica RB50]
          Length = 264

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 94/246 (38%), Gaps = 10/246 (4%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
           A   K   +++P+GA EQ+G HL   T+  I  G+A  I      R  +   P+ P+ YS
Sbjct: 13  AYLGKHDTILIPVGAVEQYGAHLATGTELRICEGIATEI----GARTGLAVAPIVPVNYS 68

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
              +   GT ++      ++   I D++   G R    +N H G+   +  V    R R+
Sbjct: 69  AMFLDYPGTLSVEMRTIEDYLKEIGDSLAGQGFRHFFFINIHAGSLGPIESVCRHLRRRY 128

Query: 136 SMLVVSTS-WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194
             +      +S                  H  E+ TS+ LA  P LV M+ A    S +S
Sbjct: 129 DAVGGLIDVFSIMRDMAAGRLKTRQSPSGHASEMVTSVALAKFPELVFMERARAAQSLRS 188

Query: 195 EFLRNF---KYLRAHGSHSFGW--SMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
                          G  SF     + D +P G  G+   A+ ++G+ +     +   + 
Sbjct: 189 FTEGVNTVSSGKVTLGGSSFAVFSDISDYSPIGTQGDPTQASAEQGQAIWDATVDYMSEA 248

Query: 250 LNDINS 255
               ++
Sbjct: 249 ARKFSA 254


>gi|108797841|ref|YP_638038.1| creatininase [Mycobacterium sp. MCS]
 gi|119866935|ref|YP_936887.1| creatininase [Mycobacterium sp. KMS]
 gi|108768260|gb|ABG06982.1| Creatininase [Mycobacterium sp. MCS]
 gi|119693024|gb|ABL90097.1| Creatininase [Mycobacterium sp. KMS]
          Length = 249

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 60/244 (24%), Positives = 98/244 (40%), Gaps = 18/244 (7%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           D S    +D R+  + ++P+GA EQHGP LP+  DTIIA  + ER   +         +P
Sbjct: 13  DLSFTDVSDGRE--VGLVPVGAVEQHGPQLPVGADTIIATAMCERASELTG----APVLP 66

Query: 69  VEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
              +G S  H   + GT +LT A         +      G+R+++ +N H GN+  ++  
Sbjct: 67  AITLGVSFGHGTELPGTLSLTPALLAGIVEQYVHWAALSGLRRLLFVNGHMGNTAALNTA 126

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
           +   R+    + V          Q + +        H    ETS++LA+ P LV +D   
Sbjct: 127 TDHIRLERRDVRVGAVDWWTCDDQVLTAMMADAADAHANCAETSVLLAMRPDLVHLDRMR 186

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
           +                      F ++  +L+  GV G    AT + GE L    A    
Sbjct: 187 DADDEDR-----------TAGLVFRYTATELSRNGVTGKPSLATAELGEQLWKLAAEGIA 235

Query: 248 QLLN 251
             + 
Sbjct: 236 ARVR 239


>gi|218531934|ref|YP_002422750.1| creatininase [Methylobacterium chloromethanicum CM4]
 gi|218524237|gb|ACK84822.1| Creatininase [Methylobacterium chloromethanicum CM4]
          Length = 266

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 91/251 (36%), Gaps = 18/251 (7%)

Query: 4   LIIFTDNSLPLCADARKDWI--VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
            ++++D +        +      +LP+GA EQHGPHL    D ++A  L       +  R
Sbjct: 8   PLLWSDRTWEEIPGDLEAVAGAALLPIGATEQHGPHLGCGMDFVLADLLC----RAVSAR 63

Query: 62  LPVTCMPVEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             V  +P  P G S+ H     GT  L      E    I +     G+R++ ++NAH  N
Sbjct: 64  TRVPMLPALPYGCSLGHSRRWPGTLALDPVVMTELVRQIGEQAYHSGVRRLFLVNAHVTN 123

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           +  +       R     L+V+   +     +   +        H    ET++M A AP L
Sbjct: 124 AAPLRCALELLRAAHDDLMVALVNTATVSERVRAAHFADAEDWHANRAETALMQAQAPAL 183

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+ D                       +  F   +   +  GV G    A+  +G  L +
Sbjct: 184 VREDRIAGADDPDRTQ-----------NLVFAHPVNRTSRNGVTGFPSQASAAEGAELFA 232

Query: 241 YFANCFIQLLN 251
           +       L+ 
Sbjct: 233 WMVEDLTALVR 243


>gi|258620075|ref|ZP_05715114.1| creatinine amidohydrolase [Vibrio mimicus VM573]
 gi|258587433|gb|EEW12143.1| creatinine amidohydrolase [Vibrio mimicus VM573]
          Length = 243

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 58/240 (24%), Positives = 98/240 (40%), Gaps = 14/240 (5%)

Query: 12  LPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEP 71
                  ++  I  LPLGA E HG HLP+ TD+ +A      I  + P   P   +P  P
Sbjct: 9   SEAIKCLKEAEIAFLPLGATEPHGDHLPLGTDSYLAEHFTALIAELFP--YPSVILPTLP 66

Query: 72  IGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
                      G   +         + +   ++  GI  +V++NAH GN   +   +   
Sbjct: 67  YSQVWSLKGFAGAIDIGNELLTHLVVKLAKNMQSYGISTLVVINAHYGNFDALKSAARLL 126

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLAENFS 190
           +   + L V +     ++ + I    E   G +H  EIETS+ LAL    V M LA+   
Sbjct: 127 KENGAELFVFSWPGTDSVIKQIRESKEARKGYMHACEIETSIALALIKDEVDMSLAKENY 186

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
                F  +F YL         W+  + +   ++G+   AT  KG+ ++   +   +++L
Sbjct: 187 PI---FPTHFSYL------PIQWT--EFSQTAILGDPTKATQNKGQIIVEASSKTIVEIL 235


>gi|296168549|ref|ZP_06850353.1| creatininase [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295896612|gb|EFG76251.1| creatininase [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 261

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 57/229 (24%), Positives = 95/229 (41%), Gaps = 25/229 (10%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
             +++PLG+ EQHGPHLP++TDT IA  +A   ++ L     V   P    G S EH   
Sbjct: 46  PSILIPLGSTEQHGPHLPLDTDTRIATAVARGARARLDGDWSV--APAIAYGASGEHQSF 103

Query: 82  DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            GT ++         L    +      R++V +N HGGN   ++   +  R         
Sbjct: 104 AGTISIGTDALTLLLLEYGRSAAGW-ARRLVFVNGHGGNVAALAAAISRLRDEGRD---- 158

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
                     G           H G  ETS++L ++P  V+ D     +  +S       
Sbjct: 159 ---------AGWCPCEAAGGDAHAGHTETSLLLHISPGDVRTDR--WLAGNRSPLPELLP 207

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
            LR  G  +       ++P GV+G+   AT ++G  +L+   +  ++ +
Sbjct: 208 SLRRGGVAA-------VSPVGVLGDPTTATAEEGRRILAEMVDGSVRRV 249


>gi|87125066|ref|ZP_01080913.1| hypothetical protein RS9917_03653 [Synechococcus sp. RS9917]
 gi|86167386|gb|EAQ68646.1| hypothetical protein RS9917_03653 [Synechococcus sp. RS9917]
          Length = 263

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 52/264 (19%), Positives = 85/264 (32%), Gaps = 29/264 (10%)

Query: 2   NPLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              I     + P      +    V+LPLG+ EQHGP   + TD + A  +A      L  
Sbjct: 13  TDAIRLDLQTWPDVEAYLERCRGVILPLGSTEQHGPTGAIGTDALTAEAVALE----LGR 68

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           R  V   P +  G +  H+   GT +L  +  +     ++ ++   G  +I ++N HGGN
Sbjct: 69  RSGVLVTPTQAFGMAEHHLGFAGTMSLQPSTLLSVLHDLVLSLAGHGFERIFVVNGHGGN 128

Query: 121 SPLV---------SIVSTEARMRFSMLVVSTSWSRFT-IPQGIISFPETEIGIHGGEIET 170
                        +  S    +   +     +W     + +          G H    E 
Sbjct: 129 IATAKAAFAQAYGTAASRGLAVAPRLRCKLANWFMAGPVMRRARELYGEREGQHATPSEI 188

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ L L   L +                      A G        +   P G +G +   
Sbjct: 189 ALTLHLHSCLQRKQR-------------PLPEPAACGPIHGPADFRARYPDGRMGSDPSL 235

Query: 230 ATVKKGEGLLSYFANCFIQLLNDI 253
           AT   G  LL   A    + L   
Sbjct: 236 ATPDHGAELLDTAATALREDLETF 259


>gi|240140549|ref|YP_002965029.1| Creatininase [Methylobacterium extorquens AM1]
 gi|240010526|gb|ACS41752.1| Creatininase [Methylobacterium extorquens AM1]
          Length = 266

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 91/251 (36%), Gaps = 18/251 (7%)

Query: 4   LIIFTDNSLPLCADARKDWI--VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
            ++++D +        +      +LP+GA EQHGPHL    D ++A  L       +  R
Sbjct: 8   PLLWSDRTWEEIPGDLEAVAGAALLPIGATEQHGPHLGCGMDFVLADLLC----RAVSAR 63

Query: 62  LPVTCMPVEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             V  +P  P G S+ H     GT  L      E    I       G+R++ ++NAH  N
Sbjct: 64  TRVPMLPALPYGCSLGHSRRWPGTIALDPVVMTELVRQIGSQAYHSGVRRLFLVNAHVTN 123

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           +  +       R     L+V+   +     +   +        H    ET++M A AP L
Sbjct: 124 AAPLRCALELLRAAHDDLMVALINTATVSERVRAAHFADAEDWHANRAETALMQAQAPAL 183

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+ D                       +  F   +   +  GV G+   A+  +G  L +
Sbjct: 184 VREDRIVEADDPDR-----------THNLVFAHPVNRTSRNGVTGSPSQASAAEGAELFA 232

Query: 241 YFANCFIQLLN 251
           +       L+ 
Sbjct: 233 WMVEDLTALVR 243


>gi|254168221|ref|ZP_04875067.1| creatininase subfamily [Aciduliprofundum boonei T469]
 gi|254168421|ref|ZP_04875266.1| creatininase subfamily [Aciduliprofundum boonei T469]
 gi|289595839|ref|YP_003482535.1| Creatininase [Aciduliprofundum boonei T469]
 gi|197622702|gb|EDY35272.1| creatininase subfamily [Aciduliprofundum boonei T469]
 gi|197622730|gb|EDY35299.1| creatininase subfamily [Aciduliprofundum boonei T469]
 gi|289533626|gb|ADD07973.1| Creatininase [Aciduliprofundum boonei T469]
          Length = 239

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 55/254 (21%), Positives = 106/254 (41%), Gaps = 24/254 (9%)

Query: 3   PLIIFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
             + + + +        +K  +V+LP+G+ E HG HLP+NTD +    LAE I       
Sbjct: 2   QRLYWDEYTYAEIEGIIKKQPLVILPVGSVEAHGHHLPLNTDMLQPLWLAEEIAKR---- 57

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
           +    +P    G++       GT ++++         I+  + K  IRKI++L+ H   +
Sbjct: 58  INALILPPIHYGWTQGLSSFPGTISISFDSLRGFVKDILSEVAKHEIRKIMVLSGHASTN 117

Query: 122 PL--VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
            +  + +   +    +  L +      +   Q        E   H G IETS ++A+ P 
Sbjct: 118 HMAALRLACEDVLKEYKDLKIMLLSDYYIAYQ-YRGKLVPEDDSHAGIIETSRIMAIRPE 176

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAH-GSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
           LVK               +N+K+ + H G ++     K++ P     N   A+ + GE L
Sbjct: 177 LVK---------------KNYKFKKNHAGKYTVQVDYKEMVPYATFSNPEGASKELGEKL 221

Query: 239 LSYFANCFIQLLND 252
            +      ++++ +
Sbjct: 222 NNMILEELLKIIKE 235


>gi|302381530|ref|YP_003817353.1| creatininase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192158|gb|ADK99729.1| Creatininase [Brevundimonas subvibrioides ATCC 15264]
          Length = 250

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 46/257 (17%), Positives = 88/257 (34%), Gaps = 26/257 (10%)

Query: 12  LPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVE 70
            P      K    VV+P+G+ EQHGP   + TD +    +A   +        +   P  
Sbjct: 8   WPEIEARLKSAKTVVIPIGSNEQHGPTGLLGTDWMCPEIIAHAAEK---TDDGLVVAPTF 64

Query: 71  PIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTE 130
            IG +  H+   GT +L  +  +      + ++ + G  +I  LN HGGN   +    +E
Sbjct: 65  NIGMAQHHLAFAGTISLRPSTFMAAITDWVSSLHRHGFERIYFLNGHGGNVATIEATFSE 124

Query: 131 ARMR-------FSMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPHLVK 182
                         ++   +W       G+  +   T  G+H    E ++  A  P  +K
Sbjct: 125 LYAEWSFMDEPCPYVLKLRNWWDLPGVMGVCNTLFPTGHGMHATPSEIAVTQAAYPDRIK 184

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLSY 241
                               +   G        +   P G +G +   A+ +KG  ++  
Sbjct: 185 T-------------ADYAPKIAPSGPIRDAADYRARFPDGRIGSDPGQASPEKGRRIIDA 231

Query: 242 FANCFIQLLNDINSFDV 258
                ++ +    +  +
Sbjct: 232 AIPALLKDVAAFANEPL 248


>gi|253700699|ref|YP_003021888.1| creatininase [Geobacter sp. M21]
 gi|251775549|gb|ACT18130.1| Creatininase [Geobacter sp. M21]
          Length = 239

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 59/254 (23%), Positives = 97/254 (38%), Gaps = 21/254 (8%)

Query: 5   IIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++  + ++            V +P G+ E+HG HLP++TDTI A  + +R    +P    
Sbjct: 1   MLIENMTMEEFSRGLTVSKTVYIPFGSVEEHGSHLPLSTDTIEAYEVGKRAAERIP---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP- 122
           +   P    G         GT +++ A        I+ ++   G+   + L  H G S  
Sbjct: 57  LFVAPPVHYGSCRSTSCHPGTISISTATLKSLLKDIVRSLHSHGLTNFIALTGHAGGSHK 116

Query: 123 -LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +     E       + ++         +      ET    H GEIETS ++   PHLV
Sbjct: 117 MALQDAGEELIRELPEINMAVVTEYDLAKEAGAGLIETRGDAHAGEIETSRIMHSHPHLV 176

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           K      + S  +  L   K              +   P GV G+   AT KKG  L S 
Sbjct: 177 KGLAEAEYPSFPTGILVRDK--------------RSFWPGGVWGDPGKATAKKGRQLESL 222

Query: 242 FANCFIQLLNDINS 255
            A+  ++L+  + S
Sbjct: 223 VADKVVELVKTLES 236


>gi|254282683|ref|ZP_04957651.1| creatininase [gamma proteobacterium NOR51-B]
 gi|219678886|gb|EED35235.1| creatininase [gamma proteobacterium NOR51-B]
          Length = 249

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 47/258 (18%), Positives = 88/258 (34%), Gaps = 29/258 (11%)

Query: 11  SLPLCADARKDWIVVL-PLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        +    ++ P+G+ EQHGP   + TD+I    +A+      P    +   P 
Sbjct: 7   TWCEVEAYLERSRAIIVPIGSMEQHGPTGLIGTDSICPEVIAKAAAEDNPD---LLVGPT 63

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G +  H+   G+ TL  +  I        ++R+ G  +I  LN HGGN   ++    
Sbjct: 64  FNVGCAQHHLGFPGSMTLRPSTMIAAIGDWCASLRRHGFERIYWLNGHGGNIATIAAAFV 123

Query: 130 EARMRFSM-----------LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           E     S+           L     W   ++            G H    E ++  A  P
Sbjct: 124 EVYAERSLSGPDSATPPLTLRQRNWWDLPSVMSVCKRLHPQNEGSHATPSEVAITYAAYP 183

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEG 237
             V+              +     + + G  +     +   P G +G +   ATV+ G  
Sbjct: 184 DQVR-------------NVPLQPKVASSGGFTDAEDYRQRFPDGRIGSDPSQATVEAGIE 230

Query: 238 LLSYFANCFIQLLNDINS 255
           ++   A    +  +   +
Sbjct: 231 IIDAAAKALQEDFSAFCA 248


>gi|159044667|ref|YP_001533461.1| hypothetical protein Dshi_2124 [Dinoroseobacter shibae DFL 12]
 gi|157912427|gb|ABV93860.1| hypothetical protein Dshi_2124 [Dinoroseobacter shibae DFL 12]
          Length = 267

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 58/269 (21%), Positives = 95/269 (35%), Gaps = 33/269 (12%)

Query: 1   MN-PLIIFTDNSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           M    +   +   P      +  D  V++PLG+ EQHG H+PM+ D ++    A R+   
Sbjct: 1   MPRSTVFAAEMPWPDYQKRVQSGDVPVLIPLGSMEQHGHHMPMHVDVLLPTEFARRVAEK 60

Query: 58  LPPRLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIV 112
           +         P    GY     S    +  GT +L  A  +     ++    + G+R + 
Sbjct: 61  VG----ALVAPPFTYGYKSHQKSGGGNFFPGTTSLDGASLVNALKDVVKEFVRHGVRNLC 116

Query: 113 ILNAHGGNSPLVSIVSTEARMR------FSMLVVSTSWSRFTIPQGIISFPE----TEIG 162
           I+N H  NS  ++     A           + +V  S+  F     I             
Sbjct: 117 IVNGHFENSWFITEAIDLALRELGWGGVHDVKIVVLSYWDFVDQASIEKLYPNGFLGWDI 176

Query: 163 IHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKG 222
            HGG +ETS+ML L P LV +  A   +         +                     G
Sbjct: 177 EHGGVLETSLMLRLHPDLVSLQDAVEHAPATFPPYDVYPAKPEWTPA-----------SG 225

Query: 223 VVGNAMDATVKKGEGLLSYFANCFIQLLN 251
            + +  +AT +KG+ LL       +  L 
Sbjct: 226 TLSSPKEATAEKGDILLEVCTAGIVNALQ 254


>gi|322368429|ref|ZP_08042998.1| Creatininase [Haladaptatus paucihalophilus DX253]
 gi|320552445|gb|EFW94090.1| Creatininase [Haladaptatus paucihalophilus DX253]
          Length = 252

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 65/252 (25%), Positives = 106/252 (42%), Gaps = 21/252 (8%)

Query: 7   FTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
             ++S P    A  D    V++ +G+ EQHGPHLP+  DT+    LA+RI   L      
Sbjct: 9   LAEHSWPEVEAALDDGRRTVIVAVGSVEQHGPHLPLIMDTLAGDELAKRIAEKLGD---A 65

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P    G S  HM   GT T+  A  ++   A   ++ + G   IV++  HGGN   V
Sbjct: 66  LAAPTVRPGCSGHHMEFPGTITIPAAVLMDLIRAYCKSLDEHGFEHIVLVPTHGGNFAPV 125

Query: 125 SIVSTEARMRFSMLVVS---TSWSRFTIPQGII--SFPETEIGIHGGEIETSMMLALAPH 179
           + V+ E        V++    +       +G+        E  IH G  ET+M+LA+   
Sbjct: 126 NTVAPEVARDIDANVIALADLADLMELQNEGLRKGGVEYQEDVIHAGAAETAMVLAIDEG 185

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           LV+ D  E     +              S       + +   GV+G+  + T + GE +L
Sbjct: 186 LVRTDELEVGHEEEISV-----------SRLLSEGFQSITENGVLGDPREGTTEAGEEIL 234

Query: 240 SYFANCFIQLLN 251
              A+ + + ++
Sbjct: 235 DTVASAYAERID 246


>gi|302337270|ref|YP_003802476.1| creatininase [Spirochaeta smaragdinae DSM 11293]
 gi|301634455|gb|ADK79882.1| Creatininase [Spirochaeta smaragdinae DSM 11293]
          Length = 325

 Score =  158 bits (400), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 50/269 (18%), Positives = 103/269 (38%), Gaps = 24/269 (8%)

Query: 5   IIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           + + + +     +   K+ ++++P+G+ E HG + P   DT +   L E++         
Sbjct: 19  VYYQNMTNKDVEERLEKNDVILIPVGSTENHGANAPYGEDTYLDTRLCEQVALATG---- 74

Query: 64  VTCMPVEPIG-YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            T       G +   H+ + GT  +      ++   +       G RK++++N HG +  
Sbjct: 75  CTVAQPIWYGSHPYHHLGMPGTIMIPEETLADYLCYVFAGFWNTGFRKMIVVNGHGQDYV 134

Query: 123 LVSIVST--EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI--------HGGEIETSM 172
           +   +    +      +++    W+    P+  ++   T+           H  E+E S 
Sbjct: 135 IPLAIHKFGKKFQVPGIVLYVHFWNAARNPETGLTDLATKDQGGVYNTPFVHADEVEQSF 194

Query: 173 MLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGW-------SMKDL-NPKGVV 224
            LAL P L K + A            +      +G     W        M+ +  P+GV+
Sbjct: 195 ALALFPELCKQENAVVTKPSPMLPPGHINNSAENGVGPIKWYNAFGSVGMECICTPEGVI 254

Query: 225 GNAMDATVKKGEGLLSYFANCFIQLLNDI 253
           G+   A  +K    + +  N   +L+NDI
Sbjct: 255 GDPTMADAEKARAGVEHTLNYLEKLVNDI 283


>gi|332653303|ref|ZP_08419048.1| creatininase subfamily [Ruminococcaceae bacterium D16]
 gi|332518449|gb|EGJ48052.1| creatininase subfamily [Ruminococcaceae bacterium D16]
          Length = 243

 Score =  158 bits (400), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 60/258 (23%), Positives = 99/258 (38%), Gaps = 18/258 (6%)

Query: 10  NSLPL-CADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
            +     A   ++  V++P G+ E +GPHLPM TD + A G+AERI             P
Sbjct: 1   MTGEQYLAAIAREPSVIIPTGSCEIYGPHLPMGTDLLAAQGIAERIAQRTG----FLIAP 56

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
              +G S        T  +      ++   ++  +   G+++IV L  H GN   VS ++
Sbjct: 57  AIEMGESSALRAFPCTFAMPRHILEDYLDFLVGKLVSDGVKRIVFLTGHAGNVDTVSYIA 116

Query: 129 TEARMRFSMLVVSTSWSRFT--IPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
            +      +      W RF      GI++   +    H  E  TS+ML L P LV    A
Sbjct: 117 KKYLHTHGLQSCQIDWWRFARTHSDGILTNTGSMAHGHASECGTSVMLHLYPDLVDRRSA 176

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                        F  +  +               G +G A DA+ +KG  L+       
Sbjct: 177 ---LPVTVPTDDAFPDVIQYAP------FSARTENGCIGAAADASAEKGAQLVEVCVERI 227

Query: 247 IQLLNDINSFDVSIFDKD 264
           +  L  +  +D+++   D
Sbjct: 228 LAYLETV--WDITVAPGD 243


>gi|327480612|gb|AEA83922.1| chain F, crystal structure of creatinine amidohydrolase
           (creatininase) [Pseudomonas stutzeri DSM 4166]
          Length = 253

 Score =  158 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 54/261 (20%), Positives = 91/261 (34%), Gaps = 29/261 (11%)

Query: 4   LIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
            +     S        R+  +V LP GA EQHGPHLP+ TD ++A+ ++  + + +    
Sbjct: 2   TVHMDQLSWVDYERRVREGAVVFLPCGATEQHGPHLPLGTDALLASAISADVAARVG--- 58

Query: 63  PVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
                P    GY          +  GT +L  A         +    + G+R++V++  H
Sbjct: 59  -GLVAPALSYGYKSQPKCGGGQHFCGTTSLDGATLSALVRDAVREFHRHGVRRLVLVLGH 117

Query: 118 GGNSPL----VSIVSTEARMRFSMLVV-STSWSRFTIPQGIISFPETEIGI---HGGEIE 169
             N       + +   +      + V+    W           FPE   G    H   IE
Sbjct: 118 YENQWFVAEGIQLALRDLGPDAGLEVMRLEHWDFCHEQTLTDIFPEGFPGFALEHAAVIE 177

Query: 170 TSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMD 229
           TS+ML   P LV M+   + +         +                   P GV+ +A  
Sbjct: 178 TSLMLHFHPQLVAMEKIPDDAPADFPPYDMYPTRTEWVP-----------PSGVLSSARG 226

Query: 230 ATVKKGEGLLSYFANCFIQLL 250
           ++  KG+ L           +
Sbjct: 227 SSAAKGQRLAHDIVEGIAAAV 247


>gi|262172974|ref|ZP_06040651.1| creatinine amidohydrolase [Vibrio mimicus MB-451]
 gi|261890332|gb|EEY36319.1| creatinine amidohydrolase [Vibrio mimicus MB-451]
          Length = 243

 Score =  158 bits (399), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 58/240 (24%), Positives = 98/240 (40%), Gaps = 14/240 (5%)

Query: 12  LPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEP 71
                  ++  I  LPLGA E HG HLP+ TD+ +A      I  + P   P   +P  P
Sbjct: 9   SEAIKCLKEAEIAFLPLGATEPHGDHLPLGTDSYLAEHFTALIAELFP--YPSVILPTLP 66

Query: 72  IGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
                      G   +         + +   ++  GI  +V++NAH GN   +   +   
Sbjct: 67  YSQVWSLKGFAGAIDIGNELLTHLVVKLAKNMQSYGISTLVVINAHYGNFDALKSAARLL 126

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLAENFS 190
           +   + L V +     ++ + I    E   G +H  EIETS+ LAL    V M LA+   
Sbjct: 127 KENGAELFVFSWPGTDSVIKQIRESKEAYKGYMHACEIETSIALALIKDEVDMSLAKENY 186

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
                F  +F YL         W+  + +   ++G+   AT  KG+ ++   +   +++L
Sbjct: 187 PI---FPTHFSYL------PIQWT--EFSKTAILGDPTKATQNKGQIIVEASSKTIVEIL 235


>gi|297203665|ref|ZP_06921062.1| creatininase [Streptomyces sviceus ATCC 29083]
 gi|197717120|gb|EDY61154.1| creatininase [Streptomyces sviceus ATCC 29083]
          Length = 255

 Score =  158 bits (399), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 58/239 (24%), Positives = 97/239 (40%), Gaps = 19/239 (7%)

Query: 11  SLPLCA---DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           +              + VLP+G++EQHGP+LP+ TDT++A  +A  I +  P    V  +
Sbjct: 18  TTEDVRTRGAGVSTQVAVLPVGSFEQHGPYLPLATDTLVACAVAREIAAAYP----VHLL 73

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P   +  S EH    GT +++          I  ++R+ G+  +V++N HGGN  L ++V
Sbjct: 74  PPVTMSCSHEHAAWPGTVSISAVTLHSVVQDIAASLRRSGVEALVVVNGHGGNYVLGNVV 133

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
              +     M +   +    T              +H GEIETS++L   P  ++     
Sbjct: 134 QEASARGERMALFPAAEDWETARTEAGVVTSLLTDMHAGEIETSILLHTHPESLRP---- 189

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                         ++     H     M      GV+G     + +KG+ LL   A  F
Sbjct: 190 --------GYETSDFVADDRRHLLTLGMSGYTDSGVIGRPSLGSAEKGKALLESLAASF 240


>gi|21224950|ref|NP_630729.1| hypothetical protein SCO6654 [Streptomyces coelicolor A3(2)]
 gi|289767779|ref|ZP_06527157.1| creatininase [Streptomyces lividans TK24]
 gi|3334785|emb|CAA19933.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)]
 gi|289697978|gb|EFD65407.1| creatininase [Streptomyces lividans TK24]
          Length = 273

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 63/246 (25%), Positives = 107/246 (43%), Gaps = 25/246 (10%)

Query: 11  SLPLCADA---RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           +     +        + VLP+G++EQHGP+LP+ TDT++A      +   +    PV  +
Sbjct: 16  TSDDVRERGSGLPRQVAVLPVGSFEQHGPYLPLATDTLVA----CAVARAVADAYPVHLL 71

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P   IG S EH    GT +++          I D++R+ G+  +V++N HGGN  ++  V
Sbjct: 72  PPVTIGCSHEHADWPGTVSISAVTLHAVVRDIADSLRRSGVGALVVVNGHGGNY-VLGNV 130

Query: 128 STEARMRFSMLVVST---SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             E+  R   + +      W       G+++   T   +H GEIETS++L   P LV+  
Sbjct: 131 VQESSARGERMALFPAAEDWETARRRAGVVTSLLT--DMHAGEIETSILLHKHPELVRP- 187

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
                            ++     H     M      GV+G     + +KG+ LL   A+
Sbjct: 188 -----------GYEAADFVADDRRHLLSLGMSAYTDSGVIGRPSLGSAEKGKELLESLAD 236

Query: 245 CFIQLL 250
            F + +
Sbjct: 237 SFGEYV 242


>gi|291457462|ref|ZP_06596852.1| creatininase [Bifidobacterium breve DSM 20213]
 gi|291381297|gb|EFE88815.1| creatininase [Bifidobacterium breve DSM 20213]
          Length = 246

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 51/257 (19%), Positives = 91/257 (35%), Gaps = 28/257 (10%)

Query: 8   TDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
              + P   +A+    V++P+G+ EQHG HLP+ TD ++A  +AE +       +  T +
Sbjct: 2   DHMTWPEFKEAKARP-VIVPIGSTEQHGQHLPIGTDAVLATCVAEDLAER----IDGTVL 56

Query: 68  PVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P    GY     S       GT  +     I     ++  +   G  KIV++NAH  N  
Sbjct: 57  PALSYGYKSKPLSGGGPLFPGTIDMNGVTVINQMHDVLSELIADGFTKIVVMNAHFENEA 116

Query: 123 LVSIVSTEARMRFS--MLVVSTSWSRFTIPQGIISFPE-----TEIGIHGGEIETSMMLA 175
            +                +V T+W        I    +          H    ETS+ML 
Sbjct: 117 FIVEAIDLVTRETGGVATIVETNWWDPVPQSVIDKVFDGLVFPGWALEHAAVTETSLMLH 176

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
            AP +V MD     +   ++    +   +                 G + N   ++  +G
Sbjct: 177 YAPEMVHMDRMVEEAGASAKSYVRYPVRQGDVPA-----------HGGLANPAGSSAARG 225

Query: 236 EGLLSYFANCFIQLLND 252
           + +     +    +  +
Sbjct: 226 KLIADACVDAVADICAE 242


>gi|312961570|ref|ZP_07776071.1| creatininase [Pseudomonas fluorescens WH6]
 gi|311284249|gb|EFQ62829.1| creatininase [Pseudomonas fluorescens WH6]
          Length = 248

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 49/259 (18%), Positives = 91/259 (35%), Gaps = 27/259 (10%)

Query: 5   IIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++   ++        +    VV+P+G+ EQHGP   + TD +    +A   +        
Sbjct: 1   MLLHQSTWIEIGQFLERSRTVVIPIGSNEQHGPTGLLGTDWMCPEIIAHEAQK----NAD 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +   P   IG +  H+   GT +L  +  I      + ++   G  KI+ LN HGGN   
Sbjct: 57  ILIGPTFNIGMAQHHLGFPGTISLRPSTFIAAIGDWVRSLAGHGFDKILFLNGHGGNIAT 116

Query: 124 VSIVSTEARMRFS--------MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
           +    +E     S         L +   W    + +          G H    E ++   
Sbjct: 117 IEAAFSELYAEASFARRPAGFALKLVNWWDLEGVNELAHRQFPVGHGSHATPSEIAVTQW 176

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKK 234
             P  +K                    +   G        +   P G +G +   ATV+K
Sbjct: 177 AYPDAIK-------------SADYSPQIANTGPIREALDFRARFPDGRMGSDPALATVEK 223

Query: 235 GEGLLSYFANCFIQLLNDI 253
           G  L++  A+  ++++ + 
Sbjct: 224 GGELVALAASGLVKVVENF 242


>gi|300712290|ref|YP_003738104.1| hypothetical protein HacjB3_14665 [Halalkalicoccus jeotgali B3]
 gi|299125973|gb|ADJ16312.1| hypothetical protein HacjB3_14665 [Halalkalicoccus jeotgali B3]
          Length = 245

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 50/231 (21%), Positives = 93/231 (40%), Gaps = 15/231 (6%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +  +D +    AD+    + +LP+G+ EQHGPH P+ TD   A        +       V
Sbjct: 1   MHLSDATWTD-ADSVDTDLALLPVGSTEQHGPHAPLGTDVETATA--VAEAASEAYDGEV 57

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P  P+G + EH +  GT  ++      +    + ++   G  ++V++N HGGN P +
Sbjct: 58  VVAPAIPVGIAEEHRHFSGTLWVSPDTFRSYVRETVASLAYHGWDRVVVVNGHGGNVPAL 117

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
             V        +   V  +W      Q            HGG +ET+++  + P L++ D
Sbjct: 118 GEVCATICRHDAANAVPYTWFEGVGDQ-------RHDMGHGGPLETALLRWVEPDLIRED 170

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
             +      +E    +         +      +    GVVG+  + + ++G
Sbjct: 171 RIDEAREGAAERWGEWVS-----RVNLAVDSAEFTENGVVGDPEEGSKERG 216


>gi|158336441|ref|YP_001517615.1| creatininase [Acaryochloris marina MBIC11017]
 gi|158306682|gb|ABW28299.1| creatininase [Acaryochloris marina MBIC11017]
          Length = 255

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 40/250 (16%), Positives = 81/250 (32%), Gaps = 29/250 (11%)

Query: 11  SLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        ++   +++P+G+ EQHGP   + TD I A  +A      +         P 
Sbjct: 14  TWLEVETYLQRSQGIIMPIGSTEQHGPTGLIGTDAICAEVIA----KGVGEATEALVGPT 69

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G ++ H    G+ +L  +  +      + ++ + G R+   +N HGGN   +    +
Sbjct: 70  INVGMALHHTEFPGSMSLRPSTLLLVIRDYLVSLARAGFRQFFFINGHGGNVATLKAAFS 129

Query: 130 EARMRFSML---------VVSTSWSRFTIP-QGIISFPETEIGIHGGEIETSMMLALAPH 179
           E     + L             +W   +   Q          G H    E ++   + P 
Sbjct: 130 ETYATIADLNLPEADQTRCRLNNWYMNSQVYQLAKELYGNREGSHATPSEVAVTQFVYPE 189

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGL 238
            +K                    + +        + +   P G +G +   AT + G  L
Sbjct: 190 AIK-------------DAPLNPEVASGHPIYGAANFRQHYPDGRMGSDPSLATPEHGRSL 236

Query: 239 LSYFANCFIQ 248
                    +
Sbjct: 237 YEAAVESIAK 246


>gi|324997220|ref|ZP_08118332.1| hypothetical protein PseP1_00584 [Pseudonocardia sp. P1]
          Length = 239

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 55/247 (22%), Positives = 98/247 (39%), Gaps = 24/247 (9%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           ++  D +        +   VV+P+G+ EQHGPHLP+ TDT+ A+ LA    ++      +
Sbjct: 1   MLLADLTWTEL--TGRAPTVVVPVGSVEQHGPHLPLGTDTLFASVLA---AALHDADPEL 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P    G + EH    GT ++         +    +  +    ++V++N HGGN   +
Sbjct: 56  VLAPALAYGAAGEHEGFPGTVSIGEEALRTVLVEYGRSACRW-ASRLVLVNGHGGNVAAL 114

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
               T  R                        P   +  H G  ETS++  + P LV+ +
Sbjct: 115 RSAVTLLRYEGRDAAWLPC---------SAPVPGVPLDAHAGRYETSLLEHVDPALVRRE 165

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
            A    +R          LRA G  +       ++P GV+G+   A+  +G  +L+   +
Sbjct: 166 HAAAGDTR--PLREVIGELRAGGVAA-------VSPNGVLGDPSGASAAEGGRVLTAIVD 216

Query: 245 CFIQLLN 251
                ++
Sbjct: 217 AASAAID 223


>gi|323486686|ref|ZP_08092007.1| hypothetical protein HMPREF9474_03758 [Clostridium symbiosum
           WAL-14163]
 gi|323400067|gb|EGA92444.1| hypothetical protein HMPREF9474_03758 [Clostridium symbiosum
           WAL-14163]
          Length = 248

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 62/252 (24%), Positives = 106/252 (42%), Gaps = 10/252 (3%)

Query: 3   PLIIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
             +I  + + P      +   + ++P+G+ EQHGP+    TD   AA  AE++      +
Sbjct: 2   DKLIINNMTWPELEAEMEHIKVALVPVGSCEQHGPNTTFATDAARAAAYAEKLAVRCKNK 61

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
             V   P    G S+ HM   GT TL     +   + I  +I + GIRKI+ LNAHGGN 
Sbjct: 62  --VVVFPCVNYGLSLHHMDFPGTVTLQVETMMHLLVDIGVSIAQHGIRKILFLNAHGGNF 119

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           P +       +    +    ++        G+   P+     H  E+ETS  L L P  V
Sbjct: 120 PALEGAVISLKQNHEIDAYWSAVGSEISLGGLTGLPKLN--GHACEVETSSCLYLCPETV 177

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + +              +F      G  ++ W   D +  G +G+A  AT + G+ +   
Sbjct: 178 RSERVPGIIQDSMLTHDSF----VKGGAAWSWK-NDASLNGALGDARKATYEIGKKMTED 232

Query: 242 FANCFIQLLNDI 253
             +   +++++I
Sbjct: 233 SLDYMEKIVDEI 244


>gi|325968777|ref|YP_004244969.1| creatininase [Vulcanisaeta moutnovskia 768-28]
 gi|323707980|gb|ADY01467.1| Creatininase [Vulcanisaeta moutnovskia 768-28]
          Length = 239

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 65/252 (25%), Positives = 112/252 (44%), Gaps = 23/252 (9%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   + +        KD ++++P+G+ EQHGPHLP+ TD+IIA  +AE ++  LP R  V
Sbjct: 1   MRILEITRDDV---PKDSLIIVPIGSVEQHGPHLPLGTDSIIANYVAEEVERRLPSR--V 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              PV  +G S+EH+   GT  + +   I + L  I+ +       +V +N HGGN   +
Sbjct: 56  LLYPVIAVGSSMEHVGFTGTTWVRFENLIHYILDFIEGVSAWDPVGVVFVNGHGGNVDAL 115

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           +IV  E         +   ++        I+      G H   +ETS++ A+   LV+ D
Sbjct: 116 NIVVKEWNYSRRNPRIYHYYAYNRRVIDFITRYFPSFG-HADAVETSLIAAINRDLVRWD 174

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM--DATVKKGEGLLSYF 242
              N              +   G+ +      D++  GVVG+        + G  +L + 
Sbjct: 175 RIIN--------------VDVSGNINIVR-TIDVSRTGVVGSLSRDLVKPEVGSEILRFM 219

Query: 243 ANCFIQLLNDIN 254
            N  ++ + DI 
Sbjct: 220 VNDILRQIQDIY 231


>gi|227546741|ref|ZP_03976790.1| creatinine amidohydrolase; creatininase [Bifidobacterium longum
           subsp. infantis ATCC 55813]
 gi|227212703|gb|EEI80584.1| creatinine amidohydrolase; creatininase [Bifidobacterium longum
           subsp. infantis ATCC 55813]
          Length = 246

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 51/257 (19%), Positives = 90/257 (35%), Gaps = 28/257 (10%)

Query: 8   TDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
              + P   + +    V++P+G+ EQHG HLP+ TD ++A  +AE +       +  T +
Sbjct: 2   DHMTWPEFKEVKTHP-VIVPIGSTEQHGQHLPIGTDAVLATRVAEDLAER----IDGTVL 56

Query: 68  PVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P    GY     S       GT  +     I     ++  +   G  KIV++NAH  N  
Sbjct: 57  PTLSYGYKSKPLSGGGPLFPGTIDMNGVTVITQMHDVLSELIADGFTKIVVMNAHFENEA 116

Query: 123 LVSIVSTEARMRFS--MLVVSTSWSRFTIPQGIISFPE-----TEIGIHGGEIETSMMLA 175
            +                +V T+W        I    +          H    ETS+ML 
Sbjct: 117 FIVEAIDLVTRETGGVATIVETNWWDPVPQSVIDKVFDGLVFPGWALEHAAVTETSLMLH 176

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
            AP LV MD     +   ++    +   +                 G + N   ++ ++G
Sbjct: 177 YAPELVHMDRMVEEAGATAKSYVRYPVRQGDVPA-----------HGGLANPAGSSAERG 225

Query: 236 EGLLSYFANCFIQLLND 252
             +         ++  +
Sbjct: 226 RLIAEACVGAVAEICAE 242


>gi|329954552|ref|ZP_08295643.1| creatininase [Bacteroides clarus YIT 12056]
 gi|328527520|gb|EGF54517.1| creatininase [Bacteroides clarus YIT 12056]
          Length = 256

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 62/245 (25%), Positives = 99/245 (40%), Gaps = 12/245 (4%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV--TCMPVEPIG- 73
              K  +V+LP GA E H  HLP  TD I+   +A    ++   R  V    MP  P G 
Sbjct: 20  KDVKYDVVILPWGATEPHNLHLPYLTDCILPHDIAVDAAALALERSGVRCMVMPPVPFGA 79

Query: 74  YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARM 133
           ++     +       YA        I+ ++   GIRK++I++ HGGN+     +  +   
Sbjct: 80  HNPGQRELPFCIHTRYATQQAILEDIVASLHAQGIRKLIIISGHGGNN--FKGMIRDLAF 137

Query: 134 RFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQ 193
            +   ++  +     +P     + E  I  H GE ETS M+   P LV +D A N  SR 
Sbjct: 138 VYPDFLILATDWFGIVP--TKGYFEAAIDDHAGESETSAMMYYHPELVNLDEAGNGDSRP 195

Query: 194 SEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                  + + A     +  +  D    GV GN   A+ +KG   L         L  ++
Sbjct: 196 FAIASLNEKV-AWAPRHWDKATVD---SGV-GNPGKASAEKGGRYLKPVIEKLATLFEEV 250

Query: 254 NSFDV 258
              ++
Sbjct: 251 GRHEL 255


>gi|84514740|ref|ZP_01002104.1| creatinine amidohydrolase; creatininase [Loktanella vestfoldensis
           SKA53]
 gi|84511791|gb|EAQ08244.1| creatinine amidohydrolase; creatininase [Loktanella vestfoldensis
           SKA53]
          Length = 257

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 58/260 (22%), Positives = 94/260 (36%), Gaps = 32/260 (12%)

Query: 10  NSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
            + P      +  D  +++PLG+ EQHG H+PM+ D ++    A R+   +         
Sbjct: 1   MAWPDYQKRVQNGDVPILIPLGSMEQHGHHMPMHVDVLLPTEFARRVAEQVG----ALVA 56

Query: 68  PVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P    GY     S    +  GT +L  A  +     ++    + G+R + I+N H  NS 
Sbjct: 57  PPFTYGYKSHQKSGGGNFFPGTTSLDGATLVNALKDVVKEFVRHGVRNLCIVNGHFENSW 116

Query: 123 LVSIVSTEARMR------FSMLVVSTSWSRFTIPQGIISFPE----TEIGIHGGEIETSM 172
            ++     A           + VV  S+  F     I              HGG +ETS+
Sbjct: 117 FITEAIDLALRELGWGDIHDVKVVVLSYWDFVDQASIEKLYPNGFLGWDIEHGGVLETSL 176

Query: 173 MLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATV 232
           ML L P LV +  A   +         +                     G + +  +AT 
Sbjct: 177 MLRLHPDLVSLQSAVEHAPATFPPYDVYPAKPEWTPA-----------SGTLSSPKEATA 225

Query: 233 KKGEGLLSYFANCFIQLLND 252
           +KG+ LL       I  L +
Sbjct: 226 EKGDILLDVCTKGIIAALTN 245


>gi|229591003|ref|YP_002873122.1| hypothetical protein PFLU3560 [Pseudomonas fluorescens SBW25]
 gi|229362869|emb|CAY49779.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 248

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 50/259 (19%), Positives = 88/259 (33%), Gaps = 27/259 (10%)

Query: 5   IIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++   ++        +    VV+P+G+ EQHGP   + TD +    +A   +        
Sbjct: 1   MLLHQSTWIEIGQFLERSRTVVIPIGSNEQHGPTGLLGTDWMCPEIIAHEAQQHAD---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +   P   IG +  H+   GT +L  +  I      + ++   G  KI+ LN HGGN   
Sbjct: 57  ILIGPTFNIGMAQHHLGFPGTISLRPSTFIAAIGDWVRSLAGHGFEKILFLNGHGGNIAT 116

Query: 124 VSIVSTEARMRFS--------MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
           +    +E     S         L +   W    +            G H    E ++   
Sbjct: 117 IEAAFSELYAEASFARRPAGFALKLVNWWDLEGVTDLAQRQFPVGHGSHATPSEIAVTQW 176

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKK 234
             P  +K                    +   G        +   P G +G +   ATV+K
Sbjct: 177 AYPESIKT-------------ADYSPQIANTGPIREALDFRARFPDGRMGSDPALATVEK 223

Query: 235 GEGLLSYFANCFIQLLNDI 253
           G  L++  A   ++ +N  
Sbjct: 224 GGELVALAAQGLVKAVNSF 242


>gi|161527730|ref|YP_001581556.1| creatininase [Nitrosopumilus maritimus SCM1]
 gi|160339031|gb|ABX12118.1| Creatininase [Nitrosopumilus maritimus SCM1]
          Length = 240

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 58/232 (25%), Positives = 98/232 (42%), Gaps = 22/232 (9%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           RK  + V+P+G+ EQHGPHLP++TDT I   ++E+I            +P    G S EH
Sbjct: 18  RKRQVAVIPIGSIEQHGPHLPISTDTDIVTAVSEKICEKNG----YLLLPTLSYGVSFEH 73

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI--VSTEARMRFS 136
                  ++           I  ++ +  I+ + I+N H GN   +    V  +   +  
Sbjct: 74  APF-FNLSIRKTTLETVLTDICVSLLENKIKTVFIINGHHGNQNSIKNIDVKLKKISKNR 132

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           + V   S+  +                H G +ETS+MLA++   VKM LA+     +   
Sbjct: 133 LEVFPFSYWHYM----------GRDFDHAGFVETSLMLAVS-KNVKMKLAKKGLITEKMT 181

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
            +  K +    + SF  + K     GV G+   A+ K G+ +L+       +
Sbjct: 182 KQEIKKVVKLATKSFPKATK----NGVWGDPTKASKKDGQEILAEIVRNLGK 229


>gi|119719731|ref|YP_920226.1| creatininase [Thermofilum pendens Hrk 5]
 gi|119524851|gb|ABL78223.1| Creatininase [Thermofilum pendens Hrk 5]
          Length = 303

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 59/272 (21%), Positives = 110/272 (40%), Gaps = 24/272 (8%)

Query: 3   PLIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
             I     ++       +K+ IV++P G+ E HG       DTII A +AER+       
Sbjct: 18  EKIYLDQMTMSELLERVKKNDIVLVPCGSVESHGLGQATGEDTIIGAYIAERVA----FE 73

Query: 62  LPVTCMPVEPIG-YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             +T  P    G +   H  + GT  +     I++  +++  +   G +KI++ N+H G 
Sbjct: 74  TGITVAPPIFYGSHPSHHYGMPGTIPIKKEAYIDYVTSVVKWLSHAGFKKIILFNSH-GQ 132

Query: 121 SPLVSIVSTEARMRFSMLV-VSTSWSRFTIPQGIISFPETEIG-------IHGGEIETSM 172
             ++ IV  +A +   +   +  +     +   +    E + G       IH  E+E S+
Sbjct: 133 EYVLPIVKDKAIIEEGVKALILVTSWWAWVRDILRQGTELKPGLVLETPFIHADELEASV 192

Query: 173 MLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSH---SFGW------SMKDLNPKGV 223
           +  +AP LV     +   + +   +   K+    G+     FGW            PKG 
Sbjct: 193 LWYVAPKLVDPSKLKESDAEKMVGVIPDKWADKAGNVYGRPFGWYDISAFMEIHHYPKGS 252

Query: 224 VGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           VG    A+ +KGE ++       I+ +  ++ 
Sbjct: 253 VGYPSKASREKGEVVVETAIQRIIEFIEWLHK 284


>gi|149914495|ref|ZP_01903025.1| Creatininase [Roseobacter sp. AzwK-3b]
 gi|149811288|gb|EDM71123.1| Creatininase [Roseobacter sp. AzwK-3b]
          Length = 266

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 56/266 (21%), Positives = 97/266 (36%), Gaps = 32/266 (12%)

Query: 3   PLIIFTDNSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
             +   +   P      +  +  +++P G+ EQHG H+PM+ D ++    A R+   +  
Sbjct: 4   DTVFAAELPWPDYQRRVRQGNVPILIPFGSMEQHGHHMPMHVDVLLPTEFARRVALEVG- 62

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
                  P    GY          +  GT +L     +     +I    + G R+I I+N
Sbjct: 63  ---GLVAPPFTYGYKSQQKCGGGNFFPGTTSLDGMSLVHALRDVIREFARHGNRQICIVN 119

Query: 116 AHGGNSPLVSIVSTEARMRFSM-------LVVSTSWSRFTIPQGIISFPETEIGI---HG 165
            H  NS  ++     A             +VV + W     P     +PE  +G    HG
Sbjct: 120 GHFENSWFIAEGIDLALRELGWSGIHDTKVVVLSYWDFVDQPAIDRLYPEGFLGWDIEHG 179

Query: 166 GEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG 225
           G +ETS+ML L P LV ++ A + +         +                     G + 
Sbjct: 180 GVLETSLMLRLYPDLVSLERAVDHAPASFPPYDVYPPHPEWTPA-----------SGTLS 228

Query: 226 NAMDATVKKGEGLLSYFANCFIQLLN 251
           +  +A+ +KG+ LL       +  L 
Sbjct: 229 SPRNASAEKGDILLDVCTRGIVAALQ 254


>gi|288959664|ref|YP_003450005.1| creatininase [Azospirillum sp. B510]
 gi|288911972|dbj|BAI73461.1| creatininase [Azospirillum sp. B510]
          Length = 248

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 43/250 (17%), Positives = 79/250 (31%), Gaps = 29/250 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        K    +++P+G+ EQHGP+  + TD I A  +A  +             P 
Sbjct: 7   TWSEVESYLKTSKGIIMPIGSTEQHGPNGLVGTDAICAEVIARGV----GDATGALVGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV-- 127
            P+G ++ HM   G+ TL  +  I      + ++ + G  +   +N HGGN   +     
Sbjct: 63  IPVGMAVHHMEFPGSMTLKPSTLIAVLRDYVGSLVEHGFARFFFVNGHGGNIATIRAAFY 122

Query: 128 -------STEARMRFSMLVVSTSWSRFTIPQGI-ISFPETEIGIHGGEIETSMMLALAPH 179
                  +   R    +     +W        +     + + G H    E ++     P 
Sbjct: 123 EIHAENRAQRGREAPDLRCALVNWWENAEVGRLSRELYQGKEGSHATPSEVALTQYAYPD 182

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGN-AMDATVKKGEGL 238
            +K    E   +               G        +   P G +G+    A  + G  L
Sbjct: 183 SIKTVAMEPEQA-------------PAGGFHDARDFRRRYPDGRIGSAPGLARPEHGRRL 229

Query: 239 LSYFANCFIQ 248
                     
Sbjct: 230 YEAAVGAIAA 239


>gi|260655430|ref|ZP_05860918.1| putative creatinine amidohydrolase [Jonquetella anthropi E3_33 E1]
 gi|260629878|gb|EEX48072.1| putative creatinine amidohydrolase [Jonquetella anthropi E3_33 E1]
          Length = 266

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 42/266 (15%), Positives = 89/266 (33%), Gaps = 20/266 (7%)

Query: 5   IIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     +     +A KD  + + PLG+ EQHG   P+ TD II   +A R+++  P +  
Sbjct: 1   MYLPAMTWHEFQEAAKDDLVALQPLGSTEQHGSIGPLGTDFIIPHEMARRVEAQFPDK-- 58

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V  +P  P G         G+  +          +++  + + G+++ + LN HGGN+  
Sbjct: 59  VVLLPTIPYGVCPSFESFAGSIDIGDEALATILTSVVRDLSRHGVKRFIFLNGHGGNTLP 118

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK- 182
           +     +A     +  +   W      +                 E ++ +A+ P  V  
Sbjct: 119 MERACAKAWDLGGLGAMLDWWKVARELKPEWGGGHGGG------QEAAVSMAVRPDWVNK 172

Query: 183 -----MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG---NA-MDATVK 233
                 +   + S             +   +             G  G   ++   A  +
Sbjct: 173 KKNFVPEKIVHLSDALKSTYGEATTFK-GATVRIVRKADAYTATGTFGGGDDSCAKADPQ 231

Query: 234 KGEGLLSYFANCFIQLLNDINSFDVS 259
            G+ +        I  +++     + 
Sbjct: 232 WGKEIFEGVTAYCIDFVDEFLRVSLE 257


>gi|326384844|ref|ZP_08206519.1| Creatininase [Gordonia neofelifaecis NRRL B-59395]
 gi|326196363|gb|EGD53562.1| Creatininase [Gordonia neofelifaecis NRRL B-59395]
          Length = 237

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 66/252 (26%), Positives = 97/252 (38%), Gaps = 25/252 (9%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M P       +         +  +V+P+GA EQHGPHLP++TD  IA  +A    + L  
Sbjct: 1   MTPATELASRTWHEL--VGTEPTIVVPIGAVEQHGPHLPLDTDHRIAVAVAREAVAALGD 58

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V   P  P G S EH    GT ++         L    +  +    +++ +NAHGGN
Sbjct: 59  SSNVLLAPAIPYGASGEHEGFPGTVSIGREALELVVLEYGRSAMRW-AGRLLFVNAHGGN 117

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
              ++      R                               H G  ETS+ML+LAP  
Sbjct: 118 GQALATAVARLRYEGRDAAFFPCAFP-------------GADAHAGHTETSVMLSLAPDD 164

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+  LA   ++     L     LR  G  +       ++P GV+G+A  A    G  LL+
Sbjct: 165 VRRSLAAAGNTSPIAALLGP--LREGGVAA-------VSPNGVLGDATAADPDHGTELLA 215

Query: 241 YFANCFIQLLND 252
             A+     L D
Sbjct: 216 GLADRLAVGLRD 227


>gi|254418407|ref|ZP_05032131.1| creatininase subfamily [Brevundimonas sp. BAL3]
 gi|196184584|gb|EDX79560.1| creatininase subfamily [Brevundimonas sp. BAL3]
          Length = 257

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 51/260 (19%), Positives = 89/260 (34%), Gaps = 33/260 (12%)

Query: 11  SLPLCADARKD-----WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
           S P               VV+P+G+ EQHGP   + TD +    +A   +        + 
Sbjct: 7   SWPEIDAQIASGRPLSKTVVVPIGSNEQHGPTGLLGTDWLCPEIIAHEAER---SDAALM 63

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
             P   IG +  H+   GT +L  +  +      + ++ + G  +I  LN HGGN   + 
Sbjct: 64  VAPTFNIGMAQHHLAFAGTISLRPSTFMAAITDWVSSLSRHGFERIYFLNGHGGNVATIE 123

Query: 126 IVSTEARM-------RFSMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALA 177
              +E              ++   +W      QG+  S   T  G+H    E ++  A  
Sbjct: 124 ATFSEIYAEWSFVEDEPPFVLKLKNWWDLPGVQGLCNSIFPTGHGMHATPSEIAVTQAAY 183

Query: 178 PHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGE 236
           P  +K                    +   G        +   P G +G +   A  +KG 
Sbjct: 184 PDRIKT-------------ADYSPQIAPSGPIRDALDYRARFPDGRIGSDPAQANPEKGR 230

Query: 237 GLLSYFANCFIQLLNDINSF 256
            ++          L+D+ +F
Sbjct: 231 RIIDLAVPAL---LSDVAAF 247


>gi|183981044|ref|YP_001849335.1| creatinine amidohydrolase [Mycobacterium marinum M]
 gi|183174370|gb|ACC39480.1| Creatinine amidohydrolase [Mycobacterium marinum M]
          Length = 250

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 55/234 (23%), Positives = 92/234 (39%), Gaps = 28/234 (11%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP-----VTCMPVEPIGYSI 76
             +++PLG+ EQHGPHLP++TDT IA  +   + + +  RL          P    G S 
Sbjct: 28  PSILIPLGSTEQHGPHLPLDTDTRIATAVGRAVATRMHGRLTQCQPGWLLAPPIAYGASG 87

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EH    GT ++         L    +       ++V +N HGGN   +     + R    
Sbjct: 88  EHQSFAGTISIGTEALRVLLLEYGRSAACW-ADRLVFVNGHGGNVEALRGAVRQLRAEGR 146

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
                  WS      G           H G  ETS++L ++P +V  D     ++  +  
Sbjct: 147 DA----GWSACGSAGG---------DAHAGHTETSVLLHISPEVVLTDRLSAGNA--APL 191

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
                 LR  G  +       ++P GV+G+   AT  +G  + +   +  +  +
Sbjct: 192 AELLPSLRRGGVAA-------VSPIGVLGDPTTATAVEGRRIFAEMVDDCVSRI 238


>gi|302391723|ref|YP_003827543.1| creatininase [Acetohalobium arabaticum DSM 5501]
 gi|302203800|gb|ADL12478.1| Creatininase [Acetohalobium arabaticum DSM 5501]
          Length = 280

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 62/266 (23%), Positives = 93/266 (34%), Gaps = 24/266 (9%)

Query: 6   IFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
            +   S       A++  I +LPLG+ EQHG HLP   DT+    + E++          
Sbjct: 12  WWQHKSWNEVVEHAKECDIAILPLGSIEQHGHHLPTGHDTLQLFPMLEKVAE----ETGA 67

Query: 65  TCMPVEPIG-YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
             +P    G +   H    GT  L+     +    ++    K G +K ++   HG     
Sbjct: 68  MLLPTPWYGAHPHHHWDFPGTIPLSNDTLDKLIKDVVKGASKAGFKKFILFFGHGQAFVT 127

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
              V+   +       V +   +  I        ET    H  E ETS+ LA     V M
Sbjct: 128 NYTVNDLGKE---GYFVLSVMFQRMIRDVHDDIFETPF-WHADEAETSIALAHFAEYVDM 183

Query: 184 DLAENFSS---------RQSEFLRNFKYLRAHGSHSFGWSMKDLNPK-----GVVGNAMD 229
             A +  +                + K LR           KDL  +     GVVG    
Sbjct: 184 SKAVDMDATSLVDGDFVDGCTDYASSKPLRFDSGTVSAPEYKDLTNEDGELIGVVGKPSL 243

Query: 230 ATVKKGEGLLSYFANCFIQLLNDINS 255
           AT +KG+    Y     I+L+N I  
Sbjct: 244 ATEEKGKEYTDYVVERTIKLVNHIKE 269


>gi|163853129|ref|YP_001641172.1| creatininase [Methylobacterium extorquens PA1]
 gi|163664734|gb|ABY32101.1| Creatininase [Methylobacterium extorquens PA1]
          Length = 266

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 53/249 (21%), Positives = 88/249 (35%), Gaps = 18/249 (7%)

Query: 6   IFTDNSLPLCADARKDWI--VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +++D +        +      +LP+GA EQHGPHL    D ++A  L       +  R  
Sbjct: 10  LWSDRTWEEIPGDLEAVAGAALLPIGATEQHGPHLGCGMDFVLADLLC----RAVSARTR 65

Query: 64  VTCMPVEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           V  +P  P G S+ H     GT  L      E    I +     G+R++ ++NAH  N+ 
Sbjct: 66  VPMLPALPYGCSLGHSRRWPGTLALDPVVMTELVRQIGEQAYHSGVRRLFLVNAHVTNAA 125

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            +       R     L+V+   +     +   +        H    ET++M A AP LV+
Sbjct: 126 PLRCALELLRAAHDDLMVALVNTATVSERVRAAHFADAEDWHANRAETALMQAQAPALVR 185

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
                                    +  F   +   +  GV G    A   +G  L ++ 
Sbjct: 186 EGRIAEADDPDRTQ-----------NLVFAHPVNRTSRNGVTGFPSQANAAEGAELFAWM 234

Query: 243 ANCFIQLLN 251
                 L+ 
Sbjct: 235 VEDLTALVR 243


>gi|124024119|ref|YP_001018426.1| creatininase [Prochlorococcus marinus str. MIT 9303]
 gi|123964405|gb|ABM79161.1| Creatininase [Prochlorococcus marinus str. MIT 9303]
          Length = 262

 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 52/263 (19%), Positives = 84/263 (31%), Gaps = 29/263 (11%)

Query: 3   PLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
             I     S P   D       V+LPLG+ EQHGP   + TD + A  +A  +       
Sbjct: 13  DSIRLALRSWPEVDDYLNHCKGVILPLGSTEQHGPTGAIGTDALTAEAVALEVGRRTG-- 70

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
             V   P +  G +  H+   GT +L  A  +     ++ ++   G  +I ++N HGGN 
Sbjct: 71  --VLVTPTQAFGMAEHHLGFAGTMSLKPATLLALIHDLVMSLANHGFERIFVINGHGGNI 128

Query: 122 PLVSIVSTEARMRF---------SMLVVSTSWSRFTIP-QGIISFPETEIGIHGGEIETS 171
                   +A              +     +W       +        + G H    E +
Sbjct: 129 ATTKAAFAQAYSSAISNDLPVASKLRCKLANWFMAGSVFRAARELYGDQEGQHATPSEIA 188

Query: 172 MMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDA 230
           + L + P L+                         G        +  +P G +G N   A
Sbjct: 189 LTLHIEPSLLSKQR-------------PLPEPAPAGPIHGPEDFRRRHPDGRMGSNPYLA 235

Query: 231 TVKKGEGLLSYFANCFIQLLNDI 253
             + G  LL   A    + L   
Sbjct: 236 KPEHGASLLETAATALSEDLTSF 258


>gi|319782322|ref|YP_004141798.1| creatininase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168210|gb|ADV11748.1| Creatininase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 268

 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 54/259 (20%), Positives = 91/259 (35%), Gaps = 11/259 (4%)

Query: 1   MNPLIIFTDNSLPLCA----DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKS 56
           + P   F   + P             +V+LPLGA EQHGPHLP+  D  +A        +
Sbjct: 10  IPPGSSFALMTSPDTERHATAGVHKPVVILPLGAVEQHGPHLPLGVDCWLA---EAVALA 66

Query: 57  ILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNA 116
               +  +        G S  H    GT +L+    I   + +   + + G    V+LN 
Sbjct: 67  AAEGQASIRVAEPFAYGSSEHHRSFSGTMSLSPQIFIAVLVDLCTCLAEDGFLP-VMLNG 125

Query: 117 HGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           HGGN   + +  T    R  +    + +                   H   +ETS+M+ +
Sbjct: 126 HGGNRAAIQVAITTLGKRGIVTAGFSYFDLIADVAAQALPDAATGTGHACALETSLMMHV 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
               V+ DL        +       +L A  + +     + +   GV+G    A+ + G 
Sbjct: 186 LGDSVRRDLI---PPGGTPPSWPDPHLYAAPAVTVWRRFEAIRDNGVIGTPSQASAEAGS 242

Query: 237 GLLSYFANCFIQLLNDINS 255
            L           + +I S
Sbjct: 243 RLFIAAVERSRAAILNIQS 261


>gi|292494059|ref|YP_003533201.1| probable amidase [Haloferax volcanii DS2]
 gi|291369251|gb|ADE01481.1| probable amidase [Haloferax volcanii DS2]
          Length = 246

 Score =  155 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 60/248 (24%), Positives = 104/248 (41%), Gaps = 16/248 (6%)

Query: 6   IFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGL-AERIKSILPPRLP 63
           +  + +      A  +   VVLP GA EQH  HLP + D+I A  L AE   +     L 
Sbjct: 9   LLAEMTWQEAETAFDEADFVVLPCGATEQHSTHLPTSVDSIRAENLTAELAAAAPEHDLN 68

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +  +PV P GYS  H+   GT +L      E  + +  ++++ G  + ++ N HGGN+  
Sbjct: 69  LLVLPVLPYGYSEHHINYAGTISLGADTYQEIIIDVGRSVQRHGGTRFLVANFHGGNTEP 128

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
             +     +    +      W+ F   Q + +   TE G H GE ETS++    P LV+ 
Sbjct: 129 HKLALDRLQRDHGLDSYYAHWTDFARDQ-LEARFGTEWG-HAGEYETSVIEHCHPDLVRG 186

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
           D     + +    +R + +              DL  +G +G+   +  +  E ++    
Sbjct: 187 DRKTPQTKKNRYEVRQYAH------------FDDLTVEGGLGDPTQSDPEFLEEVIESTT 234

Query: 244 NCFIQLLN 251
           +  +  L 
Sbjct: 235 DRILTHLR 242


>gi|94968660|ref|YP_590708.1| creatininase [Candidatus Koribacter versatilis Ellin345]
 gi|94550710|gb|ABF40634.1| Creatininase [Candidatus Koribacter versatilis Ellin345]
          Length = 293

 Score =  155 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 55/253 (21%), Positives = 90/253 (35%), Gaps = 13/253 (5%)

Query: 4   LIIFTDNSLPLCADARKDW--IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
            + + + +         D      LP+G  E+HGPH+P+ TD +     A         +
Sbjct: 26  SVHWEELTASDFIKGMGDAHNTCALPIGILEKHGPHMPIGTDLLNVRYAALHAAE----K 81

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
             V   P    G   E     GT   +    ++     ++ + + G +KIVI+N HGGN 
Sbjct: 82  EYVIVFPEYYFGQIFEARQEPGTIAYSLDLQLKLLQETVNEMARNGCKKIVIINGHGGNE 141

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            L+ + +          VV   +    +           + +H G  ETS M+   P L+
Sbjct: 142 SLLPLFAQAQLATPKDFVVFV-YGLPRLEVPGRPAKNDSVDMHAGSSETSHMMVTHPELL 200

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           KMD     S R  + L+    L         W      P    G+   AT   GE  ++ 
Sbjct: 201 KMDKVNTESGRDQDRLKLPDSLYTG-----IWWYAKF-PDHFSGDPSKATRALGEFDVNT 254

Query: 242 FANCFIQLLNDIN 254
           + N        + 
Sbjct: 255 WVNSIADAFKAVK 267


>gi|258624876|ref|ZP_05719804.1| creatinine amidohydrolase [Vibrio mimicus VM603]
 gi|258582874|gb|EEW07695.1| creatinine amidohydrolase [Vibrio mimicus VM603]
          Length = 243

 Score =  155 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 58/240 (24%), Positives = 98/240 (40%), Gaps = 14/240 (5%)

Query: 12  LPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEP 71
                  ++  I  LPLGA E HG HLP+ TD+ +A      I  + P   P   +P  P
Sbjct: 9   SEAIKCLKEAEIAFLPLGATEPHGDHLPLGTDSYLAEHFTALISELFP--YPSVILPTLP 66

Query: 72  IGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
                      G   +         + +   ++  GI  +V++NAH GN   +   +   
Sbjct: 67  YSQVWSLKGFAGAIDIGNELLTHLVVKLAKNMQSYGISTLVVINAHYGNFDALKSAARLL 126

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLAENFS 190
           +   + L V +     ++ + I    E   G +H  EIETS+ LAL    V M LA+   
Sbjct: 127 KENGAELFVFSWPGTDSVIKQIRESKEAYKGYMHACEIETSIALALIKDEVDMSLAKENY 186

Query: 191 SRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
                F  +F YL         W+  + +   ++G+   AT  KG+ ++   +   +++L
Sbjct: 187 PI---FPTHFSYL------PIQWT--EFSQTAILGDPTKATQNKGQIIVEASSKTIVEIL 235


>gi|171912648|ref|ZP_02928118.1| Creatininase [Verrucomicrobium spinosum DSM 4136]
          Length = 263

 Score =  155 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 61/251 (24%), Positives = 98/251 (39%), Gaps = 18/251 (7%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
             +     + P  A   +D +++LP+GA EQHGPHLP++TDT+IA    +   ++     
Sbjct: 16  SPVRLERLAWPDAAHTLQD-VLLLPVGAMEQHGPHLPLHTDTVIAESTCQLASALTG--- 71

Query: 63  PVTCMPVEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
               +P      S+ H +   GT +L +   +     I       G  +++I+N+H GN 
Sbjct: 72  -APVLPALGYSVSLGHTVKWPGTFSLFHETLMLTVREIAQWAADTGWNRLLIVNSHYGND 130

Query: 122 PLVSIVSTEARMR-FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
             +       R      L+ +T  +    P+    F       H  E ETS+ML L P  
Sbjct: 131 AALRCAVDRLRHDLGGNLLTATRNTWDLTPEIAGRFTHDAADWHANEAETSLMLFLDPAA 190

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V  +               F +  AH S             GV G     TV++G  L+S
Sbjct: 191 VVKERLSTADDPDRTMGCVFPHRVAHTSL-----------NGVTGRPSLGTVEQGALLIS 239

Query: 241 YFANCFIQLLN 251
              +    L+ 
Sbjct: 240 RMGDALADLIQ 250


>gi|291300801|ref|YP_003512079.1| Creatininase [Stackebrandtia nassauensis DSM 44728]
 gi|290570021|gb|ADD42986.1| Creatininase [Stackebrandtia nassauensis DSM 44728]
          Length = 260

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 67/265 (25%), Positives = 105/265 (39%), Gaps = 11/265 (4%)

Query: 1   MNP-LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M P  +          A    + ++VLP+GA EQHGP LP+ TD  +A  +AE       
Sbjct: 1   MPPDFLRLAAIDRGQVARIAPEAVLVLPIGAIEQHGPSLPLGTDAALAEAVAEAGIEASA 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
              P+   P  P G SI H+      +++          +ID+  + G R+I ILN HGG
Sbjct: 61  TSRPLVLAPTIPYGNSIHHL-FACAGSVSSRTLQLVLADLIDSFVRSGFRRIFILNGHGG 119

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N   V +   +A  R  +++ + S+    +P GI      ++  H G  E S+++A    
Sbjct: 120 NDECVHLAVKDAVNRHPVVLGAASYWTL-VPDGIFPAD--QVPGHAGAFEASLLMAARAD 176

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
           L+  D A       S               +  W+       G   +   A ++ G   L
Sbjct: 177 LLPPDAAAGGPPGSSMVHTGDFGPGVTVVRAGDWATS----GGFTDDPAKADIEAGRECL 232

Query: 240 SYFANCFIQLLNDINSFDVSIFDKD 264
                   Q L+     DVS+ D D
Sbjct: 233 RALGQRLGQALDRFA--DVSLPDDD 255


>gi|116072093|ref|ZP_01469361.1| hypothetical protein BL107_08074 [Synechococcus sp. BL107]
 gi|116065716|gb|EAU71474.1| hypothetical protein BL107_08074 [Synechococcus sp. BL107]
          Length = 262

 Score =  155 bits (392), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 48/268 (17%), Positives = 89/268 (33%), Gaps = 29/268 (10%)

Query: 2   NPLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              I     S P      +    V++PLG+ EQHGP   + TD + A  +A  +      
Sbjct: 12  TEDIRLALRSWPEVETYLQTCKGVIIPLGSTEQHGPTGAIGTDALTAEAIALEVGRRTG- 70

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V   P +  G +  H+   GT +L  A  +     ++ ++ + G  ++ ++N HGGN
Sbjct: 71  ---VLVTPAQAFGMAEHHLGFAGTMSLQPATLLAVMQDLVLSLARHGFERVFVINGHGGN 127

Query: 121 SPLVSIVSTEAR---------MRFSMLVVSTSWSRFT-IPQGIISFPETEIGIHGGEIET 170
                    +A              +    ++W     + +        + G H    E 
Sbjct: 128 IATTKAAFAQAHGTAASRGLPASPHLRCRLSNWFMAGPVMRQARDLYGDKEGHHATPSEI 187

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ L + P L                  + +     G        +  +P G +G +   
Sbjct: 188 AVTLQVEPSLQSKQR-------------DLEDPAPAGPIHGPDDFRRRHPDGRMGSHPSL 234

Query: 230 ATVKKGEGLLSYFANCFIQLLNDINSFD 257
           AT   G  ++   A    + L    S  
Sbjct: 235 ATADHGASIIETAATALSEDLRSFLSDP 262


>gi|226365544|ref|YP_002783327.1| creatininase family protein [Rhodococcus opacus B4]
 gi|226244034|dbj|BAH54382.1| creatininase family protein [Rhodococcus opacus B4]
          Length = 240

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 61/250 (24%), Positives = 94/250 (37%), Gaps = 32/250 (12%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M       D   P          VV+P+G+ EQHGPHLP++TDT IA  ++  +      
Sbjct: 1   MPHSGHLDDAVWPDLVSHV--PTVVVPVGSLEQHGPHLPLDTDTTIADAVSRAL------ 52

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V   P    G S EH    GT +L         +    +  +    +++ +N HGGN
Sbjct: 53  -PHVLVAPPIAYGASGEHEGFPGTVSLGAEALETVLVEYGRSACRW-ADRVLFVNGHGGN 110

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
            P +       R     +     W    +P             H G  ETS++L L+P  
Sbjct: 111 GPALVKAVALLRYEARDVA----WVPCAVP---------GADAHAGRTETSLLLHLSPGR 157

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V++  AE  ++     L     LR  G       M  ++  GV+G+   AT  +G  +  
Sbjct: 158 VRLSRAEPGNTEPVARL--MPRLREGG-------MVAVSANGVLGDPTVATAAEGAQIFG 208

Query: 241 YFANCFIQLL 250
              +     L
Sbjct: 209 VLVHTVTNAL 218


>gi|114568587|ref|YP_755267.1| creatininase [Maricaulis maris MCS10]
 gi|114339049|gb|ABI64329.1| Creatininase [Maricaulis maris MCS10]
          Length = 253

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 54/264 (20%), Positives = 96/264 (36%), Gaps = 29/264 (10%)

Query: 5   IIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++    S P       +   +++P+G+ EQHGP+  + TD I    +     +       
Sbjct: 1   MLLHHASWPEVETYLTRCKGIIIPIGSTEQHGPNGLVGTDAICPEVI----AAEAGAEAG 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +   P   +G +  H+   G+ TL  +  I      I+++ + G  +I  LN HGGN   
Sbjct: 57  LLVGPTFNVGIAQHHLGFAGSMTLRPSTMIAVINDWIESLTRHGFDRIYFLNGHGGNITT 116

Query: 124 VSIVSTEARMRFSMLVVST--------SWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
           ++    E    FS+  V+          W    +            G+H    E S+   
Sbjct: 117 INAAFAEYYANFSLDGVACPVQLMQRNWWELPGVMDTCRKLFPVGEGMHATASEVSVTYY 176

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKK 234
             PH +K              +     +   G  S     ++  P G +G +   AT +K
Sbjct: 177 AHPHAIKQ-------------VEMSPKIAPVGGFSDAADYRERFPDGRIGSDPSQATPEK 223

Query: 235 GEGLLSYFANCFIQLLNDINSFDV 258
           G  ++S+     I    +   FDV
Sbjct: 224 GAEIVSFAKQALIAECVNF--FDV 245


>gi|226939419|ref|YP_002794492.1| Creatininase [Laribacter hongkongensis HLHK9]
 gi|226714345|gb|ACO73483.1| Creatininase [Laribacter hongkongensis HLHK9]
          Length = 258

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 57/252 (22%), Positives = 97/252 (38%), Gaps = 30/252 (11%)

Query: 15  CADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGY 74
            A   +  ++++P+GA EQHGPH+ MN D ++   ++E +      ++     P    GY
Sbjct: 17  AAAHDEGRVLLIPVGAIEQHGPHMSMNVDVLLPTKVSEIVA----GQINGLVAPPIMYGY 72

Query: 75  -----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN----SPLVS 125
                S    ++ GT +L      +    +I    + G R+   +N H  N       + 
Sbjct: 73  KSQQRSGGGHHLCGTTSLDGQTLTDISHTLIREFVRHGFRRFAFVNGHYENNYFLIEGID 132

Query: 126 IVSTEARMRF--SMLVVSTSWSRFTIPQGIIS-FPETEIGI---HGGEIETSMMLALAPH 179
           +   E R      + V+  S+  F     I   +PE   G    HGG +ETS+ML L P 
Sbjct: 133 LALRELRWEGIPDVKVMMLSYWDFVDESTIEKLYPEGFTGWDLEHGGVMETSLMLHLFPE 192

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            V M+  ++           F                   P G + +A  +T +KG+ LL
Sbjct: 193 YVDMERVDHGDPAVLPNYDVFPIKPELTP-----------PSGCLSSAAKSTPEKGKILL 241

Query: 240 SYFANCFIQLLN 251
                  +  + 
Sbjct: 242 DTCTAGIVSAIK 253


>gi|328952196|ref|YP_004369530.1| Creatininase [Desulfobacca acetoxidans DSM 11109]
 gi|328452520|gb|AEB08349.1| Creatininase [Desulfobacca acetoxidans DSM 11109]
          Length = 242

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 60/259 (23%), Positives = 110/259 (42%), Gaps = 24/259 (9%)

Query: 5   IIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++ +  ++P    A      VV+P G+ E+HGPHLP++TDT+ A  +A R+    P    
Sbjct: 1   MLISQLTMPEFEAAMAKTETVVIPFGSVEEHGPHLPLSTDTMHAQEVAARLAKRCP---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG--NS 121
           +        G         GT +++        L +     + G R++++L  H G  + 
Sbjct: 57  MLVAAPVHYGICRSTREHPGTISISGDALRTLALDLGREFYRQGCRRLILLTGHAGGTHV 116

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFP---ETEIGIHGGEIETSMMLALAP 178
             +        +    L ++       + + ++ +P    T    H GE+ET++MLA  P
Sbjct: 117 AALIEAGERLLVELPDLKIAVVNILQLLREVLVQYPGLVHTPGDSHAGEVETAIMLAARP 176

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV            +E+ R  K++       F W      P GV G+   A  ++GE +
Sbjct: 177 ELVS-------GKAPAEWPRFPKFVLVRRKRKF-W------PGGVWGDPTQANAEQGEQI 222

Query: 239 LSYFANCFIQLLNDINSFD 257
           L+      ++LLN +N+ +
Sbjct: 223 LNLEVQFLLELLNTMNNME 241


>gi|325001096|ref|ZP_08122208.1| creatinine amidohydrolase [Pseudonocardia sp. P1]
          Length = 253

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 59/230 (25%), Positives = 95/230 (41%), Gaps = 16/230 (6%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
            +LP+G++EQHGPHLP++TDT++A  LA    + L    PV  +P   I  S EH    G
Sbjct: 37  ALLPVGSHEQHGPHLPLDTDTLVATSLA----ARLGQEYPVRVLPPVAISCSHEHAAWAG 92

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T +++          +  ++R  G+  +V++N HGGN  L ++V   +     M +    
Sbjct: 93  TVSISATTLAAVVGDVAASLRAAGVPALVLVNGHGGNHVLRNVVQEASTGPLPMALFPGG 152

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
                              +H GE+ETS++L   P +V+                   + 
Sbjct: 153 DDWVAARAAGGLVSSHSADMHAGELETSILLHTRPDVVRP------------GFAGADHD 200

Query: 204 RAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                H     ++  +  GVVG    AT  KG  +L      F   L  +
Sbjct: 201 ADERPHMLTLGLQAYSGSGVVGRPSLATEGKGRAVLDALVAGFGDHLRAL 250


>gi|295840516|ref|ZP_06827449.1| creatininase [Streptomyces sp. SPB74]
 gi|197696597|gb|EDY43530.1| creatininase [Streptomyces sp. SPB74]
          Length = 266

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 96/240 (40%), Gaps = 13/240 (5%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
                T+ +     +A  D + +LP+G+ EQH  HLP+ TDT++A  + ER  + L  R 
Sbjct: 2   SHRNLTETTWRETREAAPDAVALLPIGSQEQHAAHLPLGTDTLLAEAVTERALAHLAGRA 61

Query: 63  -------PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
                   V  +P  P G+S  H+      TL+          I+D++   G R+++++N
Sbjct: 62  AEGERVPHVVRLPTLPYGHSPHHL-FAAALTLSAHTLGLVLDEILDSLAATGHRRVLVVN 120

Query: 116 AHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
            HGGN  ++ +      +R  +   + S+     P    +     +  H G  ETS+MLA
Sbjct: 121 GHGGNDEIMRLAVKRFALRAEVTAAACSYWSLGEPAA-DAEHAALVPGHAGWFETSLMLA 179

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
             P LV+  +                Y          W     +      +A  A  ++G
Sbjct: 180 AHPALVRTPVPARAPVTPPPLFDRPPYQGLTTERHGEWERVGGSTD----DASGADAERG 235


>gi|329894076|ref|ZP_08270061.1| Creatininase [gamma proteobacterium IMCC3088]
 gi|328923248|gb|EGG30568.1| Creatininase [gamma proteobacterium IMCC3088]
          Length = 248

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 48/249 (19%), Positives = 86/249 (34%), Gaps = 30/249 (12%)

Query: 11  SLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        K    +++P+G+ EQHGP   + TD I    +A      +     V   P 
Sbjct: 7   TWTDIEQYLKTSDAIIIPIGSMEQHGPTGLIGTDAICPEVIA----KRVGDEHGVLIGPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G +  H+   GT TL  +  I        ++ K G +K+   N HGGN+  +     
Sbjct: 63  FNVGCAQHHLGFPGTMTLRPSTMIAAIADWSLSLAKHGFKKLYWFNGHGGNTATIQAAFA 122

Query: 130 EAR----------MRFSMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAP 178
           E             + ++ + S +W               +  G+H    E ++  A  P
Sbjct: 123 EVYAQRSFEPSPARQPALRMTSKNWWELPSVMAKCKELHPSGDGMHATASEVAVTYAAYP 182

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEG 237
             V+    E               +   GS +     +   P G +G +   AT++ G  
Sbjct: 183 DQVRNQTLE-------------PKIAPIGSFTDAEHYRANFPDGRIGSDPTQATIEAGNT 229

Query: 238 LLSYFANCF 246
           ++   A   
Sbjct: 230 IIDVTAQAL 238


>gi|118616559|ref|YP_904891.1| creatinine amidohydrolase [Mycobacterium ulcerans Agy99]
 gi|118568669|gb|ABL03420.1| Creatinine amidohydrolase [Mycobacterium ulcerans Agy99]
          Length = 250

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 55/234 (23%), Positives = 92/234 (39%), Gaps = 28/234 (11%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP-----VTCMPVEPIGYSI 76
             +++PLG+ EQHGPHLP++TDT IA  +   + + +  RL          P    G S 
Sbjct: 28  PSILIPLGSTEQHGPHLPLDTDTRIATAVGRAVATRMHGRLTQCQPGWLLAPPIAYGASG 87

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EH    GT ++         L    +       ++V +N HGGN   +     + R    
Sbjct: 88  EHQSFAGTISIGAEALRVLLLEYGRSAACW-ADRLVFVNGHGGNVEALRGAVRQLRAEGR 146

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
                  WS      G           H G  ETS++L ++P +V  D     ++  +  
Sbjct: 147 DA----GWSACGSAGG---------DAHAGHTETSVLLHISPEVVLTDRLSAGNA--APL 191

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
                 LR  G  +       ++P GV+G+   AT  +G  + +   +  +  +
Sbjct: 192 AELLPSLRRGGVAA-------VSPIGVLGDPTTATAVEGRRIFAEMVDDCVSRI 238


>gi|329765898|ref|ZP_08257463.1| creatininase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329137604|gb|EGG41875.1| creatininase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 244

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 56/232 (24%), Positives = 96/232 (41%), Gaps = 22/232 (9%)

Query: 19  RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH 78
           +K+ + V+P+G+ EQHGPHLP++TD+ I   +A      L  +     +P    G S EH
Sbjct: 18  KKNQVAVIPIGSIEQHGPHLPISTDSDIVTEVA----KRLSKKKDFLLLPTITYGVSYEH 73

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST--EARMRFS 136
                  ++  +      + +  ++    I+ I I+N H GN   +  +    +      
Sbjct: 74  APF-FNLSIKESTLRSIVIDLCTSLFVNDIKTIFIINGHHGNLKPLKNIDRKLQQISGNR 132

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
           + V S S+  F                H G +ETS+MLA++ + VKM LA+         
Sbjct: 133 LRVFSLSYWHFM----------KREFDHAGFVETSLMLAVS-NNVKMKLAKKGLVTDGMK 181

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
            +  K L      SF      +   G+ G+   A+ K G+ +L        +
Sbjct: 182 QQQIKKLGQLAEISFPK----VTKNGIWGDPRKASKKDGQIILDEIIRNLEK 229


>gi|225388074|ref|ZP_03757798.1| hypothetical protein CLOSTASPAR_01808 [Clostridium asparagiforme
           DSM 15981]
 gi|225045875|gb|EEG56121.1| hypothetical protein CLOSTASPAR_01808 [Clostridium asparagiforme
           DSM 15981]
          Length = 326

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 58/276 (21%), Positives = 108/276 (39%), Gaps = 19/276 (6%)

Query: 3   PLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
             I F + ++    +  +++ I++LP+G+ E HG H     DT +   +AE++       
Sbjct: 22  EPIYFQNMTMKQSEERLKENDILILPIGSTECHGAHACYGEDTFLVTRMAEQVAKKTG-- 79

Query: 62  LPVTCMPVEPIG-YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              T       G +   HM + GT  +      ++   ++      G RKI++LN HG  
Sbjct: 80  --CTVSQPIWFGSHPYHHMGMPGTIPINENTFCDYIAQVLAGFWNAGYRKIILLNGHGQE 137

Query: 121 SPLVSIVSTEAR-MRFSMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMMLAL 176
             + + +   AR  +   ++++ +W         +  P+ +      H  E ETS  LAL
Sbjct: 138 YVIPTAIHQFARKYQVPAVMMNVNWYYAIPEYLKVGDPKCKFETPFNHADEQETSFSLAL 197

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKD--------LNPKGVVGNAM 228
            P ++ M+ A +          +          +  W             NP+GVVG A 
Sbjct: 198 FPEMIHMEDAPDTDLHTFLPPGHIDNAGNIYGRAVKWYCHAGAGTIEVVGNPEGVVGKAK 257

Query: 229 DATVKKGEGLLSYFANCFIQLLNDIN-SFDVSIFDK 263
            AT  K         +   +L+NDI+  +   +  +
Sbjct: 258 LATAGKAIPATEALLDYLEKLVNDIHEKWPAGVLPE 293


>gi|110634210|ref|YP_674418.1| hypothetical protein Meso_1860 [Mesorhizobium sp. BNC1]
 gi|110285194|gb|ABG63253.1| Uncharacterized protein putative amidase-like protein
           [Chelativorans sp. BNC1]
          Length = 273

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 102/267 (38%), Gaps = 13/267 (4%)

Query: 7   FTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
             D +     +   +D ++++PLG+ E+ GPH PM  D +++  LA  +           
Sbjct: 6   LKDMTFVEFRERMAEDPVILVPLGSQEEQGPHAPMG-DFMLSERLAAAVAERSG----AI 60

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
             P  P GY+     + G   L  A         I A    G+R+IV+ N H GN+ L+ 
Sbjct: 61  AAPTIPFGYADVFRGMAGGIQLRPATFCALLEDTIAAFLDHGLRRIVLFNGHTGNAGLID 120

Query: 126 IVSTEARMRFSMLVVSTSWSRFTIPQGIISFPET---EIGIHGGEIETSMMLALAPHLVK 182
               E ++R  +++ S +  +    +             G HG +  TS+     P L++
Sbjct: 121 QTVRELKIRTGLIIPSINIWKAIPHELWTRLHGDLAERAGGHGADPITSVYWHYFPELMR 180

Query: 183 MDLAE--NFSSRQSEFLRNFKYLRAHGS-HSFGWSMKDLNPKGVV-GNAMDATVKKGEGL 238
            DL +    +            +   G   +      D+NP G++ GN+  ++ + G   
Sbjct: 181 PDLQKTSEAAKAFGHEPVGLSAISFQGCEVAVPLDALDVNPHGLIGGNSRLSSAEIGAAF 240

Query: 239 LSYFANCFIQLLNDINSFDVSIFDKDV 265
             +  +   + +    + D +      
Sbjct: 241 AEHIISFAAEFVKHFRNCDPADLRSAP 267


>gi|254549655|ref|ZP_05140102.1| hypothetical protein Mtube_04200 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
          Length = 251

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 92/235 (39%), Gaps = 29/235 (12%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR------LPVTCMPVEPIGYS 75
             +V+PLG+ EQHGPHLP++TDT IA  +A  + + L               P    G S
Sbjct: 28  PSIVIPLGSTEQHGPHLPLDTDTRIATAVARTVTARLHADDLPIAQEEWLMAPAIAYGAS 87

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            EH    GT ++         +    +      R++V +N HGGN   ++      R   
Sbjct: 88  GEHQRFAGTISIGTEALTMLLVEYGRSAACW-ARRLVFVNGHGGNVGALTRAVGLLRAEG 146

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
                   W   T P G           H G  ETS++L L+P  V+ +     +     
Sbjct: 147 RDA----GWCPCTCPGG---------DPHAGHTETSVLLHLSPADVRTERWRAGNRAPLP 193

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
            L     +R  G  +       ++  GV+G+   AT  +G  + +   +  ++ +
Sbjct: 194 VL--LPSMRRGGVAA-------VSETGVLGDPTTATAAEGRRIFAAMVDDCVRRV 239


>gi|299139968|ref|ZP_07033139.1| Creatininase [Acidobacterium sp. MP5ACTX8]
 gi|298598115|gb|EFI54282.1| Creatininase [Acidobacterium sp. MP5ACTX8]
          Length = 290

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 58/254 (22%), Positives = 96/254 (37%), Gaps = 13/254 (5%)

Query: 4   LIIFTDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
              + + + P    A  +     +LP+G  E+HGP LP+ TD +     A    + L   
Sbjct: 25  SPNWEELTGPDFVKAIHQAQGTCILPIGIIEKHGPQLPLGTDLLNVR-FASLNAAKLEY- 82

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
                 P    G   E  +  GT   + +  +      ++ + + G  KI+I+N HGGN+
Sbjct: 83  --AVVSPEYYFGQIFEARHEPGTIAYSLSTQLVLLQETVNELGRNGCHKILIVNGHGGNN 140

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            L+ + +          VV    S      G     ++   +H GE ETS MLA  P LV
Sbjct: 141 SLLPLFAQSQLASPHDYVVYVMGSIPRDGAG-RPSQKSAADLHAGEAETSAMLANRPDLV 199

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
            M+ A++ S      L     +         W      P    G+   AT   GE     
Sbjct: 200 HMERAKSESGADQHRLTLPSSIYTG-----IWWYARF-PNHYAGDGSTATEALGEFDQKN 253

Query: 242 FANCFIQLLNDINS 255
           +++   + +  I +
Sbjct: 254 WSHEIAEAVKAIKA 267


>gi|332703983|ref|ZP_08424071.1| Creatininase [Desulfovibrio africanus str. Walvis Bay]
 gi|332554132|gb|EGJ51176.1| Creatininase [Desulfovibrio africanus str. Walvis Bay]
          Length = 241

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 53/256 (20%), Positives = 93/256 (36%), Gaps = 22/256 (8%)

Query: 5   IIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++  + + P      +    +++PLG+ EQHG  LP+ TD  IA  +A+           
Sbjct: 1   MLLMEQTWPDVRAYLERCRTIIIPLGSVEQHGLALPLGTDAFIAQAMAQEAGRRTQR--- 57

Query: 64  VTCMPVEPIGYSIE-HMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
               P+   G S+  HM   GT +             + ++ + G R  +++N HGGN  
Sbjct: 58  -LVAPILAPGMSLYVHMDFPGTISFMPDTYTAMIRDCVASLHRHGFRNFLLVNGHGGNEG 116

Query: 123 LVSIVSTEARMRFSMLVVST-SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            +     E   R   +  +   W R                 HGG  E ++++ +   LV
Sbjct: 117 CIQNAMAEMGYRLPGMKYTWAQWWRMPEINAREDEVGLGRVGHGGGSEAALIMHVRSGLV 176

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNA--MDATVKKGEGLL 239
           K +L          F  +   +R H           +   G++ +A    AT + G  L 
Sbjct: 177 KSELFGRDMKEAR-FRTSQDLVRTH-----------VTETGII-DAQQERATAEIGAELF 223

Query: 240 SYFANCFIQLLNDINS 255
                    +L D+ S
Sbjct: 224 ELTVTRLTAMLADLES 239


>gi|197118520|ref|YP_002138947.1| creatinine amidohydrolase superfamily protein [Geobacter
           bemidjiensis Bem]
 gi|197087880|gb|ACH39151.1| creatinine amidohydrolase superfamily protein [Geobacter
           bemidjiensis Bem]
          Length = 239

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 59/254 (23%), Positives = 96/254 (37%), Gaps = 21/254 (8%)

Query: 5   IIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++    ++            V +P G+ E+HG HLP++TDTI A  + +R    +P    
Sbjct: 1   MLIEGMTMEEFSRGLTVSKTVYIPFGSVEEHGSHLPLSTDTIEAYEVGKRAAERIP---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP- 122
           +   P    G         GT +++ A        I+ ++   G+   + L  H G S  
Sbjct: 57  LFVAPPIHYGSCRSTSCHPGTVSISTATLKSLLKDIVRSLHAHGLTNFIALTGHAGGSHK 116

Query: 123 -LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +     E       + ++         +      ET    H GEIETS ++   PHLV
Sbjct: 117 MALQDAGEELIRELPEINMAVVTEYDLAKEAGAGIIETRGDAHAGEIETSRIMHSHPHLV 176

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           K      + S  +  L   K              +   P GV G+   AT KKG  L S 
Sbjct: 177 KGLAEAEYPSFPTGILVRDK--------------RSFWPGGVWGDPGKATAKKGRMLESL 222

Query: 242 FANCFIQLLNDINS 255
            A+  ++L+  + S
Sbjct: 223 VADKVVELVKALES 236


>gi|119952517|ref|YP_949922.1| putative creatinine amidohydrolase [Arthrobacter aurescens TC1]
 gi|119951647|gb|ABM10557.1| putative creatinine amidohydrolase [Arthrobacter aurescens TC1]
          Length = 233

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 58/238 (24%), Positives = 103/238 (43%), Gaps = 18/238 (7%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
             AR   I VLP+G++EQHG HLP+ TD+I+A  +AE +      +  +  +P   I  S
Sbjct: 12  EAARNASIAVLPIGSFEQHGSHLPLATDSIVACAVAEAV----SSQYDLMLLPPVTISCS 67

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            EH    GT +++ A        +  ++ + G+RK+V+++ HGGN  L ++         
Sbjct: 68  HEHSDFAGTVSISAATLYAVVKDVAASLDQRGVRKLVLVSGHGGNYVLGNVAQEGNVGTC 127

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
            M +           +           +HGGE+ETS++L +AP LV+ D           
Sbjct: 128 RMALFPHRDDWEQARKAGGLTTSNHEDMHGGELETSILLHVAPELVRGDA---------- 177

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDI 253
                 ++    +H     +   +  G++G    A+ ++G  +L          L  +
Sbjct: 178 ----DDWVAPERTHLHQIGVAGYSQSGIIGRPSLASAERGRLVLEELVRLAEPHLEHL 231


>gi|15607835|ref|NP_215209.1| hypothetical protein Rv0695 [Mycobacterium tuberculosis H37Rv]
 gi|15840100|ref|NP_335137.1| hypothetical protein MT0722 [Mycobacterium tuberculosis CDC1551]
 gi|31791879|ref|NP_854372.1| hypothetical protein Mb0714 [Mycobacterium bovis AF2122/97]
 gi|121636616|ref|YP_976839.1| hypothetical protein BCG_0744 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148660470|ref|YP_001281993.1| hypothetical protein MRA_0703 [Mycobacterium tuberculosis H37Ra]
 gi|148821900|ref|YP_001286654.1| hypothetical protein TBFG_10709 [Mycobacterium tuberculosis F11]
 gi|167967934|ref|ZP_02550211.1| hypothetical protein MtubH3_07813 [Mycobacterium tuberculosis
           H37Ra]
 gi|215402478|ref|ZP_03414659.1| hypothetical protein Mtub0_02058 [Mycobacterium tuberculosis
           02_1987]
 gi|215410249|ref|ZP_03419057.1| hypothetical protein Mtub9_02770 [Mycobacterium tuberculosis
           94_M4241A]
 gi|215425936|ref|ZP_03423855.1| hypothetical protein MtubT9_05941 [Mycobacterium tuberculosis T92]
 gi|215429535|ref|ZP_03427454.1| hypothetical protein MtubE_02305 [Mycobacterium tuberculosis
           EAS054]
 gi|215444817|ref|ZP_03431569.1| hypothetical protein MtubT_02395 [Mycobacterium tuberculosis T85]
 gi|218752346|ref|ZP_03531142.1| hypothetical protein MtubG1_02395 [Mycobacterium tuberculosis GM
           1503]
 gi|219556545|ref|ZP_03535621.1| hypothetical protein MtubT1_04255 [Mycobacterium tuberculosis T17]
 gi|224989088|ref|YP_002643775.1| hypothetical protein JTY_0714 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253797637|ref|YP_003030638.1| hypothetical protein TBMG_00708 [Mycobacterium tuberculosis KZN
           1435]
 gi|254231016|ref|ZP_04924343.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|254363643|ref|ZP_04979689.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|260185576|ref|ZP_05763050.1| hypothetical protein MtubCP_06030 [Mycobacterium tuberculosis
           CPHL_A]
 gi|260199704|ref|ZP_05767195.1| hypothetical protein MtubT4_06150 [Mycobacterium tuberculosis T46]
 gi|260203865|ref|ZP_05771356.1| hypothetical protein MtubK8_06089 [Mycobacterium tuberculosis K85]
 gi|289442095|ref|ZP_06431839.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289446254|ref|ZP_06435998.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A]
 gi|289552951|ref|ZP_06442161.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289568638|ref|ZP_06448865.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289573303|ref|ZP_06453530.1| conserved hypothetical protein [Mycobacterium tuberculosis K85]
 gi|289744419|ref|ZP_06503797.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289749202|ref|ZP_06508580.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289752743|ref|ZP_06512121.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gi|289756783|ref|ZP_06516161.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|289760821|ref|ZP_06520199.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|294996189|ref|ZP_06801880.1| hypothetical protein Mtub2_17221 [Mycobacterium tuberculosis 210]
 gi|297633193|ref|ZP_06950973.1| hypothetical protein MtubK4_03675 [Mycobacterium tuberculosis KZN
           4207]
 gi|297730173|ref|ZP_06959291.1| hypothetical protein MtubKR_03730 [Mycobacterium tuberculosis KZN
           R506]
 gi|298524187|ref|ZP_07011596.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|306774805|ref|ZP_07413142.1| hypothetical protein TMAG_02577 [Mycobacterium tuberculosis
           SUMu001]
 gi|306781462|ref|ZP_07419799.1| hypothetical protein TMBG_03390 [Mycobacterium tuberculosis
           SUMu002]
 gi|306783346|ref|ZP_07421668.1| hypothetical protein TMCG_03507 [Mycobacterium tuberculosis
           SUMu003]
 gi|306787715|ref|ZP_07426037.1| hypothetical protein TMDG_02420 [Mycobacterium tuberculosis
           SUMu004]
 gi|306794482|ref|ZP_07432784.1| hypothetical protein TMEG_02068 [Mycobacterium tuberculosis
           SUMu005]
 gi|306796448|ref|ZP_07434750.1| hypothetical protein TMFG_03366 [Mycobacterium tuberculosis
           SUMu006]
 gi|306802308|ref|ZP_07438976.1| hypothetical protein TMHG_03722 [Mycobacterium tuberculosis
           SUMu008]
 gi|306806518|ref|ZP_07443186.1| hypothetical protein TMGG_03714 [Mycobacterium tuberculosis
           SUMu007]
 gi|306966716|ref|ZP_07479377.1| hypothetical protein TMIG_01602 [Mycobacterium tuberculosis
           SUMu009]
 gi|306970909|ref|ZP_07483570.1| hypothetical protein TMJG_02441 [Mycobacterium tuberculosis
           SUMu010]
 gi|307078637|ref|ZP_07487807.1| hypothetical protein TMKG_03981 [Mycobacterium tuberculosis
           SUMu011]
 gi|313657500|ref|ZP_07814380.1| hypothetical protein MtubKV_03720 [Mycobacterium tuberculosis KZN
           V2475]
 gi|1806161|emb|CAB06458.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv]
 gi|13880250|gb|AAK44951.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551]
 gi|31617466|emb|CAD93576.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97]
 gi|121492263|emb|CAL70730.1| Conserved hypothetical protein [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|124600075|gb|EAY59085.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|134149157|gb|EBA41202.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148504622|gb|ABQ72431.1| hypothetical protein MRA_0703 [Mycobacterium tuberculosis H37Ra]
 gi|148720427|gb|ABR05052.1| conserved hypothetical protein [Mycobacterium tuberculosis F11]
 gi|224772201|dbj|BAH25007.1| hypothetical protein JTY_0714 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253319140|gb|ACT23743.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           1435]
 gi|289415014|gb|EFD12254.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289419212|gb|EFD16413.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A]
 gi|289437583|gb|EFD20076.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289537734|gb|EFD42312.1| conserved hypothetical protein [Mycobacterium tuberculosis K85]
 gi|289542392|gb|EFD46040.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289684947|gb|EFD52435.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289689789|gb|EFD57218.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289693330|gb|EFD60759.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gi|289708327|gb|EFD72343.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|289712347|gb|EFD76359.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|298493981|gb|EFI29275.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|308216698|gb|EFO76097.1| hypothetical protein TMAG_02577 [Mycobacterium tuberculosis
           SUMu001]
 gi|308325760|gb|EFP14611.1| hypothetical protein TMBG_03390 [Mycobacterium tuberculosis
           SUMu002]
 gi|308331842|gb|EFP20693.1| hypothetical protein TMCG_03507 [Mycobacterium tuberculosis
           SUMu003]
 gi|308335628|gb|EFP24479.1| hypothetical protein TMDG_02420 [Mycobacterium tuberculosis
           SUMu004]
 gi|308337245|gb|EFP26096.1| hypothetical protein TMEG_02068 [Mycobacterium tuberculosis
           SUMu005]
 gi|308343109|gb|EFP31960.1| hypothetical protein TMFG_03366 [Mycobacterium tuberculosis
           SUMu006]
 gi|308346994|gb|EFP35845.1| hypothetical protein TMGG_03714 [Mycobacterium tuberculosis
           SUMu007]
 gi|308350974|gb|EFP39825.1| hypothetical protein TMHG_03722 [Mycobacterium tuberculosis
           SUMu008]
 gi|308355570|gb|EFP44421.1| hypothetical protein TMIG_01602 [Mycobacterium tuberculosis
           SUMu009]
 gi|308359529|gb|EFP48380.1| hypothetical protein TMJG_02441 [Mycobacterium tuberculosis
           SUMu010]
 gi|308363433|gb|EFP52284.1| hypothetical protein TMKG_03981 [Mycobacterium tuberculosis
           SUMu011]
 gi|323720919|gb|EGB29985.1| hypothetical protein TMMG_03402 [Mycobacterium tuberculosis
           CDC1551A]
 gi|326905083|gb|EGE52016.1| hypothetical protein TBPG_03010 [Mycobacterium tuberculosis W-148]
 gi|328457418|gb|AEB02841.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           4207]
          Length = 251

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 92/235 (39%), Gaps = 29/235 (12%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR------LPVTCMPVEPIGYS 75
             +V+PLG+ EQHGPHLP++TDT IA  +A  + + L               P    G S
Sbjct: 28  PSIVIPLGSTEQHGPHLPLDTDTRIATAVARTVTARLHAEDLPIAQEEWLMAPAIAYGAS 87

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            EH    GT ++         +    +      R++V +N HGGN   ++      R   
Sbjct: 88  GEHQRFAGTISIGTEALTMLLVEYGRSAACW-ARRLVFVNGHGGNVGALTRAVGLLRAEG 146

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
                   W   T P G           H G  ETS++L L+P  V+ +     +     
Sbjct: 147 RDA----GWCPCTCPGG---------DPHAGHTETSVLLHLSPADVRTERWRAGNRAPLP 193

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
            L     +R  G  +       ++  GV+G+   AT  +G  + +   +  ++ +
Sbjct: 194 VL--LPSMRRGGVAA-------VSETGVLGDPTTATAAEGRRIFAAMVDDCVRRV 239


>gi|332830108|gb|EGK02736.1| hypothetical protein HMPREF9455_00986 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 251

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 52/236 (22%), Positives = 91/236 (38%), Gaps = 15/236 (6%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERI--KSILPPRLPVTCMPVEPIG-YSIEHMY 80
            VLP GA E H  HLP  TD  +A G++     K+    ++    +P  P+G  +     
Sbjct: 23  AVLPWGATEPHNYHLPYITDCYLAHGISVDAVIKAYDSQKIKGMVLPPIPLGSQNPGQRE 82

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS-MLV 139
           +       Y         I+ ++   GI  +VI+N HGGN      +  +  + +   L+
Sbjct: 83  LPFCLHGRYETQKGILTDIVASLDCQGIYTLVIVNGHGGN--SFKNMIRDLAVDYPHFLI 140

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
           V + W       G           H GE+ETS+M+   P LV + LA +  +        
Sbjct: 141 VVSDWFAVLPQAGYFEER----DDHAGEMETSVMMHYYPELVNLSLAGDG-AYTPFKPET 195

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
            +        ++      ++    +GN   +T +KG+      +    +L  D+  
Sbjct: 196 LRDGTGWTPRNWA----QVSYDTGIGNPKKSTAEKGKVYAGAVSQKLSELFVDLVK 247


>gi|332883797|gb|EGK04077.1| hypothetical protein HMPREF9456_01105 [Dysgonomonas mossii DSM
           22836]
          Length = 251

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 53/235 (22%), Positives = 94/235 (40%), Gaps = 13/235 (5%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERI--KSILPPRLPVTCMPVEPIG-YSIEHMY 80
            V P GA E H  HLP  TD  +A  L+     K+    ++    +PV  +G  +     
Sbjct: 23  AVQPWGATEPHNYHLPYMTDCYLAHDLSVDAVIKAYEKQKVKGMVLPVIHLGSQNPGQRE 82

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
           +       Y         I+ ++   G+ K+VI+N HGGN      +  +  +++   ++
Sbjct: 83  LPFCLHAGYETQKAILSDIVSSLNYQGVHKLVIVNGHGGN--SFKNMIRDLAVQYPDFLI 140

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
             S     +PQ   +    E   H GE+ETSMM+   P LV + +A + +S+      + 
Sbjct: 141 VISNLFAIVPQ---TGYFEEKDDHAGEMETSMMMHYHPELVNLSVAGDGASKPFS-AESL 196

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           +        ++     D      +GN   +T +KG       +    +L  D+  
Sbjct: 197 REGIGWTPRNWAKVSHDTG----IGNPRKSTAEKGRKYADAVSRKLSELFIDVAK 247


>gi|159037584|ref|YP_001536837.1| creatininase [Salinispora arenicola CNS-205]
 gi|157916419|gb|ABV97846.1| Creatininase [Salinispora arenicola CNS-205]
          Length = 238

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 58/233 (24%), Positives = 96/233 (41%), Gaps = 16/233 (6%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
              R   + VLP+G++EQHG HLP+ TDT++A  +A+ +         +  +P   I  S
Sbjct: 12  ESERAASVAVLPVGSFEQHGAHLPLVTDTVVACAIAKAVAERYD----LFLLPPVTISCS 67

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135
            EH    GT +++        + I  ++R  GI ++ ++N HGGN  L ++V        
Sbjct: 68  HEHAAWRGTVSISATTLTAVVVDIARSLRASGIHRLAVINGHGGNYALANVVQEANVAGP 127

Query: 136 SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSE 195
           +M +  T                    +H GE+E S++L +AP +V+            +
Sbjct: 128 AMTLFPTRADWDDARVAAGMHSTAHQDMHAGELEVSLLLHVAPEVVR------------D 175

Query: 196 FLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
                 +L     H     M      GV+G    AT  KG+ +L      F  
Sbjct: 176 GFEQADHLADDRRHLLTRGMDGYTTSGVIGLPSHATTAKGKAVLEALVRSFAD 228


>gi|302517408|ref|ZP_07269750.1| creatinine amidohydrolase [Streptomyces sp. SPB78]
 gi|302426303|gb|EFK98118.1| creatinine amidohydrolase [Streptomyces sp. SPB78]
          Length = 241

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 94/240 (39%), Gaps = 13/240 (5%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
                T+ +     +A  D I +LP+G+ EQH  HLP+ TDT++A  + ER  + L  R 
Sbjct: 2   SHRYLTETTWRETREAAPDAIALLPIGSQEQHAAHLPLGTDTLLAEAVTERALAHLAGRA 61

Query: 63  -------PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
                   V  +P  P G+S  H+      TL+          I+D++   G R+++++N
Sbjct: 62  ADGERVPHVVRLPTLPYGHSPHHL-FAAALTLSAHTLGLVLDEILDSLAATGHRRVLVVN 120

Query: 116 AHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
            HGGN  ++ +      +R  +   + S+                +  H G  ETS+MLA
Sbjct: 121 GHGGNDEIMRLAVKRFALRAEVTAAACSYWSLGEAAADAEHAAL-VPGHAGWYETSLMLA 179

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
             P LV+  +                Y          W     +      +A  A  ++G
Sbjct: 180 AHPGLVRTPVPAREPVDPPPLFDRPPYPGLTTERHGEWERVGGSTD----DASGAQAERG 235


>gi|284993277|ref|YP_003411832.1| Creatininase [Geodermatophilus obscurus DSM 43160]
 gi|284066523|gb|ADB77461.1| Creatininase [Geodermatophilus obscurus DSM 43160]
          Length = 240

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 64/257 (24%), Positives = 101/257 (39%), Gaps = 32/257 (12%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           P       + P      +  ++++PLGA EQHG HLP+ TDT +A  +AE     L    
Sbjct: 9   PRTRLAGATWPD---LPERPLLLVPLGAVEQHGHHLPLGTDTSVACAVAEAAVDDLD--- 62

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            V   P    G S EH    GT ++         +    +  +    ++V++N HGGN  
Sbjct: 63  GVLLAPALAYGASGEHEDFPGTVSIGTEALTGLLVEYGRSACRW-AGRLVLVNGHGGNLD 121

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            +    T+ R     +     W    +              H G  ETS ML + P  V+
Sbjct: 122 ALRTAGTQLRAEAREVA----WFPCGVA---------GADAHAGRTETSAMLHVEPDAVR 168

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
            D A          L     LRA G       ++ ++P GV+G+   A+ ++G  LL+  
Sbjct: 169 ADRAVAGDPTPIAEL--LPRLRAEG-------VRAVSPTGVLGDPAGASAEEGAELLAGM 219

Query: 243 ANCFIQLLNDINSFDVS 259
           A      +    ++DV 
Sbjct: 220 AGRLAAAVR---AWDVD 233


>gi|318058955|ref|ZP_07977678.1| hypothetical protein SSA3_13481 [Streptomyces sp. SA3_actG]
          Length = 266

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 94/240 (39%), Gaps = 13/240 (5%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
                T+ +     +A  D I +LP+G+ EQH  HLP+ TDT++A  + ER  + L  R 
Sbjct: 2   SHRYLTETTWRETREAAPDAIALLPIGSQEQHAAHLPLGTDTLLAEAVTERALAHLAGRA 61

Query: 63  -------PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
                   V  +P  P G+S  H+      TL+          I+D++   G R+++++N
Sbjct: 62  ADGERVPHVVRLPTLPYGHSPHHL-FAAALTLSAHTLGLVLDEILDSLAATGHRRVLVVN 120

Query: 116 AHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
            HGGN  ++ +      +R  +   + S+                +  H G  ETS+MLA
Sbjct: 121 GHGGNDEIMRLAVKRFALRAEVTAAACSYWSLGEAAADAEHAAL-VPGHAGWYETSLMLA 179

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
             P LV+  +                Y          W     +      +A  A  ++G
Sbjct: 180 AHPGLVRTPVPAREPVDPPPLFDRPPYPGLTTERHGEWERVGGSTD----DASGAQAERG 235


>gi|333028912|ref|ZP_08456976.1| hypothetical protein STTU_6416 [Streptomyces sp. Tu6071]
 gi|332748764|gb|EGJ79205.1| hypothetical protein STTU_6416 [Streptomyces sp. Tu6071]
          Length = 266

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 94/240 (39%), Gaps = 13/240 (5%)

Query: 3   PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
                T+ +     +A  D I +LP+G+ EQH  HLP+ TDT++A  + ER  + L  R 
Sbjct: 2   SHRYLTETTWRETREAAPDAIALLPIGSQEQHAAHLPLGTDTLLAEAVTERALAHLAGRA 61

Query: 63  -------PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
                   V  +P  P G+S  H+      TL+          I+D++   G R+++++N
Sbjct: 62  AEGERVPHVVRLPTLPYGHSPHHL-FAAALTLSAHTLGLVLDEILDSLAATGHRRVLVVN 120

Query: 116 AHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
            HGGN  ++ +      +R  +   + S+                +  H G  ETS+MLA
Sbjct: 121 GHGGNDEIMRLAVKRFALRAEVTAAACSYWSLGEAAADAEHAAL-VPGHAGWYETSLMLA 179

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
             P LV+  +                Y          W     +      +A  A  ++G
Sbjct: 180 AHPGLVRTPVPAREPVDPPPLFDRPPYPGLTTERHGEWERVGGSTD----DASGAQAERG 235


>gi|118575249|ref|YP_874992.1| conserved hypothetical protein, putative amidase [Cenarchaeum
           symbiosum A]
 gi|118193770|gb|ABK76688.1| conserved hypothetical protein, putative amidase [Cenarchaeum
           symbiosum A]
          Length = 236

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 95/240 (39%), Gaps = 24/240 (10%)

Query: 8   TDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
           +D   P           VLP+G+ EQHG HLP++TD+ I + +A R+           CM
Sbjct: 5   SDLPDPDLRRMLSGRPAVLPVGSTEQHGAHLPVSTDSDIVSEVAYRVSKKCG----YLCM 60

Query: 68  PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
           P    G S EH       +L  A        II ++   G   + ++N H GN+  +  +
Sbjct: 61  PTIQYGVSFEHSPY-LNLSLRGATLRHVVRDIISSMASAGAPAVFVINGHHGNARHLEGL 119

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAE 187
                 R     V + W               E   H G+IETS+MLA++   V+M  A+
Sbjct: 120 ---ESKRAPRTRVISYWHYL-----------EEGLDHAGDIETSIMLAIS-DKVRMSRAK 164

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
                        + L    S SF     ++   G+ G+   AT KKGE +LS       
Sbjct: 165 KGFVPPELDDTGRERLSKRASRSFI----EVTGNGIWGDPRKATAKKGEEMLSRATRAIS 220


>gi|158315010|ref|YP_001507518.1| creatininase [Frankia sp. EAN1pec]
 gi|158110415|gb|ABW12612.1| Creatininase [Frankia sp. EAN1pec]
          Length = 270

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 68/244 (27%), Positives = 101/244 (41%), Gaps = 18/244 (7%)

Query: 12  LPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL---PPRLPVTCMP 68
               A      +V++P+G++EQHGPHLP+ TDT IA  +AE    +L    P  PV   P
Sbjct: 23  WTDIAG---RPLVLVPVGSFEQHGPHLPLVTDTTIAVAVAEGAARLLLRRRPAEPVLVAP 79

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
                 S EH    GT ++         + +I ++       +V +NAHGGN   ++   
Sbjct: 80  PLTYTASGEHQSFAGTISIGGPVLHLVLVELIRSMSAW-AGPVVFVNAHGGNLRGLTDAV 138

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAEN 188
           T+ R       V+      T               H G  ETS+ML LAP  V M  A  
Sbjct: 139 TQLREERHD--VAWVPCAATGTADTARACSAAGDAHAGFTETSLMLHLAPDQVDMTRAAA 196

Query: 189 FSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
            ++   + L     L   G  +         P GV+G+   AT + GE +L        +
Sbjct: 197 GNTTSLDEL--LPALVTGGLAAVA-------PSGVLGDPTAATAQDGERILRRMVGDVCE 247

Query: 249 LLND 252
           L++D
Sbjct: 248 LIHD 251


>gi|254517313|ref|ZP_05129370.1| creatininase [gamma proteobacterium NOR5-3]
 gi|219674151|gb|EED30520.1| creatininase [gamma proteobacterium NOR5-3]
          Length = 262

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 50/251 (19%), Positives = 87/251 (34%), Gaps = 38/251 (15%)

Query: 2   NPLIIFTDNSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
              +   D +              V++P    EQ+GPH+ +          A+ I   L 
Sbjct: 22  PDTVFLEDLTWTEVRALLDGGTDTVIIPTAGTEQNGPHVVLGKHKYRMNAGADAIARKLG 81

Query: 60  PRLPVTCMPVEPIGY---SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNA 116
             L    +   P G       HM   GT T+              +++  G +KI+++  
Sbjct: 82  KTLVAPVIVHVPEGNIDPPSGHMLFPGTITIPEDVFQSLLEHTARSLKAHGFKKILLIGD 141

Query: 117 HGGNSPLVSIVS----TEARMRF-SMLVVSTSWSRFTIPQGIIS--FPETEIGIHGGEIE 169
            GGN   +  V+       +    ++L VS  +        + S  F E++IG+H G  +
Sbjct: 142 SGGNQAGMKAVANLLNNAWQSEGITVLHVSAWYDDPGYRNYLASKGFSESQIGVHAGLHD 201

Query: 170 TSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMD 229
           TS +L +AP  V++D  E     +                            GV+G+   
Sbjct: 202 TSTLLYVAPEYVRVDTMEPGKGFEI--------------------------DGVIGDPTL 235

Query: 230 ATVKKGEGLLS 240
           +T + GE    
Sbjct: 236 STPELGEVGFE 246


>gi|78211840|ref|YP_380619.1| hypothetical protein Syncc9605_0288 [Synechococcus sp. CC9605]
 gi|78196299|gb|ABB34064.1| conserved hypothetical protein [Synechococcus sp. CC9605]
          Length = 262

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 49/264 (18%), Positives = 90/264 (34%), Gaps = 29/264 (10%)

Query: 2   NPLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              I     S P      +    V++PLG+ EQHGP   + TD + A  +A  +      
Sbjct: 12  TDAIRLALRSWPEVESYLQGCKGVIIPLGSTEQHGPTGAIGTDALTAEAVALEVGRRTG- 70

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V   P +  G +  H+   GT +L  A  +     ++ ++ + G  ++ ++N HGGN
Sbjct: 71  ---VLVTPAQAFGMAEHHLGFAGTMSLQPATLLAVLHDLVLSLGRHGFERVFVINGHGGN 127

Query: 121 S---------PLVSIVSTEARMRFSMLVVSTSWSRFT-IPQGIISFPETEIGIHGGEIET 170
                        +  +    +   +     +W     + +        + G H    E 
Sbjct: 128 IATAKAAFAQAHGTATTRNLPVAPQLRCRLANWFMAGPVMRQARDLYGDKEGHHATPSEI 187

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ LA+ P L          +               G        +  +P G +G +   
Sbjct: 188 AVTLAVEPSLQSKQRPLPDPA-------------PAGPIHGPDDFRRRHPDGRMGSHPSL 234

Query: 230 ATVKKGEGLLSYFANCFIQLLNDI 253
           AT + G+ LL   A    + L   
Sbjct: 235 ATAQHGDALLETAATALSEDLRTF 258


>gi|297156223|gb|ADI05935.1| hypothetical protein SBI_02814 [Streptomyces bingchenggensis BCW-1]
          Length = 273

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 53/260 (20%), Positives = 99/260 (38%), Gaps = 27/260 (10%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
                D +     D  +   +V P+GA EQHGPHLP++ D++    LAE   + +   L 
Sbjct: 5   APSLADLTSTQVRDVLRGRTLVWPIGATEQHGPHLPLSVDSV----LAEEFAAEIAAELD 60

Query: 64  VTCMPVEPIG-----YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +PV+ IG      S   +   GT  +     I      + ++  +   +++++N H 
Sbjct: 61  GFTVPVQSIGARSLPQSGGGLSFPGTVYVGGETLIRFLAETLRSLAGLPFARLIVVNGHY 120

Query: 119 GNSPLVSIVSTEARMRFSM---LVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSM 172
            N P +     + R +       V++ SW        + +      G    H G  ETS+
Sbjct: 121 ENEPFIFEALDQIRQQGDFGHREVIAFSWWSMVQDSWLAAEVGDFPGWHAEHAGLTETSL 180

Query: 173 MLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATV 232
           ML L P LV     ++    +S    +   L    +             G++ +   ++ 
Sbjct: 181 MLHLRPDLVTDTRLDHDRPPRSGVYLHPIDLAQTTNQ------------GILSSTSGSSA 228

Query: 233 KKGEGLLSYFANCFIQLLND 252
             GE L  +     + ++ +
Sbjct: 229 DLGEKLFRHVIAESVAMVRE 248


>gi|260436341|ref|ZP_05790311.1| creatininase [Synechococcus sp. WH 8109]
 gi|260414215|gb|EEX07511.1| creatininase [Synechococcus sp. WH 8109]
          Length = 262

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 49/264 (18%), Positives = 90/264 (34%), Gaps = 29/264 (10%)

Query: 2   NPLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              I     S P      +    V++PLG+ EQHGP   + TD + A  +A  +      
Sbjct: 12  TDAIRLALRSWPEVESYLQGCKGVIIPLGSTEQHGPTGAIGTDALTAEAVALEVGRRTG- 70

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V   P +  G +  H+   GT +L  A  +     ++ ++ + G  ++ ++N HGGN
Sbjct: 71  ---VLVTPAQAFGMAEHHLGFAGTMSLQPATLLAVLHDLVLSLGRHGFERVFVINGHGGN 127

Query: 121 S---------PLVSIVSTEARMRFSMLVVSTSWSRFT-IPQGIISFPETEIGIHGGEIET 170
                        +  +    +   +     +W     + +        + G H    E 
Sbjct: 128 IATAKAAFAQAHGTATTRNLPVAPQLRCRLANWFMAGPVMRQARDLYGNKEGHHATPSEI 187

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ LA+ P L          +               G        +  +P G +G +   
Sbjct: 188 AVTLAVEPSLQSKQRPLPDPA-------------PAGPIHGPDDFRRRHPDGRMGSHPSL 234

Query: 230 ATVKKGEGLLSYFANCFIQLLNDI 253
           AT + G+ LL   A    + L   
Sbjct: 235 ATAQHGDALLETAATALSEDLRTF 258


>gi|113953418|ref|YP_729571.1| creatininase [Synechococcus sp. CC9311]
 gi|113880769|gb|ABI45727.1| creatininase [Synechococcus sp. CC9311]
          Length = 262

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 52/264 (19%), Positives = 86/264 (32%), Gaps = 29/264 (10%)

Query: 2   NPLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              I     S P      K    +++PLG+ EQHGP   + TD + A  +A      L  
Sbjct: 12  TEAIRLALQSWPDVEAYLKGCKGIIIPLGSTEQHGPTGAIGTDALTAEAVALE----LGR 67

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           R  V   P +  G +  H+   GT +L  A  +     ++ ++   G  +I ++N HGGN
Sbjct: 68  RSGVLVTPAQAYGMAEHHLGFAGTMSLQPATLMAVMHDLVLSLATHGFERIFVVNGHGGN 127

Query: 121 SPLVSIVSTEAR---------MRFSMLVVSTSWSRFT-IPQGIISFPETEIGIHGGEIET 170
                    +A          +   +    ++W     + +          G H    E 
Sbjct: 128 MATTKAAFAQAYGTAASRGLPVAPKLRCRLSNWFMAGAVMRQARELYGNREGQHATPSEI 187

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ L L   LV                         G+       +   P G +G +   
Sbjct: 188 AVTLHLHDSLVTKQR-------------PLPEAAPCGAIHGPADFRRRYPDGRMGSDPYL 234

Query: 230 ATVKKGEGLLSYFANCFIQLLNDI 253
           A  + G  LL   A    + L   
Sbjct: 235 AKPEHGAELLDTAATALREDLETF 258


>gi|33864081|ref|NP_895641.1| creatininase [Prochlorococcus marinus str. MIT 9313]
 gi|33635665|emb|CAE21989.1| Creatininase [Prochlorococcus marinus str. MIT 9313]
          Length = 262

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 53/262 (20%), Positives = 83/262 (31%), Gaps = 29/262 (11%)

Query: 4   LIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
            I     S P   D       V+LPLG+ EQHGP   + TD + A  LA  +        
Sbjct: 14  AIRLALRSWPEVDDYLNHCKGVILPLGSTEQHGPTGAIGTDALTAEALALEVGRRTG--- 70

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
            V   P +  G +  H+   GT +L  A  +     ++ ++   G  +I ++N HGGN  
Sbjct: 71  -VLVTPTQAFGMAEHHLGFAGTMSLKPATLLALIHDLVISLANHGFERIFVINGHGGNVA 129

Query: 123 LVSIVSTEARMRF---------SMLVVSTSWSRFTIP-QGIISFPETEIGIHGGEIETSM 172
                  +A              +     +W                + G H    E ++
Sbjct: 130 TTKAAFAQAYSSAISNDLPVASKLRCKLANWFMAGSVFHAARELYGDQEGQHATPSEIAL 189

Query: 173 MLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDAT 231
            L + P L+                         G        +  +P G +G N   A 
Sbjct: 190 TLHIEPSLLSKQR-------------PLPEPAPAGPIHGPEDFRRRHPDGRMGSNPYLAK 236

Query: 232 VKKGEGLLSYFANCFIQLLNDI 253
            + G  LL   A    + L   
Sbjct: 237 PEHGASLLETAATALSEDLTSF 258


>gi|118468439|ref|YP_885808.1| creatininase subfamily protein [Mycobacterium smegmatis str. MC2
           155]
 gi|118169726|gb|ABK70622.1| creatininase subfamily protein [Mycobacterium smegmatis str. MC2
           155]
          Length = 222

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 56/232 (24%), Positives = 93/232 (40%), Gaps = 25/232 (10%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL--PPRLPVTCMPVEPIGYSIEHM 79
            +V++P+G+ EQHGPHLP++TDT IAA +A  +      P        P    G S EH 
Sbjct: 3   PMVLVPVGSTEQHGPHLPLDTDTRIAAAVAGTVVEQFGAPADRDAVVAPPVAYGASGEHE 62

Query: 80  YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLV 139
              GT ++  A      +    +  K    +IV +N HGGN   ++      R       
Sbjct: 63  GFPGTVSIGTAALELLLVEYGRSASKW-TSRIVFVNGHGGNVEALAAAVALLRYEGRDA- 120

Query: 140 VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRN 199
               W   ++P             H G  ETS++L ++P  V  D     +   +     
Sbjct: 121 ---GWVPCSVPDA---------DAHAGHTETSVLLHISPDDVLTDELVCGN--TAPLAEL 166

Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
              +R+ G  +       ++  G++G+   AT  +GE + +   N     + 
Sbjct: 167 MPRMRSGGVAA-------VSELGILGDPTTATAAEGERIFAEMVNGCADRIK 211


>gi|269126965|ref|YP_003300335.1| Creatininase [Thermomonospora curvata DSM 43183]
 gi|268311923|gb|ACY98297.1| Creatininase [Thermomonospora curvata DSM 43183]
          Length = 252

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 101/243 (41%), Gaps = 18/243 (7%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
            S       R+  + +LP+G++EQHGP+LP+ TDT+    +A  I   L     V  +P 
Sbjct: 12  LSTSAEEGERRAAVALLPVGSFEQHGPYLPLATDTV----VACTIAGALAAAYRVLRLPP 67

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             I  S EH    GT +++ A        +  ++R+ GI K+V++N HGGN  L ++V  
Sbjct: 68  ITISCSHEHEGWPGTVSISAATLHALVGDVAASLRRAGIGKLVVVNGHGGNYVLGNVVQE 127

Query: 130 EARMRF-SMLVVSTSWSRFTIPQGIISFPE-TEIGIHGGEIETSMMLALAPHLVKMDLAE 187
                   ++ +      +                +H GE+ETS++L   PHLV+     
Sbjct: 128 ANAAAGEPVMALFPGPQEWESAMAAAGVQTSAWSDMHAGELETSLLLHAHPHLVRP---- 183

Query: 188 NFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFI 247
                         +L     H     M      GVVG    A+ +KGE +L +    F 
Sbjct: 184 --------GYEAGDHLCDDRRHLLTLGMAGHTRSGVVGRPSLASARKGEKVLGHLVELFA 235

Query: 248 QLL 250
             L
Sbjct: 236 DCL 238


>gi|300790153|ref|YP_003770444.1| creatinine amidohydrolase [Amycolatopsis mediterranei U32]
 gi|299799667|gb|ADJ50042.1| creatinine amidohydrolase [Amycolatopsis mediterranei U32]
          Length = 232

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 110/242 (45%), Gaps = 20/242 (8%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
            +       R+  + VLP+G++EQHG HLP+ TDT+IAA LA  +    P    V  +P 
Sbjct: 7   LATTADEQERRASVAVLPVGSFEQHGAHLPLATDTVIAATLAGAVAEAYP----VLHLPP 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             I  S EH    GT +++          +  +++  G+ ++V++N HGGN  ++S V  
Sbjct: 63  ITISCSHEHAGWAGTVSISARTLHAVVTDVAASLKASGVDRLVLVNGHGGNY-VLSNVVQ 121

Query: 130 EARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENF 189
           EA    ++      W       G+ +  +    +H GE+ETS++L   PHLV+       
Sbjct: 122 EAAGAMALFPGVADWQAAHTAAGLRTSLD--DDMHAGELETSILLHAHPHLVRP------ 173

Query: 190 SSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQL 249
               ++ + + ++L   G       ++     GVVG    A+  KG  +L      F  +
Sbjct: 174 GHETADHVTDREHLLTLG-------LRAYTESGVVGRPSLASAAKGHVVLDTLVQRFAGV 226

Query: 250 LN 251
           L 
Sbjct: 227 LE 228


>gi|269126593|ref|YP_003299963.1| Creatininase [Thermomonospora curvata DSM 43183]
 gi|268311551|gb|ACY97925.1| Creatininase [Thermomonospora curvata DSM 43183]
          Length = 237

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 102/240 (42%), Gaps = 28/240 (11%)

Query: 12  LPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEP 71
            P          V++P+G+ EQHGPHLP+ TD +IA  +AER  + L    P    PV  
Sbjct: 10  WPAVPA---GAPVLVPVGSTEQHGPHLPLGTDGLIARAVAERAAAAL--DGPPLVAPVIA 64

Query: 72  IGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
            G S EH    GT ++ +       + I+ ++      +IV +N HGGN+P +       
Sbjct: 65  YGASGEHAGFPGTVSIGHRALEAMLVEIVRSLALW-AGRIVFVNGHGGNTPALDAAVGRM 123

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSS 191
           R     +     W+   +P G           H G  ETS+ML LAPHLV+         
Sbjct: 124 RAEGHQVA----WAGCGVPGG---------DAHAGHTETSVMLHLAPHLVRP-------- 162

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
                  + + L           ++ L+P GV+G+   A+ + G  L++      I+ + 
Sbjct: 163 -FGHVSGDARPLAEIMPELVARGVRALSPSGVLGDPAGASAEHGRALVAAMVASLIRRIE 221


>gi|225352755|ref|ZP_03743778.1| hypothetical protein BIFPSEUDO_04385 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225156362|gb|EEG69931.1| hypothetical protein BIFPSEUDO_04385 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 246

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 44/254 (17%), Positives = 86/254 (33%), Gaps = 28/254 (11%)

Query: 8   TDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM 67
              + P    ++    V++P+G+ EQH  HLP+  D +IA+ ++E +       +     
Sbjct: 2   DHMTWPEIEASKSKP-VIVPIGSTEQHSQHLPLGVDAMIASHVSEDLAER----IDGIVA 56

Query: 68  PVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
           P    GY     S       GT  +     I     ++  +   G  KIV++NAH  N  
Sbjct: 57  PTMNYGYKSKPLSGGGPLFPGTIDMNGVTVINQMHDVLGELIADGFTKIVVMNAHFENEA 116

Query: 123 LVSIVSTEARMRFSMLV--VSTSWSRFTIPQGIISFPE-----TEIGIHGGEIETSMMLA 175
            +             +   V T+W        +    +          H    ETS+M+ 
Sbjct: 117 FIIEAIDLITRETRGVATIVETNWWDPLPENVVEQVFDGLVFPGWALEHAAVTETSLMMH 176

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
             P LV MD   +  +   +    +   +       G +               ++ ++G
Sbjct: 177 YEPELVHMDRVIDEGNVTPKAYVRYPVRKGDVPDYGGLAT-----------PAGSSAERG 225

Query: 236 EGLLSYFANCFIQL 249
           + ++    +    +
Sbjct: 226 KLIVDACIDAVADI 239


>gi|315445986|ref|YP_004078865.1| protein, amidase [Mycobacterium sp. Spyr1]
 gi|315264289|gb|ADU01031.1| uncharacterized protein, putative amidase [Mycobacterium sp. Spyr1]
          Length = 243

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 56/254 (22%), Positives = 98/254 (38%), Gaps = 27/254 (10%)

Query: 1   MNPLIIFTDNSLPLC--ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           M       +++      A A     +V+P+G+ EQHGPHLP++TDT IA  +A+ + + L
Sbjct: 1   MVFPRELGNSTSRQLHDAHAIHMPTLVVPVGSTEQHGPHLPLDTDTRIATAVADAVVTRL 60

Query: 59  PPR--LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNA 116
             R        P    G S EH    GT ++      E  +  + +  +    ++  +N 
Sbjct: 61  RARDETHWVMAPAIAYGASGEHEGFPGTISIGTPALAELLVEFVRSACRW-TPRVAFVNG 119

Query: 117 HGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           HGGN   +    T+ R           WS                  H G  ETS++L L
Sbjct: 120 HGGNVDALRRAVTQLRHEGRDAA----WSPCVA---------GNADAHAGHTETSVLLHL 166

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           +P  V+ +  E     ++        +   G  +       ++  GV+G+   AT  +G 
Sbjct: 167 SPDAVRQE--ERVPGNRAPLAELMPQMLRGGVAA-------VSSLGVLGDPTTATADEGR 217

Query: 237 GLLSYFANCFIQLL 250
            + +   +     +
Sbjct: 218 RIFAEMVDACAARV 231


>gi|307594509|ref|YP_003900826.1| creatininase [Vulcanisaeta distributa DSM 14429]
 gi|307549710|gb|ADN49775.1| Creatininase [Vulcanisaeta distributa DSM 14429]
          Length = 242

 Score =  152 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 54/249 (21%), Positives = 106/249 (42%), Gaps = 23/249 (9%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   + +        KD ++++P+G+ EQHGPHLP+ TD+IIA  +A  ++  +  +   
Sbjct: 1   MRILEITRDEV---PKDPLIIVPVGSIEQHGPHLPLGTDSIIANYIAAEVERKMQNK--A 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P+  +G S+EH    GT  + +   I + L  I+++       IV +N HGGN   +
Sbjct: 56  LLYPLIAVGSSMEHAGFVGTTWVRFESLIHYLLDFIESVSAWSPVGIVFVNGHGGNVDAL 115

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           +IV  E      +   +  +  +                H   +ETS++ A++  LV+ D
Sbjct: 116 TIVVKEWNYS-RVRPRAYHYYIYNKRVVDYITRYFPSFGHADAVETSLIAAISKDLVRWD 174

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAM--DATVKKGEGLLSYF 242
              +              +   G+ +      D++  GV+G+        + G  +L + 
Sbjct: 175 RVTD--------------IEVSGNINIFR-TIDVSETGVIGSLRRDLVRPEVGSEILRFI 219

Query: 243 ANCFIQLLN 251
            N  ++ + 
Sbjct: 220 VNDLLEQIQ 228


>gi|227828707|ref|YP_002830487.1| creatininase [Sulfolobus islandicus M.14.25]
 gi|229585925|ref|YP_002844427.1| Creatininase [Sulfolobus islandicus M.16.27]
 gi|227460503|gb|ACP39189.1| Creatininase [Sulfolobus islandicus M.14.25]
 gi|228020975|gb|ACP56382.1| Creatininase [Sulfolobus islandicus M.16.27]
          Length = 233

 Score =  152 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 63/253 (24%), Positives = 116/253 (45%), Gaps = 24/253 (9%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   + +       R+D + ++P+G+ EQHGPHLPM TD+II+  +A + +  L      
Sbjct: 1   MKLIEITRDEI---REDLVGLVPVGSIEQHGPHLPMGTDSIISEYVASKAEEKLKETT-- 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKM-GIRKIVILNAHGGNSPL 123
              P    G S+EH       +L++  AI  +  ++++I K  G+R+I+I+N HGGNS  
Sbjct: 56  LLFPTIYYGVSLEHKGFPF-ISLSFQTAISFFNDLLESIFKDLGLRRIIIVNGHGGNSYF 114

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           + +V  E  M++S   V          + + +       +H G +ETS + A+   +V++
Sbjct: 115 LPLVQREFNMKYSNAKVMIFNIFGEEEKLLFNV----NDLHAGTVETSKIYAIDKRVVRL 170

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV--GNAMDATVKKGEGLLSY 241
           +  E   S                     +S K+ N  GV+  G  +    + G+ +L+ 
Sbjct: 171 NKIEEIKSYDVRD-----------GVFVYYSTKEANQFGVLNDGKPIRIDEELGKKILAD 219

Query: 242 FANCFIQLLNDIN 254
             +  I L+ +  
Sbjct: 220 TVDKLIWLILNFK 232


>gi|186471044|ref|YP_001862362.1| creatininase [Burkholderia phymatum STM815]
 gi|184197353|gb|ACC75316.1| Creatininase [Burkholderia phymatum STM815]
          Length = 277

 Score =  152 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 63/268 (23%), Positives = 99/268 (36%), Gaps = 31/268 (11%)

Query: 1   MNPLIIFTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M   ++  + + P  A    D W V++PLGA EQHGPH+ MN D ++   +   +     
Sbjct: 14  MKQSVVIGELAAPEYARRIGDGWPVLIPLGALEQHGPHMSMNPDVLLPTAIGIAVAR--- 70

Query: 60  PRLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVIL 114
             +     P    GY     S    ++ GT +L           I+    + G R I ++
Sbjct: 71  -NIEALVAPAIAYGYKSQQKSGGGNHLCGTTSLDGHTLTSTIKDILKEFARHGARSICLI 129

Query: 115 NAHGGNSPL----VSIVSTEARMRF--SMLVVSTSWSRFTIPQGIISFPETEIGI----H 164
           N H  NS      + +   E +      + VV  S+  F     I              H
Sbjct: 130 NGHFENSMFAVEGIDLALRELKWEGTCDLQVVMLSYWDFVTETTIARIYPDGFPGWAVEH 189

Query: 165 GGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV 224
           GG +ETS+ML L PHLV M      ++        F  +                  G +
Sbjct: 190 GGVLETSLMLHLHPHLVDMSQVPTHAAVTFPPYDVFPPIPEWTPA-----------SGCL 238

Query: 225 GNAMDATVKKGEGLLSYFANCFIQLLND 252
            +A +A+ +KG+ L         Q L +
Sbjct: 239 SSAANASAEKGKLLFDVCVEGMSQALGE 266


>gi|330820016|ref|YP_004348878.1| creatininase [Burkholderia gladioli BSR3]
 gi|327372011|gb|AEA63366.1| creatininase [Burkholderia gladioli BSR3]
          Length = 249

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 50/255 (19%), Positives = 87/255 (34%), Gaps = 27/255 (10%)

Query: 11  SLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        K    +V+P+G+ EQHGP   + TD +    +A   +        +   P 
Sbjct: 7   TWAEIEAYLKRSRTIVVPIGSNEQHGPTGLLGTDWLCPEIIAVEAQKSAD----ILVAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             IG +  H+   GT +L  +  I      ++++   G  KI+ LN HGGN   +    +
Sbjct: 63  FNIGMAQHHLGFPGTISLRPSTFIAAICDWVNSLAVHGFEKILFLNGHGGNVASIEAAFS 122

Query: 130 EA-------RMRFSMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPHLV 181
           E        R R    +   +W        I      T  G+H    E ++     PH +
Sbjct: 123 EIYAQASFARRRCGFALKLKNWWDLEGVTEIANRQFPTGHGVHATPSEIAVTQWALPHTI 182

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
           K                    +   G        +   P G +G +   A+ +KG  L+ 
Sbjct: 183 K-------------DADYAPEIAPMGPIREALEFRARFPDGRMGSHPKQASQEKGGELVR 229

Query: 241 YFANCFIQLLNDINS 255
             A      +   ++
Sbjct: 230 QAAIGLAAEVEAFSA 244


>gi|227831446|ref|YP_002833226.1| Creatininase [Sulfolobus islandicus L.S.2.15]
 gi|227457894|gb|ACP36581.1| Creatininase [Sulfolobus islandicus L.S.2.15]
 gi|323475796|gb|ADX86402.1| creatininase [Sulfolobus islandicus REY15A]
 gi|323478509|gb|ADX83747.1| Creatininase [Sulfolobus islandicus HVE10/4]
          Length = 233

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 63/253 (24%), Positives = 116/253 (45%), Gaps = 24/253 (9%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   + +       R+D + ++P+G+ EQHGPHLPM TD+II+  +A + +  L      
Sbjct: 1   MKLIEITRDEI---REDLVGLVPVGSIEQHGPHLPMGTDSIISEYVASKAEEKLKETT-- 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKM-GIRKIVILNAHGGNSPL 123
              P    G S+EH       +L++  AI  +  ++++I K  G+R+I+I+N HGGNS  
Sbjct: 56  LLFPTVYYGVSLEHKGFPF-ISLSFQTAISFFNDLLESIFKDLGLRRIIIVNGHGGNSYF 114

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           + +V  E  M++S   V          + + +       +H G +ETS + A+   +V++
Sbjct: 115 LPLVQREFNMKYSNAKVMIFNIFGEEEKLLFNV----NDLHAGTVETSKIYAIDKRVVRL 170

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV--GNAMDATVKKGEGLLSY 241
           +  E   S                     +S K+ N  GV+  G  +    + G+ +L+ 
Sbjct: 171 NKIEEIKSYDVRD-----------GVFVYYSTKEANQFGVLNDGKPIRIDEELGKKILAD 219

Query: 242 FANCFIQLLNDIN 254
             +  I L+ +  
Sbjct: 220 TVDKLIWLILNFK 232


>gi|145225634|ref|YP_001136312.1| creatininase [Mycobacterium gilvum PYR-GCK]
 gi|145218120|gb|ABP47524.1| Creatininase [Mycobacterium gilvum PYR-GCK]
          Length = 251

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 55/251 (21%), Positives = 97/251 (38%), Gaps = 27/251 (10%)

Query: 4   LIIFTDNSLPLC--ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
                +++      A A     +V+P+G+ EQHGPHLP++TDT IA  +A+ + + L  R
Sbjct: 12  PRELGNSTSRQLHDAHAIHMPTLVVPVGSTEQHGPHLPLDTDTRIATAVADAVVTRLRAR 71

Query: 62  --LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
                   P    G S EH    GT ++      E  +  + +  +    ++  +N HGG
Sbjct: 72  DETHWVMAPAIAYGASGEHEGFPGTISIGTPALAELLVEFVRSACRW-TPRVAFVNGHGG 130

Query: 120 NSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
           N   +    T+ R           WS                  H G  ETS++L L+P 
Sbjct: 131 NVDALRRAVTQLRHEGRDAA----WSPCVA---------GNADAHAGHTETSVLLHLSPD 177

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            V+ +  E     ++        +   G  +       ++  GV+G+   AT  +G  + 
Sbjct: 178 AVRQE--ERVPGNRAPLAELMPQMLRGGVAA-------VSSLGVLGDPTTATADEGRRIF 228

Query: 240 SYFANCFIQLL 250
           +   +     +
Sbjct: 229 AEMVDACAARV 239


>gi|256783895|ref|ZP_05522326.1| hypothetical protein SlivT_05361 [Streptomyces lividans TK24]
          Length = 241

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 62/229 (27%), Positives = 104/229 (45%), Gaps = 22/229 (9%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           +LP+G++EQHGP+LP+ TDT++A      +   +    PV  +P   IG S EH    GT
Sbjct: 1   MLPVGSFEQHGPYLPLATDTLVA----CAVARAVADAYPVHLLPPVTIGCSHEHADWPGT 56

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST-- 142
            +++          I D++R+ G+  +V++N HGGN  ++  V  E+  R   + +    
Sbjct: 57  VSISAVTLHAVVRDIADSLRRSGVGALVVVNGHGGNY-VLGNVVQESSARGERMALFPAA 115

Query: 143 -SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
             W       G+++   T   +H GEIETS++L   P LV+                   
Sbjct: 116 EDWETARRRAGVVTSLLT--DMHAGEIETSILLHKHPELVRP------------GYEAAD 161

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           ++     H     M      GV+G     + +KG+ LL   A+ F + +
Sbjct: 162 FVADDRRHLLSLGMSAYTDSGVIGRPSLGSAEKGKELLESLADSFGEYV 210


>gi|298293563|ref|YP_003695502.1| creatininase [Starkeya novella DSM 506]
 gi|296930074|gb|ADH90883.1| Creatininase [Starkeya novella DSM 506]
          Length = 259

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 65/268 (24%), Positives = 113/268 (42%), Gaps = 33/268 (12%)

Query: 6   IFTDNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +  D +    A+  ++D IV LP+G+ EQHGPHLP+ TDT++   +A+++   +      
Sbjct: 5   LIADLTWYDFAERVKEDPIVFLPIGSVEQHGPHLPLATDTLLPLAVAQQVADRVG----G 60

Query: 65  TCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
              P    GY     S    +  GT +L     I     I++ + + G+R+IV+ + H  
Sbjct: 61  LVAPPVAYGYKSQPKSGGGNHFPGTLSLDAGVLIGLVRNIVNELVRHGVRRIVLFDGHME 120

Query: 120 NSPLVSIVSTEARMRFSML-------VVSTSWSRFTIPQGIISFPETEIGI---HGGEIE 169
           N   +   +  A    +ML       V    W   T     + FP+        H   +E
Sbjct: 121 NQWFLVEAADLALRDQAMLGRTDVRIVKLGYWEFITKATEKVLFPDGFPSWELEHAAVME 180

Query: 170 TSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMD 229
           TS+ML + P LV+ +L  +  +        + +             + + P GV+ +A  
Sbjct: 181 TSVMLHIRPDLVREELIPDDPAADFPPYDIYPF-----------DTRPIPPTGVLSSAKA 229

Query: 230 ATVKKGEGLLSYFANCFIQLLNDINSFD 257
           A+  KGE +L+         L  I +F+
Sbjct: 230 ASAAKGEAVLAQVVPDIADAL--IKAFE 255


>gi|302539277|ref|ZP_07291619.1| predicted protein [Streptomyces sp. C]
 gi|302448172|gb|EFL19988.1| predicted protein [Streptomyces sp. C]
          Length = 262

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 57/242 (23%), Positives = 97/242 (40%), Gaps = 13/242 (5%)

Query: 4   LIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
                  +     A  +   ++ LP+G+ EQHGPHLP+ TDT+IA     ++ +      
Sbjct: 8   HRQLDRQTAAALTARVQASSVLCLPVGSTEQHGPHLPLATDTLIADEFTRQLVAEHGEAF 67

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKM-GIRKIVILNAHGGNS 121
            +  +P  P G + EH +  GT +LT  E       +     +      +V++N HGGN 
Sbjct: 68  DLWQLPAVPYGIAPEHAWAPGTLSLTITEFTNLLHTLTAQYVRATKAHHLVLVNGHGGNR 127

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
            +++ +  E      + V                       IH G  ET++ML LAP  V
Sbjct: 128 GVLTALVYELGHAHHISVCVLHPLALANL-----PAGDRPEIHAGLHETALMLHLAPDTV 182

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKD--LNPKGVVG-NAMDATVKKGEGL 238
            +D   +   + ++     +        ++ W+  D  +   GV+G +   AT   G  L
Sbjct: 183 LLDQLADHPPQDAD---EIRRQVTDRGVTWPWTSGDPAIAAAGVIGNDPRTATPALGARL 239

Query: 239 LS 240
           L 
Sbjct: 240 LD 241


>gi|209967095|ref|YP_002300010.1| creatininase, putative [Rhodospirillum centenum SW]
 gi|209960561|gb|ACJ01198.1| creatininase, putative [Rhodospirillum centenum SW]
          Length = 245

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 47/254 (18%), Positives = 88/254 (34%), Gaps = 28/254 (11%)

Query: 5   IIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     S P      ++   +++P+G+ EQHGP   + TD I A  +A      L   + 
Sbjct: 1   MRLQLMSWPEVETYLQRRTDIIIPIGSTEQHGPTGLLGTDAITAEAIAW----KLGEAVG 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               P   +G +  H+   GT +L  +        ++ ++ + G   ++ +N HGGN   
Sbjct: 57  ACVGPTLGVGMAHHHLAFAGTVSLRPSTLAAVVADVVASLHRHGFTHMLFVNGHGGNVAT 116

Query: 124 VSIVSTEARMR--------FSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
           V++   E              +  +   W    +     S    + G HG   E S+  A
Sbjct: 117 VNMAFQEIAAASSFGGGSVPPVCSIVNWWDGNRVKDLARSLYGDQDGSHGTASEISVTWA 176

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKK 234
           + P  V+   AE   +  +               +     +   P G +G N   +    
Sbjct: 177 VHPDQVR--RAEFGPAPAA------------RPWTDAADFRRHFPDGRIGSNPALSDPAH 222

Query: 235 GEGLLSYFANCFIQ 248
           G  L+        +
Sbjct: 223 GTALIDAAVADLTE 236


>gi|114797561|ref|YP_762179.1| creatininase [Hyphomonas neptunium ATCC 15444]
 gi|114737735|gb|ABI75860.1| creatininase [Hyphomonas neptunium ATCC 15444]
          Length = 251

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 51/260 (19%), Positives = 95/260 (36%), Gaps = 31/260 (11%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           + P       K   +V+P+G++EQHGP+  + TD +    +A   +S+ P    +   P 
Sbjct: 7   TWPDIEAWLTKSKTIVIPIGSFEQHGPNGFIGTDALCPEIIANHAESLAPDD--ILIGPT 64

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G +  H+   GT TL  +  I   +   +++ + G  ++  LN HGGN   +    +
Sbjct: 65  FAVGCAQHHLGFPGTVTLRPSTMIASMVDWTESLMRHGFERLYWLNGHGGNIATIEAAFS 124

Query: 130 EARMRFSM------------LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
           E   R S             L     W    +   +     T  G H    E S+     
Sbjct: 125 EIHARRSFDPRGADNRPGLTLKRRDWWDFRDVMSTVNQLYPTGHGSHATASEVSVTYWGY 184

Query: 178 PHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGE 236
           P             R+    +    +   G+       +   P G +G +   + ++ G 
Sbjct: 185 PE------------RERSSTKMTPKIAPTGTIGDAVQYRRDFPDGRIGSDPTQSNIEDGG 232

Query: 237 GLLSYFANCFIQLLNDINSF 256
            +++  A C    L ++  F
Sbjct: 233 KIVAVAAKCV---LEEVARF 249


>gi|238620899|ref|YP_002915725.1| Creatininase [Sulfolobus islandicus M.16.4]
 gi|238381969|gb|ACR43057.1| Creatininase [Sulfolobus islandicus M.16.4]
          Length = 233

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 63/253 (24%), Positives = 115/253 (45%), Gaps = 24/253 (9%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   + +       R+D + ++P+G+ EQHGPHLPM TD II+  +A + +  L      
Sbjct: 1   MKLIEITRDEI---REDLVGLVPVGSIEQHGPHLPMGTDIIISEYVASKAEEKLKETT-- 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKM-GIRKIVILNAHGGNSPL 123
              P    G S+EH       +L++  AI  +  ++++I K  G+R+I+I+N HGGNS  
Sbjct: 56  LLFPTVYYGVSLEHKGFPF-ISLSFQTAISFFNDLLESIFKDLGLRRIIIVNGHGGNSYF 114

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           + +V  E  M++S   V          + + +       +H G +ETS + A+   +V++
Sbjct: 115 LPLVQREFNMKYSNAKVMIFNIFSEEEKLLFNV----NDLHAGTVETSKIYAIDKRVVRL 170

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV--GNAMDATVKKGEGLLSY 241
           +  E   S                     +S K+ N  GV+  G  +    + G+ +L+ 
Sbjct: 171 NKIEEIKSYDVRD-----------GVFVYYSTKEANQFGVLNDGKPIRIDEELGKKILAD 219

Query: 242 FANCFIQLLNDIN 254
             +  I L+ +  
Sbjct: 220 TVDKLIWLILNFK 232


>gi|222081117|ref|YP_002540480.1| creatininase (creatinine amidohydrolase) protein [Agrobacterium
           radiobacter K84]
 gi|221725796|gb|ACM28885.1| creatininase (creatinine amidohydrolase) protein [Agrobacterium
           radiobacter K84]
          Length = 270

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 56/262 (21%), Positives = 105/262 (40%), Gaps = 11/262 (4%)

Query: 1   MNPLIIFTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLA-ERIKSIL 58
           +   I   + +          D +++LP+G+ E  G H PM  D + A  +A +  ++  
Sbjct: 2   LTNKIKIAELTSEEARQFLNDDAVILLPMGSLEDQGTHAPMG-DYLAAEAVALDIARAAR 60

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P    PV P G +       G   L+ +  +     +   + + G+ K++++N HG
Sbjct: 61  AEGVPTFIAPVIPFGGADYFGSSHGGVALSQSTLVAVLDDMFACLARHGLTKVLVINGHG 120

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLA 175
           GN   ++ VS + R    M V S    + +     + +      +   HGG+  TS+ L 
Sbjct: 121 GNVGAINDVSLKWRQTNGMFVASMYLWQISYELLKEILGPEAAAKSSGHGGDPLTSVGLH 180

Query: 176 LAPHLVKMDLAENFSSRQSEF---LRNFKYLRAHGSHSFGWS-MKDLNPKGVV-GNAMDA 230
             P L++MDLA+     Q      +  F  L+  G+         +  P GV  G+ +  
Sbjct: 181 YYPELLRMDLAKAPPKGQKAMGVDVAGFAALKYAGARLQAPIEAMESAPNGVWGGDPVYC 240

Query: 231 TVKKGEGLLSYFANCFIQLLND 252
           + + G  L +         + D
Sbjct: 241 SAETGAALTARLVQIGAGFIRD 262


>gi|148238675|ref|YP_001224062.1| amidase [Synechococcus sp. WH 7803]
 gi|147847214|emb|CAK22765.1| Possible amidase [Synechococcus sp. WH 7803]
          Length = 262

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 54/264 (20%), Positives = 89/264 (33%), Gaps = 29/264 (10%)

Query: 2   NPLIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              I     S P      +    V++PLG+ EQHGP   + TD + A  +A      L  
Sbjct: 12  TDAIRLALQSWPDVDRYLQSCKGVIIPLGSTEQHGPTGAIGTDALTAEAVALE----LGR 67

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           R  V   PV+  G +  H+   GT +L  A  +     ++ ++   G  +I ++N HGGN
Sbjct: 68  RSGVLVTPVQAFGMAEHHLGFAGTMSLQPATLLAVLHDMVLSLATHGFERIFVVNGHGGN 127

Query: 121 SPLVS---------IVSTEARMRFSMLVVSTSWSRFT-IPQGIISFPETEIGIHGGEIET 170
                           S    +   +    ++W     + +          G H    E 
Sbjct: 128 MATTRAAFAQAYGTAASRGLEVAPRLRCKLSNWFMAGPVMRRARELYGDREGQHATPSEI 187

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ L L   L+    A                    GS       +   P G +G +   
Sbjct: 188 AVTLHLHNSLIAKQRA-------------LPEAAPCGSIHGPADFRRRYPDGRMGSDPYL 234

Query: 230 ATVKKGEGLLSYFANCFIQLLNDI 253
           A  + G  LL+  A    + L+  
Sbjct: 235 AKPEHGLELLNTAAEALREDLSTF 258


>gi|284998983|ref|YP_003420751.1| Creatininase [Sulfolobus islandicus L.D.8.5]
 gi|284446879|gb|ADB88381.1| Creatininase [Sulfolobus islandicus L.D.8.5]
          Length = 233

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 64/253 (25%), Positives = 116/253 (45%), Gaps = 24/253 (9%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   + +       R+D + ++P+G+ EQHGPHLPM TD+II+  +A + +  L      
Sbjct: 1   MKLIEITRDEI---REDLVGLVPVGSIEQHGPHLPMGTDSIISEYVASKAEEKLKETT-- 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKM-GIRKIVILNAHGGNSPL 123
              P    G S+EH       +L++  AI  +  ++++I K  G+R+I+I+N HGGNS  
Sbjct: 56  LLFPTVYYGVSLEHKGFPF-ISLSFQTAISFFNDLLESIFKDLGLRRIIIVNGHGGNSYF 114

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           + +V  E  M++S   V          + + +       +H G +ETS + A+   +V++
Sbjct: 115 LPLVQREFNMKYSNAKVMIFNIFGEEEKLLFNV----NDLHAGTVETSKIYAIDKRVVRL 170

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV--GNAMDATVKKGEGLLSY 241
           +  E   S                     +S K+ N  GV+  G  +    + G+ +L+ 
Sbjct: 171 NKIEEIKSYDVRD-----------GVFVYYSTKEANQFGVLNDGKPIRIDEELGKKILAD 219

Query: 242 FANCFIQLLNDIN 254
             N  I L+ +  
Sbjct: 220 TVNKLIWLILNFK 232


>gi|88807983|ref|ZP_01123494.1| hypothetical protein WH7805_07471 [Synechococcus sp. WH 7805]
 gi|88788022|gb|EAR19178.1| hypothetical protein WH7805_07471 [Synechococcus sp. WH 7805]
          Length = 262

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 54/264 (20%), Positives = 92/264 (34%), Gaps = 29/264 (10%)

Query: 2   NPLIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              I     S P      +    V++PLG+ EQHGP   + TD + A  +A      L  
Sbjct: 12  TDAIRLALQSWPDVDRYLQTCKGVIIPLGSTEQHGPTGAIGTDALTAEAVALE----LGR 67

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           R  V   PV+  G +  H+   GT +L  A  +     ++ ++   G  +I+++N HGGN
Sbjct: 68  RSGVLVTPVQAFGMAEHHLGFAGTMSLQPATLLAVLHDLVLSLATHGFERILVVNGHGGN 127

Query: 121 SPLVS---------IVSTEARMRFSMLVVSTSWSRFT-IPQGIISFPETEIGIHGGEIET 170
                           S    +   +    ++W     + +          G H    E 
Sbjct: 128 IATTRAAFAQAYGTAASRGLEVAPRLRCKLSNWFMAGPVMRRARELYGEREGQHATPSEI 187

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ L L                  E  R      A G+       +  +P G +G +   
Sbjct: 188 AVTLHLHR-------------CLQEKQRPLPEAAACGAIHGPQDFRRRHPDGRMGSDPYL 234

Query: 230 ATVKKGEGLLSYFANCFIQLLNDI 253
           A  + G+ LL+  A    + L+  
Sbjct: 235 AKPEHGQELLNTAAETLREDLSTF 258


>gi|254563039|ref|YP_003070134.1| Creatininase [Methylobacterium extorquens DM4]
 gi|254270317|emb|CAX26313.1| Creatininase [Methylobacterium extorquens DM4]
          Length = 266

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 89/251 (35%), Gaps = 18/251 (7%)

Query: 4   LIIFTDNSLPLCA--DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
            ++++D +               +LP+GA EQHGPHL    D ++A  L       +  R
Sbjct: 8   PLLWSDRTWEEIPGDLEAAAGAALLPIGATEQHGPHLGCGMDFVLADLLC----RAVSAR 63

Query: 62  LPVTCMPVEPIGYSIEH-MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
             V  +P  P G S+ H     GT  L      E    I       G+R++ ++NAH  N
Sbjct: 64  TRVPMLPALPYGCSLGHSRRWPGTLALDPVVMTELVRQIGSQAYHSGVRRLFLVNAHVTN 123

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           +  +       R     L+V+   +     +   +        H    ET++M A AP L
Sbjct: 124 AAPLRCALELLRAAHDDLMVALVNTATVSERVRAAHFADAEDWHANRAETALMQAQAPAL 183

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V+ D                       +  F   +   +  GV G+   A   +G  L +
Sbjct: 184 VREDRIAKADDPDR-----------THNLVFAHPVNRTSRNGVTGSPSRANAAEGAELFA 232

Query: 241 YFANCFIQLLN 251
           +       L+ 
Sbjct: 233 WMVEDLTALVR 243


>gi|289643567|ref|ZP_06475683.1| Creatininase [Frankia symbiont of Datisca glomerata]
 gi|289506633|gb|EFD27616.1| Creatininase [Frankia symbiont of Datisca glomerata]
          Length = 240

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 59/235 (25%), Positives = 96/235 (40%), Gaps = 27/235 (11%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
              + + P  A+     ++ +PLGA EQHGPHLP+  DT +A  L ER+      R  V 
Sbjct: 8   RLAELAWPEVAERAAASVLAVPLGATEQHGPHLPLTVDTELATALCERLAR---ARSWVL 64

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
             P  P G S EH    GT ++         + ++ +        ++++  HGGN+  + 
Sbjct: 65  VAPALPYGASGEHAGFPGTLSIGQDGVELLLVELVRS--ADAFAGVLLVCGHGGNAAPLR 122

Query: 126 IVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
                 R     ++          P             H G  ETS+MLAL    V++D 
Sbjct: 123 RAVARLRGEGRRVLA----WLPGGPAD---------DAHAGRTETSVMLALRGQAVRLDH 169

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
            E   +R    L     LR  G       ++ ++P GV+G+   ++ + G  +L 
Sbjct: 170 VEPGVTRPIGEL--LPALRESG-------VRAVSPNGVLGDPTGSSARAGTRILD 215


>gi|55376664|ref|YP_134515.1| creatinine amidohydrolase [Haloarcula marismortui ATCC 43049]
 gi|55229389|gb|AAV44809.1| creatinine amidohydrolase [Haloarcula marismortui ATCC 43049]
          Length = 252

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 53/231 (22%), Positives = 86/231 (37%), Gaps = 21/231 (9%)

Query: 4   LIIFTDNSLPLCADARKDWI--VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
            +   + + P    A ++    VV+ +G+ EQHGPHLP+N DT+    LA RI + +   
Sbjct: 6   SVCLEEMAWPEIESALENGTRTVVVAVGSIEQHGPHLPLNMDTLDGDELARRIAAEMGD- 64

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
                 P    G S  HM   GT T+     ++   +   ++   G   IV++  HGGN 
Sbjct: 65  --ALAAPTIRPGCSGHHMEFPGTITVPPETLMDVIRSYCRSLDTHGFEHIVLVPTHGGNF 122

Query: 122 PLVSIVSTEARMRFSMLVVS-----TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
             V  V+ +         +                        +  IH G  ET+++LA+
Sbjct: 123 GPVKTVAPDIARELEAAAIPLADLDEHMQLLNQGLSKAGIEYEQDVIHAGAAETAIVLAI 182

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNA 227
              LV+M+  E          R                 K +   GV+G+ 
Sbjct: 183 DEGLVRMEDVEPGPEGDISPARLLSD-----------GFKSITENGVLGDP 222


>gi|229580997|ref|YP_002839396.1| Creatininase [Sulfolobus islandicus Y.N.15.51]
 gi|228011713|gb|ACP47474.1| Creatininase [Sulfolobus islandicus Y.N.15.51]
          Length = 233

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/253 (25%), Positives = 116/253 (45%), Gaps = 24/253 (9%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   + +       R+D + ++P+G+ EQHGPHLPM TD+II+  +A + +  L      
Sbjct: 1   MKLIEITRDEI---REDLVGLVPVGSIEQHGPHLPMGTDSIISENVASKAEEKLKETT-- 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKM-GIRKIVILNAHGGNSPL 123
              P    G S+EH       +L++  AI  +  ++++I K  G+R+I+I+N HGGNS  
Sbjct: 56  LLFPTVYYGVSLEHKGFPF-ISLSFQTAISFFNDLLESIFKDLGLRRIIIVNGHGGNSYF 114

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           + +V  E  M++S   V          + + +       +H G +ETS + A+   +V++
Sbjct: 115 LPLVQREFNMKYSNAKVMIFNIFGEEEKLLFNV----NDLHAGTVETSKIYAIDKRVVRL 170

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV--GNAMDATVKKGEGLLSY 241
           +  E   S                     +S K+ N  GV+  G  +    + G+ +L+ 
Sbjct: 171 NKIEEIKSYDVRD-----------GVFVYYSTKEANQFGVLNDGKPIRIDEELGKKILAD 219

Query: 242 FANCFIQLLNDIN 254
             N  I L+ +  
Sbjct: 220 TVNKLIWLILNFK 232


>gi|308178499|ref|YP_003917905.1| creatininase [Arthrobacter arilaitensis Re117]
 gi|307745962|emb|CBT76934.1| possible creatininase [Arthrobacter arilaitensis Re117]
          Length = 264

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 59/265 (22%), Positives = 99/265 (37%), Gaps = 31/265 (11%)

Query: 3   PLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
             +   +      A+  AR    +++P GA EQHGPH+P+  D +++  +AE +  +   
Sbjct: 2   HSVFIDELDAQTYAEHVARTGSTIIIPAGATEQHGPHMPLGVDAMLSRSIAEAVAQLTG- 60

Query: 61  RLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
                  P    GY     S    +  GT +L           ++ +    G   +V+LN
Sbjct: 61  ---ALVAPALCYGYKSQPRSGGGNHRVGTTSLGGTSLSLMVEDVVASFISQGFDNVVLLN 117

Query: 116 AHGGNSPLV-----SIVSTEARMRFSMLVVSTSWSRFTIPQGIIS-FPETEIGI---HGG 166
            H  N   +     + V+       +   +  S+  F     +   FP+  +G    HGG
Sbjct: 118 GHFENYQFLYEGVDNAVAKTRTAGSTARAILLSYWDFVDENTLAKVFPDGFLGWDIEHGG 177

Query: 167 EIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGN 226
            +ETS+ML L P LV MD   +    +      F    A                G + +
Sbjct: 178 ILETSLMLLLHPQLVDMDRVIDHPPAKLTAYDIFPEDPARTP-----------DSGCLSS 226

Query: 227 AMDATVKKGEGLLSYFANCFIQLLN 251
           A  AT ++G+ L     +   Q L 
Sbjct: 227 AKGATAERGQLLFETVTDQVAQALK 251


>gi|254431671|ref|ZP_05045374.1| creatininase [Cyanobium sp. PCC 7001]
 gi|197626124|gb|EDY38683.1| creatininase [Cyanobium sp. PCC 7001]
          Length = 271

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 51/268 (19%), Positives = 85/268 (31%), Gaps = 29/268 (10%)

Query: 2   NPLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              I     + P      +    V++PLG+ EQHGP   + TD + A  +A  +      
Sbjct: 20  TEDIRLQLRTWPEVEAYLERCRAVIVPLGSTEQHGPTGAIGTDALTAEAVALEV----GR 75

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           R  V   P +  G +  H+   GT +L  +  +     ++ ++   G  +I ++N HGGN
Sbjct: 76  RSGVLVTPAQAFGMAEHHLGFAGTVSLQPSTLMAVLHDVVLSLAGHGFERIFVINGHGGN 135

Query: 121 SPLVS---------IVSTEARMRFSMLVVSTSWSRFTIP-QGIISFPETEIGIHGGEIET 170
                           S        +     +W       Q          G H    E 
Sbjct: 136 IATSKAAFAQAYATAASRGLPRAAELRCRLANWFMVPTVFQKARELYGDLEGHHATPSEI 195

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ L L P L+         +              HG        +  +P G +G +   
Sbjct: 196 ALTLHLEPSLMGQQRPLPAPAPAGPI---------HGPA----DFRRRHPDGRMGSDPFL 242

Query: 230 ATVKKGEGLLSYFANCFIQLLNDINSFD 257
           A  + G   L   A      L    + D
Sbjct: 243 ARAEHGAIFLDLAATALCTDLERFLNTD 270


>gi|110632440|ref|YP_672648.1| creatininase [Mesorhizobium sp. BNC1]
 gi|110283424|gb|ABG61483.1| Creatininase [Chelativorans sp. BNC1]
          Length = 267

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 53/256 (20%), Positives = 107/256 (41%), Gaps = 11/256 (4%)

Query: 7   FTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIK-SILPPRLPV 64
               +     +    D ++++P+G+ E  G H PM  D + A  +A+RI  +      P 
Sbjct: 5   LAQLTSQEGRELLTDDAVILIPMGSLEDQGVHAPMG-DYLAAKLIADRIAQAATAAGTPT 63

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              PV P G         G   L  +        ++ ++ + G+++IV++N HGGN P++
Sbjct: 64  FTAPVIPFGAEDYFGLTHGGIALRSSTLRALLDDMVGSLYRRGLKRIVLINGHGGNVPVI 123

Query: 125 SIVSTEARMRFSMLVVSTSWSRFT---IPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           + ++ + R    M + S    +     + + +       +  HG +  TS+ L L P ++
Sbjct: 124 TELALKWRRDKGMFITSLYLWQMAYGILRKELGDAEAARVSGHGADPLTSVGLHLYPEIL 183

Query: 182 KMDLAENFSSRQS---EFLRNFKYLRAHG-SHSFGWSMKDLNPKGVV-GNAMDATVKKGE 236
           +MDLA+   +        ++ + YL   G          +  P G+  GN   ++ ++G+
Sbjct: 184 RMDLAKGPPTNPMLKGLKIQQYGYLEYEGSPVQAPIEAAECGPDGIWGGNPKYSSPERGK 243

Query: 237 GLLSYFANCFIQLLND 252
            L+          + D
Sbjct: 244 MLVERLTALGAGYIRD 259


>gi|15899547|ref|NP_344152.1| hypothetical protein SSO2832 [Sulfolobus solfataricus P2]
 gi|284174684|ref|ZP_06388653.1| hypothetical protein Ssol98_08511 [Sulfolobus solfataricus 98/2]
 gi|13816187|gb|AAK42942.1| Conserved hypothetical protein [Sulfolobus solfataricus P2]
 gi|261601319|gb|ACX90922.1| Creatininase [Sulfolobus solfataricus 98/2]
          Length = 233

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 58/246 (23%), Positives = 109/246 (44%), Gaps = 24/246 (9%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   + +         D + ++P+G+ EQHGPHLPM TD II+  +A + +  L      
Sbjct: 1   MKLVEITREEIRG---DLVGLVPVGSIEQHGPHLPMGTDGIISEYIASKAEEKLKD--IT 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKM-GIRKIVILNAHGGNSPL 123
              P    G S+EH       +L++  AI  +  +++++    G+R+I+I+N HGGNS  
Sbjct: 56  LLFPTIYYGVSLEHKGFPF-VSLSFQTAISFFTDLLESVFNDLGLRRIIIVNGHGGNSYF 114

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           + +V  E  M+ S   V    +     + + +       +H G IETS + A+   LV++
Sbjct: 115 LPLVQREFNMKHSDAKVIVFNTFGEEEKILFNV----NDLHAGTIETSKIWAIGKSLVRV 170

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV--GNAMDATVKKGEGLLSY 241
           +  +   + +                   +S ++ N  GV+  G  +    + G+ +L  
Sbjct: 171 NKIDEIKNYEVRD-----------GVFIYYSSREANQFGVLNDGKPIRVNEEYGKKILRD 219

Query: 242 FANCFI 247
             +  I
Sbjct: 220 LVDKLI 225


>gi|239927696|ref|ZP_04684649.1| hypothetical protein SghaA1_05684 [Streptomyces ghanaensis ATCC
           14672]
          Length = 229

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 62/225 (27%), Positives = 97/225 (43%), Gaps = 20/225 (8%)

Query: 28  LGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTL 87
           +G+YEQHGP LP+ TDT++A  +A  I    P    V  +P   I  S EH    GT +L
Sbjct: 1   MGSYEQHGPFLPLATDTLVACAVAREIADAYP----VHLLPPVTISCSHEHAAWPGTVSL 56

Query: 88  TYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST--EARMRFSMLVVSTSWS 145
           +          I D++R+ G+  +V++N HGGN  L ++V        R ++      W 
Sbjct: 57  SSVTLHAVVRDIADSLRRSGVEALVLVNGHGGNYVLGNVVQESSARGERTALFPAPEDWE 116

Query: 146 RFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRA 205
                 G+++   T   +H GEIETS++L   P L++                    +  
Sbjct: 117 TARRRAGVVTSLLT--DMHAGEIETSILLHTHPELLRP------------GYETSDSVAD 162

Query: 206 HGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
              H     M      GV+G     + +KG+ LL+  A+ F    
Sbjct: 163 DRRHLLSLGMAAYTDSGVIGRPSLGSAEKGKKLLASLADSFGAYF 207


>gi|229580368|ref|YP_002838768.1| Creatininase [Sulfolobus islandicus Y.G.57.14]
 gi|228011084|gb|ACP46846.1| Creatininase [Sulfolobus islandicus Y.G.57.14]
          Length = 233

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 62/253 (24%), Positives = 114/253 (45%), Gaps = 24/253 (9%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   + +       R+D + ++P+G+ EQHGPHLPM TD+II+  +A + +  L      
Sbjct: 1   MKLIEITRDEI---REDLVGLVPVGSIEQHGPHLPMGTDSIISEYVASKAEEKLKETT-- 55

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKM-GIRKIVILNAHGGNSPL 123
              P    G S+EH       +L++  AI  +  ++++I    G+R+I+I+N HGGNS  
Sbjct: 56  LLFPTVYYGVSLEHKGFPF-ISLSFQTAISFFNDLLESIFNDLGLRRIIIVNGHGGNSYF 114

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
           + +V  E  M++S   V          + + +       +H G +ETS +  +   +V++
Sbjct: 115 LPLVQREFNMKYSNAKVMIFNIFGEEEKLLFNV----NDLHAGTVETSKIYTIDKRVVRL 170

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV--GNAMDATVKKGEGLLSY 241
           +  E   S                     +S K+ N  GV+  G  +    + G+ +L+ 
Sbjct: 171 NKIEEIKSYDVRD-----------GVFVYYSTKEANQFGVLNDGKPIRIDEELGKKILAD 219

Query: 242 FANCFIQLLNDIN 254
             N  I L+ +  
Sbjct: 220 TVNKLIWLILNFK 232


>gi|88705774|ref|ZP_01103483.1| Creatininase [Congregibacter litoralis KT71]
 gi|88699845|gb|EAQ96955.1| Creatininase [Congregibacter litoralis KT71]
          Length = 249

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 49/258 (18%), Positives = 85/258 (32%), Gaps = 29/258 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        +    ++LP+G+ EQHGP   + TD I    +AE   +  P    +   P 
Sbjct: 5   TWCDVEAYLERSRSILLPIGSMEQHGPTGLIGTDAICPTVIAEAAAAEDPE---ILIGPT 61

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G +  H+   G+ TL  +  I        ++R+ G  +I   N HGGN   ++    
Sbjct: 62  FSVGCAQHHLGFPGSMTLRPSTMIAAIADWSTSLRRHGFERIYWFNGHGGNVATIAAAFA 121

Query: 130 EARMRFSM-----------LVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           E   + S            +     W    +            G H    E ++  A  P
Sbjct: 122 EVYAQRSFAGADSDIPALQMKQRNWWELPGVMSTCRRLHPKNEGSHATASEVAVTYAAYP 181

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEG 237
             V+              L     +   G  S     +     G +G +   ATV  G+ 
Sbjct: 182 EQVR-------------NLDLDPKVAPSGGFSDADDYRRRYADGRIGSDPTQATVAAGKE 228

Query: 238 LLSYFANCFIQLLNDINS 255
           +++  AN   +       
Sbjct: 229 IIAAAANALREDFLAFAR 246


>gi|171911207|ref|ZP_02926677.1| hypothetical protein VspiD_08535 [Verrucomicrobium spinosum DSM
           4136]
          Length = 261

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/254 (22%), Positives = 97/254 (38%), Gaps = 13/254 (5%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLA-ERIKSILPPRLPV 64
           I  + +      + K  + VLP+GA E H  HLP  TD+     L  E  +        V
Sbjct: 12  IIAETNWKQV-QSTKYEVAVLPMGATEAHNWHLPYGTDSFQNVALCSEAGRQAWEQGAKV 70

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
             +P  P G     + +     +  +  +     +I ++  +GI K+V+ N HGG     
Sbjct: 71  AILPNIPFGVQTGQLDIPFCINMNPSTQLALLNDVIASLVGVGIPKLVVFNGHGG--SDF 128

Query: 125 SIVSTEARMRFSMLVVST-SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
             +  E + ++  + +ST  W       GI       +G H  E ETS+ML   P LV  
Sbjct: 129 KQMLRELQAKWPQIFLSTVFWPNIDSGAGIFDV----LGDHADERETSLMLHFHPELVLP 184

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
                     +  L+  K   A    ++  + +D       G    +T +KG    +  +
Sbjct: 185 KETWGDGKANAWKLQAMKEKWAWAQRAWTQATQDTG----SGTPAASTAEKGAQYAALLS 240

Query: 244 NCFIQLLNDINSFD 257
           +     L ++ + D
Sbjct: 241 SRLASYLVELAAAD 254


>gi|126737597|ref|ZP_01753327.1| Creatininase [Roseobacter sp. SK209-2-6]
 gi|126720990|gb|EBA17694.1| Creatininase [Roseobacter sp. SK209-2-6]
          Length = 253

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 49/255 (19%), Positives = 89/255 (34%), Gaps = 14/255 (5%)

Query: 5   IIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +     +        RK   ++LP+G+ EQHGP   + TDTI A  +A            
Sbjct: 1   MKLEHMTWQEVDNRIRKGAAIILPVGSTEQHGPMGRIGTDTICAKAVALLAAEACD---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
               P      +  +    GT ++       H  AI+  +   G   + ++N HG N   
Sbjct: 57  AIVAPPLAYTPAPFNTAFPGTVSMPEEIFQAHAGAIVTGLLAQGFLGVFVVNGHGANLAP 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGI-ISFPETEIGIHGGEIETSMMLALAPHLVK 182
           +  ++   +      +   SW       G+         G+H    E ++   L   L  
Sbjct: 117 LRAIANSCK---PEQMRIRSWWEPEEVNGLRRDLYGDWEGMHATPSEVAITQYLLGVLPS 173

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLSY 241
            D +E  +    E+++     R           + + P G VG ++  AT + GE +L+ 
Sbjct: 174 GDASEAPTKLTQEYIQEHSGDRHGRPEEH----RQMFPDGRVGSHSALATPEDGERILAA 229

Query: 242 FANCFIQLLNDINSF 256
            +    +   D    
Sbjct: 230 ASQSIAREFLDFEES 244


>gi|310815541|ref|YP_003963505.1| Creatininase [Ketogulonicigenium vulgare Y25]
 gi|308754276|gb|ADO42205.1| Creatininase [Ketogulonicigenium vulgare Y25]
          Length = 250

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 62/241 (25%), Positives = 93/241 (38%), Gaps = 19/241 (7%)

Query: 3   PLIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
           P + F         A   +  + VLPLGA EQHG HLP+  D  +A G+A  I   L   
Sbjct: 2   PALDFAFTPWTDVEARLTRPTVAVLPLGAVEQHGAHLPLTVDADLALGVARAIADPLD-- 59

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
                +P  P G +  +    GT +L+ A        I   +++MG+  +++LN H GN 
Sbjct: 60  --ALLLPAMPYGDAWNNAAYPGTLSLSPATLRAAITDIGKGLQEMGVSSLILLNGHFGNH 117

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGI--ISFPETEIGIHGGEIETSMMLALAPH 179
             + + + +      +  +   +            S P      H  E+ETSMMLAL P 
Sbjct: 118 EPMLLAARD-LAGGGLPCLHLDYPGLAELAEKHCDSTPAAPHFYHADEVETSMMLALRPD 176

Query: 180 LVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLL 239
            V+M  A                            ++  NP GV G+   AT  KG   +
Sbjct: 177 AVRMADAAPSYPTFPATFGAEPM-----------QLRSFNPSGVFGDPRPATANKGRAFI 225

Query: 240 S 240
            
Sbjct: 226 E 226


>gi|229490589|ref|ZP_04384427.1| creatininase family protein [Rhodococcus erythropolis SK121]
 gi|229322409|gb|EEN88192.1| creatininase family protein [Rhodococcus erythropolis SK121]
          Length = 230

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 61/248 (24%), Positives = 97/248 (39%), Gaps = 32/248 (12%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M+          P          VV+P+G++EQHGPHLP++TDT IA  +A+ +      
Sbjct: 1   MSSPRDLAAIPSPALEGTA--LTVVVPVGSFEQHGPHLPLDTDTRIARAVAQAL------ 52

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V   P    G S EH    GT ++         +    +  +   ++++ +N HGGN
Sbjct: 53  -PDVVVAPAIEYGASGEHEGFAGTISIGAEAMETVVVEYGRSAFRW-TKRVLFVNGHGGN 110

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
            P ++      R           W+   +              H G  ETS++L L+P L
Sbjct: 111 GPALAKAVALLRYEGRDAA----WAPCAVA---------GADAHAGHTETSLLLHLSPDL 157

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M LAE  +   S        +R+ G       M  ++  GV+GN + AT + G  +  
Sbjct: 158 VHMSLAETGN--LSPIADLMPGMRSGG-------MVAVSQNGVLGNPVGATAEDGAYIFG 208

Query: 241 YFANCFIQ 248
                   
Sbjct: 209 ELVGRVTD 216


>gi|146304172|ref|YP_001191488.1| creatininase [Metallosphaera sedula DSM 5348]
 gi|145702422|gb|ABP95564.1| Creatininase [Metallosphaera sedula DSM 5348]
          Length = 226

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 106/251 (42%), Gaps = 28/251 (11%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   + +     D     I V+P+G+ EQHGPHLP+ TD++IA  +AE++  I      +
Sbjct: 1   MRILELT----KDELSSPIGVIPVGSIEQHGPHLPLGTDSMIAEAVAEKVAQIEG----L 52

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P    G S+EH  +    ++     +     I+++  K+ I+ +V++N HGGN+ L+
Sbjct: 53  LLFPTVYYGCSVEHGDLP-QVSIGDVNFLNMMGDILESSVKLNIKGLVLVNGHGGNTDLL 111

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
            +V+           V        +    I        +H G +ETS++L L P LV++D
Sbjct: 112 KVVTRRVNFTRPRPKV------MLVDLHEIGIFSQYRDLHAGTVETSLLLYLRPELVRLD 165

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
              +  S        F  + +    S G   + + P          + + GE +     N
Sbjct: 166 RIPSNISFSPF---TFTLITSEKGGSNGVVAEKVEP----------SKELGERVFKEMIN 212

Query: 245 CFIQLLNDINS 255
             +  + +  S
Sbjct: 213 FVMNRVKEFRS 223


>gi|302539143|ref|ZP_07291485.1| predicted protein [Streptomyces sp. C]
 gi|302448038|gb|EFL19854.1| predicted protein [Streptomyces sp. C]
          Length = 253

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 49/262 (18%), Positives = 96/262 (36%), Gaps = 24/262 (9%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           ++  D + P       D  V++P+GA E HGPHLP+ +DT+I+   A R+ + +      
Sbjct: 1   MLIGDMTWPDLNPGP-DTHVIIPVGALEPHGPHLPLGSDTMISDHFAHRLAAAVA----G 55

Query: 65  TCMPVEPIGYSIEHMY----VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              P    G +           G  ++T A        I+ A+   G R++++LN+   N
Sbjct: 56  HVAPSIGYGVATPGQRLGGTFPGVISITGATLTALVTEILTALADHGYRRLILLNSAIDN 115

Query: 121 SPLVSIVSTEARMR-FSMLVVSTSWSRFTIPQGIISFPE-----TEIGIHGGEIETSMML 174
              +   +           V+  +W          +  E          H G +E+S+++
Sbjct: 116 IAFLCEAARHLTEHVPGARVMIVNWWDVVGEDFRNALAEETGTARADDHHAGMVESSLVM 175

Query: 175 ALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKK 234
            ++PH V+ +        +     ++        H +          G+V  A  A+ + 
Sbjct: 176 HISPHAVRPNRLPADGGTERPRRISY--------HLYPQPADTTTSTGIVYTAAHASPEL 227

Query: 235 GEGLLSYFANCFIQL-LNDINS 255
           G  +    A       L +  +
Sbjct: 228 GRRVADQVAAQLADAVLREFTA 249


>gi|308396513|ref|ZP_07492314.2| hypothetical protein TMLG_03187 [Mycobacterium tuberculosis
           SUMu012]
 gi|308367072|gb|EFP55923.1| hypothetical protein TMLG_03187 [Mycobacterium tuberculosis
           SUMu012]
          Length = 221

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 55/232 (23%), Positives = 91/232 (39%), Gaps = 29/232 (12%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR------LPVTCMPVEPIGYSIEH 78
           ++PLG+ EQHGPHLP++TDT IA  +A  + + L               P    G S EH
Sbjct: 1   MIPLGSTEQHGPHLPLDTDTRIATAVARTVTARLHAEDLPIAQEEWLMAPAIAYGASGEH 60

Query: 79  MYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSML 138
               GT ++         +    +      R++V +N HGGN   ++      R      
Sbjct: 61  QRFAGTISIGTEALTMLLVEYGRSAACW-ARRLVFVNGHGGNVGALTRAVGLLRAEGRDA 119

Query: 139 VVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLR 198
                W   T P G           H G  ETS++L L+P  V+ +     +      L 
Sbjct: 120 ----GWCPCTCPGG---------DPHAGHTETSVLLHLSPADVRTERWRAGNRAPLPVL- 165

Query: 199 NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
               +R  G  +       ++  GV+G+   AT  +G  + +   +  ++ +
Sbjct: 166 -LPSMRRGGVAA-------VSETGVLGDPTTATAAEGRRIFAAMVDDCVRRV 209


>gi|3873398|gb|AAC77474.1| unknown [Rhodococcus erythropolis]
          Length = 230

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 61/248 (24%), Positives = 96/248 (38%), Gaps = 32/248 (12%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M+          P          VV+P+G++EQHGPHLP++TDT IA  +A+ +      
Sbjct: 1   MSSPRDLAAIPSPALEGTA--LTVVVPVGSFEQHGPHLPLDTDTRIARAVAQAL------ 52

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V   P    G S EH    GT ++         +    +  +   ++++ +N HGGN
Sbjct: 53  -PDVVVAPAIEYGASGEHEGFAGTISIGAEAMETLVVEYGRSAFRW-TKRVLFVNGHGGN 110

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
            P ++      R           W    +              H G  ETS++L L+P L
Sbjct: 111 GPALAKAVALLRYEGRDAA----WVPCAVA---------GADAHAGHTETSLLLHLSPDL 157

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V M LAE  +   S        +R+ G       M  ++  GV+GN + AT + G  +  
Sbjct: 158 VHMSLAETGN--LSPIADLMPGMRSGG-------MVAVSQNGVLGNPVGATAEDGAYIFG 208

Query: 241 YFANCFIQ 248
                   
Sbjct: 209 ELVGRVTD 216


>gi|325168378|ref|YP_004280168.1| creatininase [Agrobacterium sp. H13-3]
 gi|325064101|gb|ADY67790.1| creatininase [Agrobacterium sp. H13-3]
          Length = 285

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 57/264 (21%), Positives = 107/264 (40%), Gaps = 14/264 (5%)

Query: 3   PLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
             +  +  +    A   K   ++++PL + E+ GPH PM  D ++   LAE         
Sbjct: 5   EPVAISRMTHETFAARMKRPAVILIPLASQEEQGPHAPMG-DFMLTERLAEMSARA---- 59

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
                 PV P G++     + G   L  A        I+ +    G  +++I N H  N+
Sbjct: 60  GDGLTAPVLPFGHAEFFRAISGGIQLRAATFTAVLEDILTSFLDHGHEQLLIFNGHTTNA 119

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIP---QGIISFPETEIGIHGGEIETSMMLALAP 178
           PL+  V  + R    +L+ + +  +       + +     T +  HGGE  TS+ + L P
Sbjct: 120 PLIDQVCRKLRREKGVLIPALNIWQSLPDSLWKTLYGDDATRVRGHGGEPMTSVYMHLFP 179

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHG----SHSFGWSMKDLNPKGVV-GNAMDATVK 233
            LV+ +   + + R S F      + A               +++P G++ G A  A+ +
Sbjct: 180 ELVRTEAMRDPAPRGSVFGLPVGGVSATRFEGIPVQIPLDCTEVDPAGMLGGRASLASAE 239

Query: 234 KGEGLLSYFANCFIQLLNDINSFD 257
           KG+ +  +      +L+  +  FD
Sbjct: 240 KGQVICDHIVGHTARLMRHLAGFD 263


>gi|300788797|ref|YP_003769088.1| creatinine amidohydrolase [Amycolatopsis mediterranei U32]
 gi|299798311|gb|ADJ48686.1| creatinine amidohydrolase [Amycolatopsis mediterranei U32]
          Length = 250

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 53/257 (20%), Positives = 90/257 (35%), Gaps = 17/257 (6%)

Query: 6   IFTDNSLPLCADARKD---WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL--PP 60
            F D S    A    D    +++LP+GA E HGPH P+ TD +I+ G+ ER    L    
Sbjct: 3   YFADLSSRQVASLPDDERVPVLLLPVGAIEPHGPHAPLGTDPLISRGMCERAAERLAADD 62

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            + V  +P  P G +       G   +         + I  A+    + +I+++N H   
Sbjct: 63  DVHVLVLPEVPYGVTRFAAGFAGGIHIGEETLHSLLVDIGAALIAQRLGRILLVNNHFEP 122

Query: 121 SP--LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           +    +   +      +   V      R    + +          H G  ETS++LA  P
Sbjct: 123 AHLVTLRRAAETLNFAYDGRVALLELVRRRHAERLTDEF-RSGECHAGRYETSLVLADRP 181

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
            LV   L                     G    G +          G   +AT ++GE  
Sbjct: 182 ELVDQTLMRTLPHVPVSLAAAP---ADGGFREMGMT------DAYCGKPAEATAREGEET 232

Query: 239 LSYFANCFIQLLNDINS 255
            S   +  ++ + ++  
Sbjct: 233 FSTLTDLLVEAIRELAR 249


>gi|197106872|ref|YP_002132249.1| creatinine amidohydrolase [Phenylobacterium zucineum HLK1]
 gi|196480292|gb|ACG79820.1| creatinine amidohydrolase [Phenylobacterium zucineum HLK1]
          Length = 249

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 45/248 (18%), Positives = 78/248 (31%), Gaps = 27/248 (10%)

Query: 11  SLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        ++   VV+P+G+ EQHGP   + TD +    +A   +        +   P 
Sbjct: 7   TWAEIEGFLQRSETVVIPIGSNEQHGPTGLLGTDWLCPEIIAHEAEKQ----GDILVAPT 62

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             IG +  H+   GT  L  +  +        ++   G  K+  LN HGGN   +    +
Sbjct: 63  FNIGMAQHHLDFPGTIALRPSTFMLAIGDWCRSLGHAGFEKLYFLNGHGGNVATIEAAFS 122

Query: 130 EARMRF-------SMLVVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPHLV 181
           E                   +W        +  S   T  G H    E ++     P  +
Sbjct: 123 ELYAEASYAGRKRGFACKLKNWWDLKGVTALANSQFPTGHGSHATPSEIAVTQWAYPQAI 182

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLS 240
           K                    +   G        +     G +G +   AT +KG  L+ 
Sbjct: 183 K-------------SANYAPQIAPTGPIREATDFRARYADGRMGSDPGQATPEKGGELVR 229

Query: 241 YFANCFIQ 248
             A   ++
Sbjct: 230 TAAAALLE 237


>gi|78185623|ref|YP_378057.1| hypothetical protein Syncc9902_2056 [Synechococcus sp. CC9902]
 gi|78169917|gb|ABB27014.1| conserved hypothetical protein [Synechococcus sp. CC9902]
          Length = 262

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/268 (17%), Positives = 88/268 (32%), Gaps = 29/268 (10%)

Query: 2   NPLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              I     S P      +    V++PLG+ EQHGP   + TD + A  +A  +      
Sbjct: 12  TDNIRLALRSWPEVETYLQTCKGVIIPLGSTEQHGPTGAIGTDALTAEAIALEVGRRTG- 70

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V   P +  G +  H+   GT +L  A  +     ++ ++ + G  ++ ++N HGGN
Sbjct: 71  ---VLVTPAQAFGMAEHHLGFAGTMSLQPATLLAVMQDLVLSLARHGFERVFVINGHGGN 127

Query: 121 SPLVSIVSTEAR---------MRFSMLVVSTSWSRFT-IPQGIISFPETEIGIHGGEIET 170
                    +A              +    ++W     + +        + G H    E 
Sbjct: 128 IATTKAAFAQAHGTAASRGLPASPHLRCRLSNWFMAGPVMRQARDLYGDKEGHHATPSEI 187

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ L + P L          +               G        +  +P G +G +   
Sbjct: 188 AVTLQVEPSLQSKQRPLEDPA-------------PAGPIHGPDDFRRRHPDGRMGSHPSL 234

Query: 230 ATVKKGEGLLSYFANCFIQLLNDINSFD 257
           AT   G  ++   A    + L    S  
Sbjct: 235 ATADHGAAIIETAATALSEDLRSFLSDP 262


>gi|284044248|ref|YP_003394588.1| creatininase [Conexibacter woesei DSM 14684]
 gi|283948469|gb|ADB51213.1| Creatininase [Conexibacter woesei DSM 14684]
          Length = 255

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 69/261 (26%), Positives = 115/261 (44%), Gaps = 19/261 (7%)

Query: 9   DNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
           + + P  A   + +  + ++PLGA EQHGPHLP+ TD IIA  LA  + + L    PV  
Sbjct: 3   ELTSPQLAAVGSDEQAVGLIPLGAVEQHGPHLPVATDAIIARHLAGEVAARLTE--PVLV 60

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126
            PV P+G S  H+   GT  L          A  DA+R +G+R++ I +AHGGN   ++ 
Sbjct: 61  APVLPLGVSAHHLGFAGTVHLDAEAFGACVRAYADAMRDLGLRRVAIFSAHGGNFAAIAE 120

Query: 127 VSTEARMRFSMLVVSTSWSR-----FTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
           V+        + V++ +             G       +   H G +ETS +L L   + 
Sbjct: 121 VAASYADDPGVEVIAYTDFTRYLGAMRSGAGRAGVVVPDADTHAGGLETSQILYLE-RIF 179

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
            +D A       ++     + + A G       +  L+  GV+G    AT   G  + + 
Sbjct: 180 GLDPAGVPDGYAADEEGWVERMNAEG-------IAALSANGVLGLPRLATSPAGRAICAA 232

Query: 242 FANCFIQLLNDINSFDVSIFD 262
            A+   + + +  +F ++  D
Sbjct: 233 LADELAEWIRE--AFGLAQAD 251


>gi|111225224|ref|YP_716018.1| putative creatininase [Frankia alni ACN14a]
 gi|111152756|emb|CAJ64499.1| Conserved hypothetical protein; putative Creatininase [Frankia alni
           ACN14a]
          Length = 227

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/228 (28%), Positives = 103/228 (45%), Gaps = 20/228 (8%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           +LPLG+ EQHGPHLP++TDT IA+ +A  +   L P L    +P    G S EH    GT
Sbjct: 1   MLPLGSTEQHGPHLPLDTDTRIASAVAHGLAQRLEPLLVGAALP---YGASGEHAGFPGT 57

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSW 144
            +L         + ++ ++     R +V++N HGGN   +             + +   W
Sbjct: 58  VSLGTQVLERVVVELVRSVDDT-ARAVVLVNGHGGNIAALRSARRILAGEGRPVFL---W 113

Query: 145 SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLR 204
           +        +  P  +  +H G  ETS++L LAP LV++DLA    S     L       
Sbjct: 114 APVAALAATVGVPAADRDLHAGRGETSLLLHLAPDLVRLDLAVAGPSPSLAEL------- 166

Query: 205 AHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
                     +  L+P GV+G+   A+  +G  LL  + +  ++ L D
Sbjct: 167 ------LARGVAALSPSGVLGDPAGASAAEGARLLDAYVDDAVERLLD 208


>gi|168184781|ref|ZP_02619445.1| creatininase [Clostridium botulinum Bf]
 gi|229587299|ref|YP_002860337.1| creatininase [Clostridium botulinum Ba4 str. 657]
 gi|182672183|gb|EDT84144.1| creatininase [Clostridium botulinum Bf]
 gi|229260238|gb|ACQ51275.1| creatininase [Clostridium botulinum Ba4 str. 657]
          Length = 248

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 57/254 (22%), Positives = 96/254 (37%), Gaps = 28/254 (11%)

Query: 9   DNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           D + P+  +   +  +VLP+G  EQHGPHLP++ D  I   + +++             P
Sbjct: 10  DQTSPVVMELLNNNSLVLPVGTIEQHGPHLPLSVDIDITVDICKKLCCR----KNWVMGP 65

Query: 69  VEPIG-----YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
                      S       GT ++     I++++ II +  +MG++ + I+N H  N   
Sbjct: 66  QIMYAARSLPQSGGGSDFPGTISINGKVLIDYFVDIISSFCQMGLKNLYIINGHYENEAF 125

Query: 124 VSIVSTEARMRF---SMLVVSTSWSRFTIPQGIISF----PETEIGIHGGEIETSMMLAL 176
           +       R R     M +V+ SW      + I              H G +ETS+ML L
Sbjct: 126 IFEAIEICRQRNLLKGMSIVALSWWSAIDDEFIKKKFNNNFVGWHAEHAGFVETSLMLYL 185

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
            P  V+                    +   G + +    KD N  G + ++  AT K GE
Sbjct: 186 RPEKVR------------FINEECSNIPMAGIYYYSDEKKDENANGTLSSSKGATSKAGE 233

Query: 237 GLLSYFANCFIQLL 250
               +       +L
Sbjct: 234 EFFDHICKRLEMIL 247


>gi|116075648|ref|ZP_01472907.1| Creatininase [Synechococcus sp. RS9916]
 gi|116066963|gb|EAU72718.1| Creatininase [Synechococcus sp. RS9916]
          Length = 262

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/266 (19%), Positives = 86/266 (32%), Gaps = 29/266 (10%)

Query: 3   PLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR 61
             I     S P      +    V++PLG+ EQHGP   + TD + A  +A      L  R
Sbjct: 13  DAIRLALRSWPEVDTYLEQCKGVIIPLGSTEQHGPTGAIGTDALTAEAVALE----LGRR 68

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
             V   P +  G +  H+   GT +L  +  +     ++ ++   G  +I ++N HGGN 
Sbjct: 69  SGVLVTPAQAFGMAEHHLGFAGTMSLQPSTLMAVLHDLVLSLATHGFERIFVVNGHGGNI 128

Query: 122 PLV---------SIVSTEARMRFSMLVVSTSWSRFT-IPQGIISFPETEIGIHGGEIETS 171
                       +  S +  +   +     +W     + Q          G H    E +
Sbjct: 129 ATAKAAFAQAYGTATSRDLPVAPRLRCRMANWFMAGPVMQRARELYGNREGQHATPSEIA 188

Query: 172 MMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDA 230
           + L L   L++                        GS       +   P G +G +   A
Sbjct: 189 LTLHLHDSLMEKQR-------------PLPEAAPCGSIHGPADFRRRYPDGRMGSDPYLA 235

Query: 231 TVKKGEGLLSYFANCFIQLLNDINSF 256
               G   L+  A      L    + 
Sbjct: 236 KPDHGAEFLTTAATALRDDLETFLAA 261


>gi|315229781|ref|YP_004070217.1| creatinine amidohydrolase [Thermococcus barophilus MP]
 gi|315182809|gb|ADT82994.1| creatinine amidohydrolase [Thermococcus barophilus MP]
          Length = 364

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 57/261 (21%), Positives = 109/261 (41%), Gaps = 20/261 (7%)

Query: 15  CADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM--PVEPI 72
             + R+  +V++P+G+ E HG HLP  TDT+    ++E ++  +  +     +  P+   
Sbjct: 62  FEEVRQCDVVLIPIGSTEFHGNHLPSGTDTLYVTQISEAVRRYMKKKGKPVAITWPINYG 121

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
            +   H  + GT  +      ++ + ++  +  +G RK +++N HG    ++     E  
Sbjct: 122 SHPWHHYGMPGTVIIEEDHLKDYIIDVMLGLWNLGYRKQILINNHGHFW-VLESAIQEFM 180

Query: 133 MRF--SMLVVSTSWSRFTIP----QGIISFPETEIGIHGGEIETSMMLALAP-HLVKMDL 185
            ++    + ++  W R        +      ET+  +H  E ETS+ L L P  +V MD 
Sbjct: 181 KKYQLPGIYIALDWHRAAGKFFRTKERGGEFETDF-VHADEAETSIALLLFPREMVDMDK 239

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKD--------LNPKGVVGNAMDATVKKGEG 237
           A + + R      +F            WS  +          P+GVVG A  A  KK + 
Sbjct: 240 AVDTTPRAYLPDGHFDKAVDGLLRPMRWSSAEGHIPIEIVNTPEGVVGKATLADAKKAKR 299

Query: 238 LLSYFANCFIQLLNDI-NSFD 257
            +++       L++ I   F 
Sbjct: 300 AIAFILKYLELLIDQILEKFP 320


>gi|283779450|ref|YP_003370205.1| Creatininase [Pirellula staleyi DSM 6068]
 gi|283437903|gb|ADB16345.1| Creatininase [Pirellula staleyi DSM 6068]
          Length = 263

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 56/244 (22%), Positives = 84/244 (34%), Gaps = 10/244 (4%)

Query: 22  WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAER-IKSILPPRLPVTCMPVEPIGYSIEHMY 80
            + VLPLGA E H  HLP  TD      + E  +         V  +P  P G       
Sbjct: 20  DVAVLPLGATEPHNLHLPYGTDLFEGTIVGEHIVAEAHRRGGRVVLLPTIPFGTETNMQE 79

Query: 81  VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140
                 +  +        +I +  K GI KIV+LN+HGGN   +  +  E   +    + 
Sbjct: 80  FPLAINVNPSTLFAFITDVIHSCIKSGIHKIVLLNSHGGNE--MKPLLRELADKVDASLF 137

Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
             +W R         F   E   H GE+ETS  LA  P  V  +     ++       + 
Sbjct: 138 LCNWYRVIADVESQIFEHRED--HAGEMETSFGLAYFPQFVARNANGTLAADNGSTAPSQ 195

Query: 201 KYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSI 260
                 G  S       L      G    A+  K + ++          L     +D+SI
Sbjct: 196 FEAINKGWVSITRPWHLLTTNSGSGYPHAASADKAKRMMDVLVERLGGFL-----YDLSI 250

Query: 261 FDKD 264
             ++
Sbjct: 251 APRE 254


>gi|33864829|ref|NP_896388.1| hypothetical protein SYNW0293 [Synechococcus sp. WH 8102]
 gi|33632352|emb|CAE06808.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 317

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 47/246 (19%), Positives = 84/246 (34%), Gaps = 29/246 (11%)

Query: 2   NPLIIFTDNSLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
              I     S P   D  K    V++PLG+ EQHGP   + TD + A  +A  +      
Sbjct: 67  TEAIRLALRSWPEVDDYLKTCKGVIVPLGSTEQHGPTGAIGTDALTAEAVALEVGRRTG- 125

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
              V   P +  G +  H+   GT +L  A  +     ++ ++ + G  ++ ++N HGGN
Sbjct: 126 ---VLVTPAQAFGMAEHHLGFAGTMSLQPATLLAVMHDLVLSLARHGFERVFVINGHGGN 182

Query: 121 SPLVS---------IVSTEARMRFSMLVVSTSWSRFT-IPQGIISFPETEIGIHGGEIET 170
                           S +  +   +     +W     + +        + G H    E 
Sbjct: 183 IATTKAAFAQAHGTAASRDLPVAPQLRCRLANWFMAGPVMRQARDLYGNKEGHHATPSEI 242

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMD 229
           ++ L + P L          +               G        +  +P G +G +   
Sbjct: 243 AVTLQVEPSLQTKQRPLPDPA-------------PAGPIHSPEDFRRRHPDGRMGSHPSL 289

Query: 230 ATVKKG 235
           AT + G
Sbjct: 290 ATAEHG 295


>gi|325261148|ref|ZP_08127886.1| putative creatinine amidohydrolase [Clostridium sp. D5]
 gi|324032602|gb|EGB93879.1| putative creatinine amidohydrolase [Clostridium sp. D5]
          Length = 246

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 53/251 (21%), Positives = 94/251 (37%), Gaps = 19/251 (7%)

Query: 11  SLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +      + R+   V++ LG+ E+HG HLP+ TDTI+A   A+ I         +   P 
Sbjct: 8   NWTAASKNIRESEGVLITLGSVEEHGLHLPLGTDTILAQAFAQEICER----ENMYYYPC 63

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
              G        + T ++  A    + L  ++++ +   R+I++ + H GN  ++  V  
Sbjct: 64  ITYGQVWSARDFESTISINPACLENYCLQAVESVMRARPRRIILFSFHNGNHKVIDDVLR 123

Query: 130 EARMRFSMLVVSTSWSRFTIPQG---IISFPETEIGIHGGEIETSMMLALAPHLVKMDLA 186
               R     V    +     +    + +        H GE+ETS+ML +   LV M  A
Sbjct: 124 TLTDRGDGENVFHIKAAGIEKKAGHILTTPLWNGSIWHAGELETSLMLYVNEELVDMKAA 183

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCF 246
                              +G     W  ++    G  G+A  AT +KG  L        
Sbjct: 184 TAEFPPVP---------LLYGKKPIPW--REFLESGAFGDASAATAEKGRELFELICREL 232

Query: 247 IQLLNDINSFD 257
              ++ +   D
Sbjct: 233 QAQIHCVKEGD 243


>gi|120402309|ref|YP_952138.1| creatininase [Mycobacterium vanbaalenii PYR-1]
 gi|119955127|gb|ABM12132.1| Creatininase [Mycobacterium vanbaalenii PYR-1]
          Length = 247

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 52/246 (21%), Positives = 94/246 (38%), Gaps = 27/246 (10%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL--PPR 61
                +++        +   +V+P+G+ EQHGPHLP++TDT IA+ +A+ + + L     
Sbjct: 12  PRELGNSTSRQLQH--ESPTLVVPVGSTEQHGPHLPLDTDTRIASAVADALVTRLRAGGG 69

Query: 62  LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS 121
                 P    G S EH    GT ++      E       +  +    ++V +N HGGN 
Sbjct: 70  PDWLIAPAIGYGASGEHEGFAGTVSIGTPVLAELLTEFARSACRW-APRVVFVNGHGGNV 128

Query: 122 PLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLV 181
             +    T  R      V     S             +    H G  ETS++L ++P  V
Sbjct: 129 EALRRAVTLLRHEGRDAVWCPCTS-------------SNADAHAGHTETSVLLHISPAAV 175

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + D  E     ++        +   G  +       ++  G++G+   AT  +G  + + 
Sbjct: 176 RQD--ERVPGNRAPLSELMPEMLRGGVAA-------VSSLGILGDPTTATADEGRRIFAE 226

Query: 242 FANCFI 247
             +   
Sbjct: 227 MVDACA 232


>gi|296116067|ref|ZP_06834687.1| creatininase (creatinine amidohydrolase) protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977421|gb|EFG84179.1| creatininase (creatinine amidohydrolase) protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 272

 Score =  145 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 64/262 (24%), Positives = 108/262 (41%), Gaps = 15/262 (5%)

Query: 7   FTDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LPV 64
            ++ +      A  D  +++LPLG++E  GPH PM  D + A  +A R+      R +  
Sbjct: 10  LSELTAQEARTALADNPVIILPLGSHEDQGPHAPMG-DYLCADAIARRVALATRARGIGT 68

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              PV P G +     V G   L  A        I+  +R+ G+ +I+I N HGGN+  V
Sbjct: 69  YVAPVLPYGGADYFGSVIGGIALGQATLRAVLTDIMSCLRRNGLTRIIIFNGHGGNAQAV 128

Query: 125 SIVSTEARMRFSMLVVSTSWS-----RFTIPQGIISFPETEIGIHGGEIETSMMLALAPH 179
             V+   R    +++ S               G     E   G HGG   +S+ +AL P 
Sbjct: 129 HDVTLSMRHTHGVVIPSVYLWSIAAGMLPEVMGNRDVAERSAG-HGGNPLSSVAMALFPD 187

Query: 180 LVKMDLAENFSSRQSEFLR----NFKYLRAHG-SHSFGWSMKDLNPKGVV-GNAMDATVK 233
           LV+ DL    ++   +F+      F   R  G S  F   + ++  +GV+  +    +  
Sbjct: 188 LVRPDLLPAPATHPQQFMGLPVNGFATARFEGSSIHFPLEIDEIATQGVMQADPRLCSPT 247

Query: 234 KGEGLLSYFANCFIQLLNDINS 255
            G  L+       + L++ +  
Sbjct: 248 AGRELVERLTTLGVNLVSHLMK 269


>gi|240167696|ref|ZP_04746355.1| hypothetical protein MkanA1_00170 [Mycobacterium kansasii ATCC
           12478]
          Length = 236

 Score =  145 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 57/251 (22%), Positives = 95/251 (37%), Gaps = 26/251 (10%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           M       +++            +V+PLG+ EQHGPHLP++TDT IA  +A  + + +P 
Sbjct: 1   MPVRGELGNSTSSQLPSI--SPSIVVPLGSTEQHGPHLPLDTDTRIATAVARAVAAGMP- 57

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
           R      P    G S EH    GT ++         +    +       ++V +N HGGN
Sbjct: 58  RPDWLVAPAIAYGASGEHQSFAGTISIGIDALAMLLVEYGRSATCW-AGRLVFVNGHGGN 116

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
              +     + R           W   +   G           H G  ETS++L ++P  
Sbjct: 117 IAALRRAVGQLRFEGRDAA----WCPCSAVGG---------DAHAGHTETSVLLHISPDD 163

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           V  D     +      L     +R  G       +  ++P GV+G+   AT   G  + +
Sbjct: 164 VLTDRWLAGNGAPLPEL--LPSMRRGG-------IAAVSPTGVLGDPTTATAAAGRRIFA 214

Query: 241 YFANCFIQLLN 251
              +   Q ++
Sbjct: 215 EMVDECRQRID 225


>gi|118465285|ref|YP_883611.1| creatininase subfamily protein [Mycobacterium avium 104]
 gi|254776912|ref|ZP_05218428.1| creatininase subfamily protein [Mycobacterium avium subsp. avium
           ATCC 25291]
 gi|118166572|gb|ABK67469.1| creatininase subfamily protein [Mycobacterium avium 104]
          Length = 243

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 55/227 (24%), Positives = 92/227 (40%), Gaps = 25/227 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++PLG+ EQHGPHLP++TDT IA+ +A R    L         P    G S EH    G
Sbjct: 30  LLVPLGSTEQHGPHLPLDTDTRIASAVAGRAAPRLGDG--WLVAPAIAYGASGEHQSFAG 87

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T ++         +    +      +++V +N HGGN   +       R           
Sbjct: 88  TVSIGTEALTLLLIEYGRSAAGW-AQRVVFVNGHGGNVAALGRAVGTLRAEGRD------ 140

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
                   G           H G  ETS++L ++P  V+    +  +  ++        +
Sbjct: 141 -------AGWCPCVAAGGDAHAGHTETSVLLHISPAEVRTGQWQAGN--RAPLPELLGSM 191

Query: 204 RAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           R  G  +       ++P GV+G+   AT  +GE +LS   N  ++ +
Sbjct: 192 RRGGVAA-------VSPVGVLGDPTTATAAEGERILSEMVNECVRRV 231


>gi|226950860|ref|YP_002805951.1| creatininase family protein [Clostridium botulinum A2 str. Kyoto]
 gi|226842178|gb|ACO84844.1| creatininase family protein [Clostridium botulinum A2 str. Kyoto]
          Length = 279

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 55/255 (21%), Positives = 106/255 (41%), Gaps = 20/255 (7%)

Query: 8   TDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
              +     +  KD  ++ + L   E+HGPHLP+ TD I A  L + +   L  +     
Sbjct: 7   ERITWKEIDNLDKDKSVIFVALSPIEEHGPHLPLGTDYISAKDLLKAVIDNLEKQNNAYN 66

Query: 67  M---PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH--GGNS 121
               P  PIGY+   M   GT +          + + ++I + G +K+VI+N H   G+ 
Sbjct: 67  YIIHPSFPIGYNECVMNYPGTISFKSKTIENIIVDLGESISRAGFKKMVIVNHHLDLGHI 126

Query: 122 PLVSIVSTEARMRFSMLV------VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
             +           S+ V      +  S S+    +   +  + E  IH    ETS ML 
Sbjct: 127 KAIENAKDILNKECSLKVLEVASSIIYSQSKKENAKIARNDLDMEREIHADVRETSFMLF 186

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
             P LVK    + +S+ +  ++   +++++ G     + +++    G +G+    + +KG
Sbjct: 187 KHPELVK----DCYSTLEPIYMDMKEFIKSDGRCWREYGIEE----GYIGSPAKGSKEKG 238

Query: 236 EGLLSYFANCFIQLL 250
           +          ++L+
Sbjct: 239 KVKFEDMVKNTVELI 253


>gi|326445231|ref|ZP_08219965.1| creatininase [Streptomyces clavuligerus ATCC 27064]
          Length = 243

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 100/242 (41%), Gaps = 21/242 (8%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75
              R   I VLP+G++EQH  HLP+ TDT++AA +A  +         +  +P   I  S
Sbjct: 4   EAERNASIAVLPVGSFEQHAAHLPLTTDTLVAAAIAREVADAYG----LFLLPPVTISCS 59

Query: 76  IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNS---PLVSIVSTEAR 132
            EH    GT +++          I  ++   GIR++V++N HGGN     +V   +    
Sbjct: 60  HEHAAWPGTVSISATTLTAVVGDIARSLEGSGIRRLVLVNGHGGNYVLSNIVQEANAHPG 119

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEI-GIHGGEIETSMMLALAPHLVKMDLAENFSS 191
                + +      +   +       T    +H GEIETS++L L P  V+         
Sbjct: 120 PGGPRMALFPRPEDWNTAREAAGLTTTAHEDMHAGEIETSLLLHLHPTQVR------DGY 173

Query: 192 RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
           R ++ L +  +L  HG              GVVG    AT  KG+ +L      F   L 
Sbjct: 174 RDADHLADRPHLLVHGLRP-------YTLTGVVGCPSLATATKGKTILHTLTTAFQDTLA 226

Query: 252 DI 253
            +
Sbjct: 227 AL 228


>gi|91787495|ref|YP_548447.1| creatininase [Polaromonas sp. JS666]
 gi|91696720|gb|ABE43549.1| Creatininase [Polaromonas sp. JS666]
          Length = 259

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 47/266 (17%), Positives = 85/266 (31%), Gaps = 39/266 (14%)

Query: 1   MNPLIIFTDNSLPLCADARKD--WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           +   +   + +     D  +     +++P+G  EQ GPH+ +    +    LA RI   L
Sbjct: 13  VPSSVYLDELTWTEVRDTLRAGATTIIIPVGGTEQSGPHMALGKHNVRVQALAGRIADKL 72

Query: 59  PPRLPVTCMPVEPIG---YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILN 115
              L    +   P G       HM   GT ++     +        ++++ G   IV + 
Sbjct: 73  GNTLVAPVVSYVPEGRVSPPSGHMRFAGTISVPDDAFVAVLSGAARSLKQHGFLHIVFIG 132

Query: 116 AHGGNSPLVSIVSTE---------ARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGG 166
            HGG   L+  V+            R  +       +   F         P  +IG H G
Sbjct: 133 DHGGYQNLLKEVAQRLNREWTTSKTRAHYISAYYRAADEDFAQALRARGLPSNQIGTHAG 192

Query: 167 EIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGN 226
             +TS+MLA+ P  V+       +                               GV G+
Sbjct: 193 LADTSLMLAIDPGRVRTGQLNGSAMTGPS-------------------------SGVSGD 227

Query: 227 AMDATVKKGEGLLSYFANCFIQLLND 252
              ++   G        +  +Q + +
Sbjct: 228 PAGSSALLGRIGTDMIVDKSVQSIRE 253


>gi|188587170|ref|YP_001918715.1| Creatininase [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179351857|gb|ACB86127.1| Creatininase [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 286

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 67/280 (23%), Positives = 110/280 (39%), Gaps = 37/280 (13%)

Query: 7   FTDNSLPLCAD-ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP--RLP 63
            +  +     D      +++LP+G+ EQHGPHLP++ D  IA  LA++I         + 
Sbjct: 4   LSRLTWQEIQDKLPDLDVLLLPVGSIEQHGPHLPIDNDIYIARALAKKIAEEAKQSMNIS 63

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           +      P+GYS  HM   GT +            II +    GI  I+++N HGGN  +
Sbjct: 64  IGIGASMPVGYSQHHMEFPGTVSFRKETYKMVLKDIIHSYYHHGITDILLINGHGGNGEI 123

Query: 124 VSIVSTEARM----------------------------RFSMLVVSTSWSRFTIPQGIIS 155
           +    TE +                             + ++L +   W    I +    
Sbjct: 124 IKETLTEIKENSNGPNNSPNNVSNKVPNKLPNNVPSNEKTNLLDIFNYW--NAIKEQGGH 181

Query: 156 FPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSM 215
             ET+   H  E ETS   AL    V  D   +  S+  E  +   +    G+     S+
Sbjct: 182 LLETQFFCHACEGETSFAEALD-QRVLRDELIDALSQNPELSKYNLFSEPCGNLP---SI 237

Query: 216 KDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINS 255
           + ++  GV+GN   A+ + GE LL       ++ L  + S
Sbjct: 238 EQVSASGVIGNNKPASRETGEKLLQIVIAKALKKLEVVQS 277


>gi|225420011|ref|ZP_03762314.1| hypothetical protein CLOSTASPAR_06354 [Clostridium asparagiforme
           DSM 15981]
 gi|225041362|gb|EEG51608.1| hypothetical protein CLOSTASPAR_06354 [Clostridium asparagiforme
           DSM 15981]
          Length = 371

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 59/269 (21%), Positives = 101/269 (37%), Gaps = 20/269 (7%)

Query: 10  NSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAE---RIKSILPPRLPVTC 66
           N   +    RK+ IV +P+G  E HG H     DT +   + E   R  +       +  
Sbjct: 63  NRSRVIERRRKNDIVFVPIGCTENHGKHANTGLDTFMVTQILEGLRRYTAKQGRECSIAF 122

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126
            P+   G+   H+ + GT  + +    E  + ++  +   G RKI+++N H G+  ++  
Sbjct: 123 TPLNYGGHPYHHIAMPGTVNMPHEVVQETIIYMMLGLWNDGFRKIILVNNH-GHLWMLEA 181

Query: 127 VSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG-----IHGGEIETSMMLALAPHLV 181
              E   RF +  +          +      +         IH  EIETSM + L P ++
Sbjct: 182 AIQEFCKRFQLPGIFRVIDWHRAIREFFIPVDRGDSFETTFIHADEIETSMGMLLFPEMM 241

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWS--------MKDLNPKGVVGNAMDATVK 233
            M+ AE    +      +F            WS             P+GVVGN   AT +
Sbjct: 242 DMEQAEEAWPKGYLPDGHFDVSVDAYRRPCRWSEGQGHQAIEIAGTPEGVVGNPKLATAR 301

Query: 234 KGEGLLSYFANCFIQLLND--INSFDVSI 260
           K +   +        L++D  + +F    
Sbjct: 302 KAKRPTAAILKYLT-LVHDEILEAFPAGT 329


>gi|119720708|ref|YP_921203.1| creatininase [Thermofilum pendens Hrk 5]
 gi|119525828|gb|ABL79200.1| Creatininase [Thermofilum pendens Hrk 5]
          Length = 249

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 46/179 (25%), Positives = 78/179 (43%), Gaps = 7/179 (3%)

Query: 7   FTDNSLPLCADARKDWIV---VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
             + S     +  +   +   VLP+G  E HG HLP+ TDT+I + L E +   +     
Sbjct: 6   LEELSYVELKEEVEKRKIDSFVLPVGTVEPHGTHLPLGTDTLIPSALGEYVAEKV----N 61

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
              +P    G +       G+  +           I++++   G R  +ILN HGGN+  
Sbjct: 62  AVLLPPVHYGVTTGLHGYFGSVRVQPETLEALVYEILESMSLHGFRYGLILNGHGGNTQA 121

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
           +   + +A +R  + V+   W      +G+      + G H    ET+M+LA+ P LVK
Sbjct: 122 LDNAAKKAWLRNKLAVMVVDWWILAREKGVTREVLGKEGGHAATDETAMVLAIRPELVK 180


>gi|41410253|ref|NP_963089.1| hypothetical protein MAP4155 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41399087|gb|AAS06705.1| hypothetical protein MAP_4155 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 243

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 55/227 (24%), Positives = 92/227 (40%), Gaps = 25/227 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++PLG+ EQHGPHLP++TDT IA+ +A R    L         P    G S EH    G
Sbjct: 30  LLVPLGSTEQHGPHLPLDTDTRIASAVAGRAVPRLGDD--WLVAPAIAYGASGEHQSFAG 87

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T ++         +    +      +++V +N HGGN   +       R           
Sbjct: 88  TVSIGTEALTLLLIEYGRSAAGW-AQRVVFVNGHGGNVAALGRAVGTLRAEGRD------ 140

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
                   G           H G  ETS++L ++P  V+    +  +  ++        +
Sbjct: 141 -------AGWCPCVAAGGDAHAGHTETSVLLHISPAEVRTGAWQAGN--RAPLPELLGSM 191

Query: 204 RAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           R  G  +       ++P GV+G+   AT  +GE +LS   N  ++ +
Sbjct: 192 RRGGVAA-------VSPVGVLGDPTTATAAEGERILSEMVNECVRRV 231


>gi|23010663|ref|ZP_00051275.1| COG1402: Uncharacterized protein, putative amidase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 232

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 82/233 (35%), Gaps = 15/233 (6%)

Query: 29  GAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLT 88
           GA E HGPH+P +TDT     +A     +L  R+     P    G S    +  GT +L+
Sbjct: 1   GATEAHGPHMPTDTDTHQVEHIAW----LLAQRIDALVAPPVAYGISKTFEFFPGTISLS 56

Query: 89  YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST----EARMRFSMLVVSTSW 144
                     I  A+ + G   ++ILN +  N      V+     E     +  V + S+
Sbjct: 57  IPTYQAMLFEIGAALVRQGFEHLIILNGNRPNGTANDAVARHLVDELDAAHTFKVSAVSY 116

Query: 145 SRFTIPQGIISFPETEIG-IHGGEIETSMMLALAPHLVKMDLA--ENFSSRQSEFLRNFK 201
                 +          G  HG E ET   LA  P LVKM+     ++     + +   +
Sbjct: 117 WEPAAEKIHALRRSVPGGMGHGCEFETGFQLATRPELVKMERLAGAHYGPVGWDLVAPTE 176

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
            +R +                + G+   AT + G+  +        Q    + 
Sbjct: 177 PVRTYMRRPRP----AAGHAAIFGDPSSATAEAGQVFIDTVVEVLEQTFRTLR 225


>gi|254514920|ref|ZP_05126981.1| creatininase [gamma proteobacterium NOR5-3]
 gi|219677163|gb|EED33528.1| creatininase [gamma proteobacterium NOR5-3]
          Length = 249

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 48/259 (18%), Positives = 85/259 (32%), Gaps = 29/259 (11%)

Query: 11  SLPLCADARKDWI-VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPV 69
           +        +    ++LP+G+ EQHGP   + TD I    +AE   +       +   P 
Sbjct: 7   TWCDVEAYLERSRSILLPIGSMEQHGPTGLIGTDAICPQVIAEAAAADD---PDILVGPT 63

Query: 70  EPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVST 129
             +G +  H+   G+ TL  +  I        ++R+ G  +I  +N HGGN   ++    
Sbjct: 64  FSVGCAQHHLGFAGSMTLRPSTMIAVIADWCASLRRHGFERIYWINGHGGNIATIAAAFA 123

Query: 130 EARMR------FSMLVVS-----TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAP 178
           E           S L          W    +            G H    E ++  A  P
Sbjct: 124 EVYAERSLSGPHSDLAPLSMRQRNWWELPEVMSTCQRLHPKHEGSHATASEIAVTYAAYP 183

Query: 179 HLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEG 237
             V+  + E               +   G  +     ++    G +G +   ATV  GE 
Sbjct: 184 EQVRDLVLE-------------PKVAPSGGFTDAEDYRERFADGRIGSDPTQATVAAGEE 230

Query: 238 LLSYFANCFIQLLNDINSF 256
           +++  A    +        
Sbjct: 231 IIAVAAEALRKDFLAFARA 249


>gi|284046552|ref|YP_003396892.1| creatininase [Conexibacter woesei DSM 14684]
 gi|283950773|gb|ADB53517.1| Creatininase [Conexibacter woesei DSM 14684]
          Length = 245

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 57/254 (22%), Positives = 93/254 (36%), Gaps = 12/254 (4%)

Query: 4   LIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
            + + D +         + +VVLP+GA EQHGPHL    DT+ A  +A    +       
Sbjct: 3   AVRWADRTREELRSLLPEAVVVLPIGATEQHGPHLVTAMDTLAAEAVAAAGAARATRPER 62

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
           V   P  P G S  H+   GT +LT A        ++++    G R++++LN HGGNS  
Sbjct: 63  VVLAPTLPFGASHHHLPFGGTLSLTAATLAHVLADLLESAAASGARRLLLLNGHGGNSAT 122

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
            +  + +A     ++V +  +       G           H G  ETS+M AL P  V+ 
Sbjct: 123 CAQAAADAARLHGIVVAAADYWALAPVDGAWGEH---FPGHAGAFETSLMGALRPDGVRE 179

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFA 243
                        +     LR      +          G   +   A    G       A
Sbjct: 180 QALRPSPGTLPAAVD---GLRLETPRLWAQI------DGFTDDPRRADAAAGAAAFDRLA 230

Query: 244 NCFIQLLNDINSFD 257
           +   + ++ +    
Sbjct: 231 DAVARAIDAVAEAP 244


>gi|168181938|ref|ZP_02616602.1| putative creatinine amidohydrolase [Clostridium botulinum Bf]
 gi|237796869|ref|YP_002864421.1| putative creatinine amidohydrolase [Clostridium botulinum Ba4 str.
           657]
 gi|182674892|gb|EDT86853.1| putative creatinine amidohydrolase [Clostridium botulinum Bf]
 gi|229263726|gb|ACQ54759.1| putative creatinine amidohydrolase [Clostridium botulinum Ba4 str.
           657]
          Length = 279

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 55/255 (21%), Positives = 105/255 (41%), Gaps = 20/255 (7%)

Query: 8   TDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR---LP 63
              +     +  KD  ++++ L   E+HGPHLP+ TD I A  L +     L  +     
Sbjct: 7   EKITWKEILNLDKDKSVILVALSPIEEHGPHLPLGTDYIAAKDLLKATIDSLEKQNNLYN 66

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH--GGNS 121
               P  PIGY+   M   GT +          + + ++I + G +K+VI+N H   G+ 
Sbjct: 67  YIIYPSLPIGYNESIMNYPGTVSFKSETIENIIIDLGESISRAGFKKMVIVNHHLDLGHI 126

Query: 122 PLVSIVSTEARMRFSMLV------VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
             +           S+ +      +  S S     + + S  + E  IH    ETS ML 
Sbjct: 127 KAIENAKDILNKGCSLKILEVASSIIYSQSEKENAKIVNSDLDMESEIHADVRETSFMLF 186

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
             P LVK    + +++  S ++   +++++       + +++    G +G+    + +KG
Sbjct: 187 KHPELVK----DCYNTLDSIYMDMKEFIKSSERCWRRYGIEE----GYIGSPAKGSKEKG 238

Query: 236 EGLLSYFANCFIQLL 250
           E          ++L+
Sbjct: 239 EVQFEDMIKNTVELI 253


>gi|300712869|ref|YP_003738681.1| Creatininase [Halalkalicoccus jeotgali B3]
 gi|299126553|gb|ADJ16890.1| Creatininase [Halalkalicoccus jeotgali B3]
          Length = 252

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/247 (20%), Positives = 89/247 (36%), Gaps = 20/247 (8%)

Query: 11  SLPLCADARKDWI--VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP 68
           +      A    +  +++P G+ EQHGPHL +  D   A  +   +   L   L     P
Sbjct: 12  TWMEIESAIDRGVKTILVPAGSVEQHGPHLGILKDAAWAEAMGVELAKELGDTL---VAP 68

Query: 69  VEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVS 128
           V   G S  HM   GT +      +        ++   G   IV+ + HGGN P ++ + 
Sbjct: 69  VIRPGCSDHHMGFSGTISYRPETLMRVLEDYCRSLDSHGFEHIVLFSLHGGNFPAMNAIL 128

Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG----IHGGEIETSMMLALAPHLVKMD 184
                     +++       I   + S  + EI      HGG   T+ +  L P LV  +
Sbjct: 129 PSIADEVDAQIITLLDKELLIDPLMESLAQMEIPSEARGHGGAAVTASVWYLRPDLVLEE 188

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
               F+      +   K +              +   G +G+   AT + GE + +   +
Sbjct: 189 ---EFTPGFIGDVSTSKLMTNGL--------DAVTELGHMGDPTYATRELGEEVTTRLVS 237

Query: 245 CFIQLLN 251
            F + + 
Sbjct: 238 AFSERIR 244


>gi|226228198|ref|YP_002762304.1| creatinine amidohydrolase [Gemmatimonas aurantiaca T-27]
 gi|226091389|dbj|BAH39834.1| creatinine amidohydrolase [Gemmatimonas aurantiaca T-27]
          Length = 263

 Score =  143 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/252 (22%), Positives = 94/252 (37%), Gaps = 12/252 (4%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIA-AGLAERIKSILPPRLPVT 65
             + + P   D     + +LP GA E H  HLP  TDT++     A      +     V 
Sbjct: 15  LAEQTWPALRDGHW-PVALLPFGATEPHNTHLPYGTDTLLGAEVAARVAAHAIAHGTGVL 73

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
            +P  P G +   + +  T  +     +     I+ ++   G+R +V+LNAHGGN   + 
Sbjct: 74  ALPPIPFGVNTTQLDLRFTINVMPTTQLILLRDIVKSLEPHGVRALVLLNAHGGNE--LR 131

Query: 126 IVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
            V  E +   SM++   +W +             E G H GE+ET+ ++ +AP LV  D 
Sbjct: 132 AVVRELQPETSMMLAIVNWWQTADVSVF-----REPGDHAGELETAAVMHVAPGLVVEDR 186

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
           ++      +            G          L+    VG+   AT   G   ++     
Sbjct: 187 SQWGDGAVNPSALE---AVRKGWAWMPRRWTQLSADTGVGDPRSATETAGAQFMAQAVER 243

Query: 246 FIQLLNDINSFD 257
                  +   D
Sbjct: 244 ISGFCAQLAVAD 255


>gi|292900677|ref|YP_003540046.1| amidohydrolase [Erwinia amylovora ATCC 49946]
 gi|291200525|emb|CBJ47654.1| putative amidohydrolase [Erwinia amylovora ATCC 49946]
 gi|312170999|emb|CBX79258.1| creatininase [Erwinia amylovora ATCC BAA-2158]
          Length = 250

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 47/257 (18%), Positives = 90/257 (35%), Gaps = 28/257 (10%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
            F + S        +   ++  +G  EQHGPHLP+N DT+I    A      L       
Sbjct: 8   YFAEFSSESICSNVEGRTLIWAIGGIEQHGPHLPLNVDTLIPEAFA----KALALDCQGI 63

Query: 66  CMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            +PV+P+       S   +   GT  +  +  I++    + ++  +  R+IVI+N H  N
Sbjct: 64  MLPVQPLSVRSLPQSGGGLQFPGTLFVDGSTFIDYLADTLKSLCSLPFRQIVIINGHYEN 123

Query: 121 SPLVSIVSTEAR------MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMML 174
              +       R       R ++     S    +     +         H G  ETS+M+
Sbjct: 124 EGFIFEALDRVRSTGAFAERSALAFSWWSMVSSSWVVENLPGFPGWHAEHAGMTETSLMM 183

Query: 175 ALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKK 234
            L P LV  +  ++    +    +                    + +GV+     ++   
Sbjct: 184 YLKPELVSCERPDHEHPPRCGVYQLP-------------ITAQASTRGVLSKTSGSSALT 230

Query: 235 GEGLLSYFANCFIQLLN 251
           G+ +  +       ++ 
Sbjct: 231 GKLIFEHVRQEIKNMVE 247


>gi|195970706|gb|ACG60744.1| putative hydrolase [Streptomyces flavoviridis]
          Length = 276

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 55/203 (27%), Positives = 85/203 (41%), Gaps = 15/203 (7%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
             TD +    ADA +   VV P+GA EQHGPHLP++ D I+A   A  I   L       
Sbjct: 10  RLTDLTSEQVADAVRGRTVVWPIGAIEQHGPHLPLSVDLILAEAFATEIARELD----AF 65

Query: 66  CMPVEPIG-----YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            +P + IG      S   ++  GT  +     +      + A+  + + ++V++N H  N
Sbjct: 66  TLPAQAIGARSLPQSGGGLFFPGTVYVGGDTLVRFLRDTLSALTVLPMARLVVVNGHYEN 125

Query: 121 SPLVSIVSTEARMRF---SMLVVSTSWSRFTIPQGIISFPETEIGI---HGGEIETSMML 174
            P +     + R R     M V + SW          +      G    H G  ETS+ML
Sbjct: 126 EPFLFEALDQVRERGLLDGMEVFAFSWWSLVRDTWTDAETPRFPGWHAEHAGITETSLML 185

Query: 175 ALAPHLVKMDLAENFSSRQSEFL 197
            L P LV  +  ++ S  ++   
Sbjct: 186 HLRPDLVTDERPDHDSPPRAGVY 208


>gi|292486929|ref|YP_003529799.1| creatininase [Erwinia amylovora CFBP1430]
 gi|291552346|emb|CBA19391.1| creatininase [Erwinia amylovora CFBP1430]
          Length = 250

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 47/257 (18%), Positives = 90/257 (35%), Gaps = 28/257 (10%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
            F + S        +   ++  +G  EQHGPHLP+N DT+I    A      L       
Sbjct: 8   YFAEFSSESICSNVEGRTLIWAIGGIEQHGPHLPLNVDTLIPEAFA----KALALDCQGI 63

Query: 66  CMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            +PV+P+       S   +   GT  +  +  I++    + ++  +  R+IVI+N H  N
Sbjct: 64  MLPVQPLSVRFLPQSGGGLQFPGTLFVDGSTFIDYLADTLKSLCSLPFRQIVIINGHYEN 123

Query: 121 SPLVSIVSTEAR------MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMML 174
              +       R       R ++     S    +     +         H G  ETS+M+
Sbjct: 124 EGFIFEALDRVRSTGAFAERSALAFSWWSMVSSSWVVENLPGFPGWHAEHAGMTETSLMM 183

Query: 175 ALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKK 234
            L P LV  +  ++    +    +                    + +GV+     ++   
Sbjct: 184 YLKPELVSCERPDHEHPPRCGVYQLP-------------ITAQASTRGVLSKTSGSSALT 230

Query: 235 GEGLLSYFANCFIQLLN 251
           G+ +  +       ++ 
Sbjct: 231 GKLIFEHVRQEIKNMVE 247


>gi|116626877|ref|YP_829033.1| creatininase [Candidatus Solibacter usitatus Ellin6076]
 gi|116230039|gb|ABJ88748.1| Creatininase [Candidatus Solibacter usitatus Ellin6076]
          Length = 314

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 51/268 (19%), Positives = 96/268 (35%), Gaps = 27/268 (10%)

Query: 6   IFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
                S     D   +  +V++P+ + E+HGP  P+ TD +           ++  +  V
Sbjct: 35  YLPHMSWLEVQDLLTRTDMVIIPVASLEEHGPQTPIGTDFLNG----VEEAKLIAKKTDV 90

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P+   G S  HM   GT T+++  A   +   + ++   G R+I+ +NAH GN  L 
Sbjct: 91  LVAPILLPGISPYHMEFPGTITISHDTAQRVYFEAVQSLIHHGFRRILFVNAHTGNQYLT 150

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPET--EIGIHGGEIETSMMLALAPHLVK 182
           + V+         + +    +         +   T      H G  ETS  + L P LV 
Sbjct: 151 AYVADRINQETPAIALELHTAMQGGAGAGPTNRSTPLPFDRHAGVGETSSAMYLIPTLVD 210

Query: 183 MDLAENFSSRQSEFLRN-----------------FKYLRAHGSHSFGWSMKDLNPKGVVG 225
           +           + L                    + L+  G+     S +++   GV  
Sbjct: 211 LSKGGKNDLTLPDHLSRALPQVNMGDRVATQVFLAEALKPKGTGKHT-STREMAATGVWS 269

Query: 226 --NAMDATVKKGEGLLSYFANCFIQLLN 251
             +  +A+  +G    + F N  +  + 
Sbjct: 270 ERDTREASADRGRSATNSFVNSAVAFIE 297


>gi|170760294|ref|YP_001788743.1| putative creatinine amidohydrolase [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169407283|gb|ACA55694.1| putative creatinine amidohydrolase [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 279

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 57/255 (22%), Positives = 106/255 (41%), Gaps = 20/255 (7%)

Query: 8   TDNSLPLCADARKD-WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTC 66
              +     +  KD  ++ + L   E+HGPHLP+ TD I A  L + +   L  +     
Sbjct: 7   EKITWKEIDNLDKDKSVIFVALSPIEEHGPHLPLGTDYISAKDLLKAVIDNLEKQNNAYN 66

Query: 67  M---PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH--GGNS 121
               P  PIGY+   M   GT +          + + ++I + G +K+VI+N H   G+ 
Sbjct: 67  YIIHPSFPIGYNECVMNYPGTISFKSETVENIIVDLGESISRSGFKKMVIVNHHLDLGHI 126

Query: 122 PLVSIVSTEARMRFSMLV------VSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175
             +           S+ V      +  S S     + + +  + +  IH    ETS ML 
Sbjct: 127 KAIENAKDILNKECSLKVLEVASSIIYSRSEKENAKIVKNDLDMKREIHADVRETSFMLF 186

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKG 235
             P LVK    + +S+    +L   +++++ GS    + M++    G +G+    + +KG
Sbjct: 187 KHPELVK----DCYSTLDPIYLDMKEFIKSGGSCWKKYGMEE----GYIGSPAKGSKEKG 238

Query: 236 EGLLSYFANCFIQLL 250
           +          ++L+
Sbjct: 239 KIQFEGMIKNTVELI 253


>gi|126433638|ref|YP_001069329.1| creatininase [Mycobacterium sp. JLS]
 gi|126233438|gb|ABN96838.1| Creatininase [Mycobacterium sp. JLS]
          Length = 235

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 54/227 (23%), Positives = 86/227 (37%), Gaps = 25/227 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++P+G+ EQHGPHLP++TDT IA  +A  +   L P       P    G S EH    G
Sbjct: 22  LIVPVGSTEQHGPHLPLDTDTRIATAVAREVAGTLTPSWS--LAPAVGYGASGEHESFPG 79

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T ++  A      +    +       ++V LN HGGN+  ++  +   R     +     
Sbjct: 80  TISIGTAALRLLLVEFGRSATNW-ASRVVFLNGHGGNTEALAGATALLRYEDRDVA---- 134

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
           W                   H G  ETS++L ++P  V  D  E  ++           L
Sbjct: 135 WCPCIAKD---------SDAHAGHTETSVLLHISPDDVHTDHWERGNTAP---------L 176

Query: 204 RAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           R          +  ++  GV+G+   AT   G  L           +
Sbjct: 177 RDLMPALRQGGVAAVSEVGVLGDPTTATGADGARLFGEMVRHCADRI 223


>gi|162450266|ref|YP_001612633.1| hypothetical protein sce1994 [Sorangium cellulosum 'So ce 56']
 gi|161160848|emb|CAN92153.1| hypothetical protein sce1994 [Sorangium cellulosum 'So ce 56']
          Length = 264

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 55/256 (21%), Positives = 89/256 (34%), Gaps = 13/256 (5%)

Query: 1   MNPLIIFTDNSLPLCADARKD---WIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           M       + +    A         + ++P+G+ E HGPHLP+ TDT+I    AE+    
Sbjct: 1   MQAAPRLAELTTEELAALLSGGAPCVALVPVGSVEPHGPHLPLGTDTLIGEAAAEQAGRR 60

Query: 58  LPPR-LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNA 116
           L  R +     P    G +       G  ++          A+ +A    G+  +  +N 
Sbjct: 61  LWARGVAALLAPPIGYGVTDFAAGFAGAISIPAPALTAFLRAVAEAYLSAGLSHVCFINN 120

Query: 117 HGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLAL 176
           H    P        A     +   S +          +S        H G  ETS++LA 
Sbjct: 121 HLE--PEHDRAVRAATSDLPLGRASVACPLARRWARTLSAEFRSGACHAGRYETSLVLAA 178

Query: 177 APHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGE 236
           A  LV+ D+AE             K     G+ SF     D       G+  +A+  +G 
Sbjct: 179 ASALVRKDIAEALPDLGLSLSEGIKA----GAKSFRALGMD---AAYTGSPREASEDEGR 231

Query: 237 GLLSYFANCFIQLLND 252
            LL   A   +  + +
Sbjct: 232 ALLDLLATMIVTEVEE 247


>gi|146282360|ref|YP_001172513.1| chain F, crystal structure of creatinine amidohydrolase
           (creatininase) [Pseudomonas stutzeri A1501]
 gi|145570565|gb|ABP79671.1| chain F, crystal structure of creatinine amidohydrolase
           (Creatininase) [Pseudomonas stutzeri A1501]
          Length = 253

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 53/261 (20%), Positives = 91/261 (34%), Gaps = 29/261 (11%)

Query: 4   LIIFTDNSLPLC-ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
            +     S        R+  +V LP GA EQHGPHLP+ TD ++A+ ++  + + +    
Sbjct: 2   TVHMDQLSWVDYERRVREGAVVFLPCGATEQHGPHLPLGTDALLASAISADVAARVG--- 58

Query: 63  PVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
                P    GY          +  GT +L  A         +    + G+R++V++  H
Sbjct: 59  -GLVAPALSYGYKSQPKCGGGQHFCGTTSLDGATLSALVRDAVREFYRHGVRRLVLVLGH 117

Query: 118 GGNSPL----VSIVSTEARMRFSMLVV-STSWSRFTIPQGIISFPETEIGI---HGGEIE 169
             N       + +   +      + V+    W           FPE   G    H   IE
Sbjct: 118 YENQWFVAEGIQLALRDLGPDAGLEVMRLEHWDFCHEQTLTDIFPEGFPGFALEHAAVIE 177

Query: 170 TSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMD 229
           TS+ML   P LV ++   + +         +                   P GV+ +A  
Sbjct: 178 TSLMLHFHPQLVALEKIPDDAPADFPPYDMYPTRTEWVP-----------PSGVLSSARS 226

Query: 230 ATVKKGEGLLSYFANCFIQLL 250
           ++  KG+ L           +
Sbjct: 227 SSAAKGQRLAHDIVEGIAAAV 247


>gi|254514973|ref|ZP_05127034.1| creatininase [gamma proteobacterium NOR5-3]
 gi|219677216|gb|EED33581.1| creatininase [gamma proteobacterium NOR5-3]
          Length = 487

 Score =  141 bits (356), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 52/274 (18%), Positives = 107/274 (39%), Gaps = 26/274 (9%)

Query: 6   IFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
                + P   +   K  +V++P+ + EQH  HLP+ TD I           ++  +  +
Sbjct: 218 YLPHMTSPEVDELLGKTDLVIIPIASLEQHAAHLPIGTDFING----VERAKLIAQQRDL 273

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P+   G S  HM   G+ TL     ++  L  ++++ + G ++ +I+NAHGGN  + 
Sbjct: 274 LVAPILMAGQSPYHMGFAGSVTLKAQTIVDVHLQAVESLIQHGFKRFIIMNAHGGNRAIS 333

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
           + +  +     + + VS   +               +  HGG  ETS  L L P LV++D
Sbjct: 334 TYLVDQINQTTAGVAVSYGEAVRPFLAPSTVALSNVLDRHGGTGETSNSLYLMPDLVQLD 393

Query: 185 LA-ENFSSRQSEFLRNFKYLRAHGSHSFGW---------------SMKDLNPKGVVG--N 226
            A     +           + A    +                  S  +++  GV G  +
Sbjct: 394 KAIAADITLPDHLEAMLPDVIAGDPTALQLFLAEGLKAQETGKMTSSAEMSTTGVWGERH 453

Query: 227 AMDATVKKGEGLLSYFANCFIQLLN---DINSFD 257
             + ++ +G    +   +  ++ ++   ++ + D
Sbjct: 454 PAEGSLARGAAESARQIDAAVKFIDRWNELAAAD 487


>gi|160881359|ref|YP_001560327.1| creatininase [Clostridium phytofermentans ISDg]
 gi|160430025|gb|ABX43588.1| Creatininase [Clostridium phytofermentans ISDg]
          Length = 233

 Score =  141 bits (356), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 85/240 (35%), Gaps = 24/240 (10%)

Query: 5   IIFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           +  +D +     D    +  +++P+G  EQHGPHLP+N DT+ A   AE     L     
Sbjct: 1   MKLSDRTYKEVKDYLYTNKNLIIPVGTCEQHGPHLPLNNDTLCAEYFAEE----LSNATG 56

Query: 64  VTCMPVEPIGYS-IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122
               P    G +    +   GT T++          I+D  +K G     I+  HG    
Sbjct: 57  CLVAPTINYGVNLPCDISFTGTTTISKDTLKNIITEIVDWWKKQGFENFFIITFHGDPFH 116

Query: 123 LVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVK 182
            +  +   +   + +      ++     Q  +         H  E ETS+ L L P  V+
Sbjct: 117 -IDTLCNISENVYLIEAYEIDYTGILDKQSTMR--------HACEAETSVALWLYPEKVR 167

Query: 183 MDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYF 242
             L E       +F     +        +          G +G    A+ +KG+ L+   
Sbjct: 168 TMLMEESDIVFDDFREYLFHENCEKPDGYI---------GCLGYPKSASAEKGKILVEKM 218


>gi|226305295|ref|YP_002765253.1| hypothetical protein RER_18060 [Rhodococcus erythropolis PR4]
 gi|226184410|dbj|BAH32514.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
          Length = 208

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 57/224 (25%), Positives = 92/224 (41%), Gaps = 30/224 (13%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           ++P+G++EQHGPHLP++TDT IA  +A+ +         V   P    G S EH    GT
Sbjct: 1   MVPVGSFEQHGPHLPLDTDTRIARAVAQAL-------PDVVVAPAIEYGASGEHEGFAGT 53

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSW 144
            ++         +    +  +   ++++ +N HGGN P ++      R           W
Sbjct: 54  ISIGAEAMETLVVEYGRSAFRW-TKRVLFVNGHGGNGPALAKAVALLRYEGRDAA----W 108

Query: 145 SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLR 204
               +              H G  ETS++L L+P LV M LAE  +   S        +R
Sbjct: 109 VPCAVA---------GADAHAGHTETSLLLHLSPDLVHMSLAETGN--LSPIADLMPGMR 157

Query: 205 AHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQ 248
           + G       M  ++  GV+GN + AT + G  +          
Sbjct: 158 SGG-------MVAVSQNGVLGNPVGATAEDGAYIFGELVGRVTD 194


>gi|289524184|ref|ZP_06441038.1| putative creatinine amidohydrolase [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
 gi|289502840|gb|EFD24004.1| putative creatinine amidohydrolase [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
          Length = 369

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 51/267 (19%), Positives = 95/267 (35%), Gaps = 22/267 (8%)

Query: 15  CADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT--CMPVEPI 72
               RK+ IV +P+G  E HG H     DT +   + E I+     +       +P    
Sbjct: 66  IEKRRKNDIVFVPIGCTENHGLHANSGLDTFMVTQILEGIRRYTAKKGHEVNLALPPLNY 125

Query: 73  -GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
            G+   H+ + GT  +      E  + ++  +   G RKI+++N H G+  ++     E 
Sbjct: 126 GGHPYHHVGMPGTIIMPKEVVEETLIYVMLGLWNDGYRKIILINNH-GHLWMLESAVQEF 184

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEIGI-----HGGEIETSMMLALAPHLVKMDLA 186
             RF +  +          +      + E  +     H  E ETS+   L P ++ M   
Sbjct: 185 CKRFQLPGIFMVIDWHRAVREFFFPVDREDSLETHFVHADESETSVAQLLFPDMIDMKYV 244

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWS--------MKDLNPKGVVGNAMDATVKKGEGL 238
           ++          +F            WS         +   P+GVVG+   A  KK +  
Sbjct: 245 QDAEGESFLPDGHFDKSVDPFHRPMAWSQGEGHMAIERAATPEGVVGHPSKANPKKAKRP 304

Query: 239 LSYFANCFI---QLLNDINSFDVSIFD 262
           ++   +        + +  +F   +  
Sbjct: 305 IAAILSYLTLLHDHIRE--AFPPGVLP 329


>gi|254822792|ref|ZP_05227793.1| membrane sugar transferase [Mycobacterium intracellulare ATCC
           13950]
          Length = 685

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 58/226 (25%), Positives = 95/226 (42%), Gaps = 25/226 (11%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           ++PLG+ EQHGPHLP++TDT IA  +A R ++ L         P    G S EH    GT
Sbjct: 1   MIPLGSTEQHGPHLPLDTDTRIATAVARRARARLGDG--WLVAPAIAYGASGEHQSFAGT 58

Query: 85  KTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSW 144
            +L         +    +      R++V +N HGGN   +       R        +  W
Sbjct: 59  ISLGTEALTLLLVEYGRSAGTW-ARRLVFVNGHGGNVAALGAAVARLRAEGR----NAGW 113

Query: 145 SRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLR 204
                P G           H G  ETS++L ++P  V+ D     ++     L     +R
Sbjct: 114 CPCVAPGG---------DAHAGHTETSVLLHISPADVRTDQWRAGNTAPLPEL--LGSMR 162

Query: 205 AHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
             G  +       ++P GV+G+   AT  +GE +++   +  ++ +
Sbjct: 163 RGGVAA-------VSPVGVLGDPTTATAAEGERIVAEMVDECVRRV 201


>gi|114767632|ref|ZP_01446352.1| hypothetical protein 1100011001190_R2601_23138 [Pelagibaca
           bermudensis HTCC2601]
 gi|114540352|gb|EAU43443.1| hypothetical protein R2601_23138 [Roseovarius sp. HTCC2601]
          Length = 269

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/262 (20%), Positives = 98/262 (37%), Gaps = 11/262 (4%)

Query: 1   MNPLIIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL- 58
           M   I   + +      +   + +V+LP+G+ E  G H PM  D + A  +A  I     
Sbjct: 1   MIEKIRIAELTSEEARQELTSEAVVLLPMGSLEDQGIHAPMG-DYMAADLMAMEIAKAAR 59

Query: 59  PPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +P    PV P G         G  ++++A        +   + + GIRK++I+N HG
Sbjct: 60  EDGVPTFVAPVIPFGGKDYFESSHGGISISHATLCGILDDMFGCLERHGIRKLMIVNGHG 119

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTSWSRFT---IPQGIISFPETEIGIHGGEIETSMMLA 175
           GN P ++ V+   R +  + + S    +     +P  I +        HGG+  TS+ L 
Sbjct: 120 GNVPAITEVALRWRQKAGLFIPSMYLWQVAYGELPALIGADKAKASSGHGGDPLTSVGLH 179

Query: 176 LAPHLVKMDLAENFSSRQSEFLRNFKYLR----AHGSHSFGWSMKDLNPKGVVG-NAMDA 230
             P L++ D+ +   +                             +    G  G +    
Sbjct: 180 FYPDLIRADMIKPAPTGSEIKGMKIGGFSSVVYDGAKIQAPIEALEATETGAYGCDPTLC 239

Query: 231 TVKKGEGLLSYFANCFIQLLND 252
           + + G+ L+   A     L+ D
Sbjct: 240 SAETGDVLVKRLAAIGAGLVRD 261


>gi|108797976|ref|YP_638173.1| creatininase [Mycobacterium sp. MCS]
 gi|119867072|ref|YP_937024.1| creatininase [Mycobacterium sp. KMS]
 gi|108768395|gb|ABG07117.1| Creatininase [Mycobacterium sp. MCS]
 gi|119693161|gb|ABL90234.1| Creatininase [Mycobacterium sp. KMS]
          Length = 218

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 54/227 (23%), Positives = 86/227 (37%), Gaps = 25/227 (11%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++P+G+ EQHGPHLP++TDT IA  +A  +   L P       P    G S EH    G
Sbjct: 5   LIVPVGSTEQHGPHLPLDTDTRIATAVAREVAGTLTPSWS--LAPAVGYGASGEHESFPG 62

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
           T ++  A      +    +       ++V LN HGGN+  ++  +   R     +     
Sbjct: 63  TISIGTAALRLLLVEFGRSATNW-ASRVVFLNGHGGNTEALAGATALLRYEDRDVA---- 117

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
           W                   H G  ETS++L ++P  V  D  E  ++           L
Sbjct: 118 WCPCIAKD---------SDAHAGHTETSVLLHISPDDVHTDHWERGNTAP---------L 159

Query: 204 RAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250
           R          +  ++  GV+G+   AT   G  L           +
Sbjct: 160 RDLMPALRQGGVAAVSEVGVLGDPTTATGADGARLFGEMVRHCADRI 206


>gi|260427252|ref|ZP_05781231.1| creatininase [Citreicella sp. SE45]
 gi|260421744|gb|EEX14995.1| creatininase [Citreicella sp. SE45]
          Length = 269

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 56/262 (21%), Positives = 99/262 (37%), Gaps = 11/262 (4%)

Query: 1   MNPLIIFTDNSLPLCA-DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M   I   + +      +   + +V+LP+G+ E  G H PM  D + A  +A  I     
Sbjct: 1   MIDKIRMAELTSEEARQELTSEAVVLLPMGSLEDQGIHAPMG-DYLAADLMAMEIAKAAR 59

Query: 60  PR-LPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
              +     PV P G         G  ++++A        +   + + GIRKI+I+N HG
Sbjct: 60  EGGVSTFVAPVIPFGGKDYFESSHGGISISHATLCGILDDMFGCLNRHGIRKIMIVNGHG 119

Query: 119 GNSPLVSIVSTEARMRFSMLVVSTSWSRFT---IPQGIISFPETEIGIHGGEIETSMMLA 175
           GN P ++ V+   R +  + + S    +     +P  I +        HGG+  TS+ L 
Sbjct: 120 GNVPAITEVALRWRQKAGLFIPSMYLWQVAYGELPALIGAEKAKASSGHGGDPLTSVGLH 179

Query: 176 LAPHLVKMDLAENFSS----RQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDA 230
             P L++ DL     +    +  +       +             +    G  G N    
Sbjct: 180 FYPDLIRKDLVREAPTGSTIKGMDIGGFSSVVYDGAKIQAPIEALEATETGAYGCNPTLC 239

Query: 231 TVKKGEGLLSYFANCFIQLLND 252
           + + G+ L+   A     L+ D
Sbjct: 240 SAETGDVLVKRLAAIGAGLVID 261


>gi|332798648|ref|YP_004460147.1| creatinine amidohydrolase [Tepidanaerobacter sp. Re1]
 gi|332696383|gb|AEE90840.1| creatinine amidohydrolase, putative [Tepidanaerobacter sp. Re1]
          Length = 373

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 54/264 (20%), Positives = 100/264 (37%), Gaps = 20/264 (7%)

Query: 15  CADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCM---PVEP 71
                K+ IV +P+G  E HG H     DT +   + E ++     +     +   P+  
Sbjct: 70  IEKRSKNDIVFVPIGCTENHGMHANSGLDTFMVTQILEGVRRYTAKQGREVSLAFPPLNY 129

Query: 72  IGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEA 131
            G+   H+ + GT  +      E  + ++  +   G RKI+++N H G+  ++     E 
Sbjct: 130 GGHPYHHLGMPGTVIMPKEVVEETIIYMMLGLWNDGFRKIILVNNH-GHLWMLESAIQEF 188

Query: 132 RMRFSMLVVSTSWSRFTIPQGIISFPETEIGI-----HGGEIETSMMLALAPHLVKMDLA 186
             RF +  +          +      + E  +     H  E ETS+ L L P ++ M + 
Sbjct: 189 MKRFQLPGIFQVLDWHRAVREFFYPTDREDSLETHFVHADEAETSVGLLLFPDMIDMSVV 248

Query: 187 ENFSSRQSEFLRNFKYLRAHGSHSFGWS--------MKDLNPKGVVGNAMDATVKKGEGL 238
           E+          +F            WS         +   P+GVVG    A+VKK +  
Sbjct: 249 EDAEGESFLPDGHFDKSVDPFGRPHRWSEGEGHAAIERAATPQGVVGKPSIASVKKAKRP 308

Query: 239 LSYFANCFIQLLND--INSFDVSI 260
           ++        L++D  +++F    
Sbjct: 309 IAAILKYLT-LVHDQILDAFPAGT 331


>gi|167043903|gb|ABZ08591.1| putative creatinine amidohydrolase [uncultured marine crenarchaeote
           HF4000_APKG3H9]
          Length = 233

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 100/243 (41%), Gaps = 19/243 (7%)

Query: 8   TDNSLPLCADA--RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT 65
           ++   P        K   V++P+G+ EQHG HLP+ TD+ I   +A R+           
Sbjct: 4   SELYDPEFRKLIKSKKPTVIIPVGSLEQHGAHLPITTDSDIVTEIASRLAKKCG----FI 59

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
             P    G S EH  +    +++     +    I  ++ K  I+ +VILN H GN+  V 
Sbjct: 60  VFPTISYGVSEEHAPL-FNASISDTLLPDLLKGIFHSLVKNKIKSVVILNGHHGNARAVQ 118

Query: 126 IVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
             ST     +  ++    +S +   +            H G +ETS+MLA++   VKM  
Sbjct: 119 H-STTPLSYWRKIIKLRYYSYWHFMKHEFD--------HAGFVETSLMLAIS-DKVKMKK 168

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANC 245
           A+     +    +  + ++   + S G     +   GV G+   AT K GE  L+     
Sbjct: 169 AKKGLITKGMSEKEIQRIKKLSTESGG--FPKVAKNGVWGDPTSATKKDGEKFLAEIVRN 226

Query: 246 FIQ 248
             +
Sbjct: 227 LAK 229


>gi|302876628|ref|YP_003845261.1| Creatininase [Clostridium cellulovorans 743B]
 gi|307687302|ref|ZP_07629748.1| Creatininase [Clostridium cellulovorans 743B]
 gi|302579485|gb|ADL53497.1| Creatininase [Clostridium cellulovorans 743B]
          Length = 277

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 56/268 (20%), Positives = 105/268 (39%), Gaps = 30/268 (11%)

Query: 9   DNSLPLCADA-RKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP-RLPVTC 66
           D +     +  +++ +V+LP+   E+HGPHLP+ TDT +   + + I+  L    +    
Sbjct: 12  DMTYVEVENLIKQEAVVLLPVAVIEEHGPHLPLGTDTYLTYAMFKHIQDELDKVNVKSVI 71

Query: 67  MPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL--- 123
            P    G ++      G+ T+            I+ +   G + + ILN HG +      
Sbjct: 72  APPFYWGINVATSGFPGSFTVKVDTMKAVLKDTIECLYNWGFKNVYILNMHGDSLHSKTI 131

Query: 124 ------VSIVSTEARMRF---SMLVVSTSWSRFTIPQGIISFPETE----------IGIH 164
                 +  VS + +  +               + P  +I   + +          + IH
Sbjct: 132 VETVKEIYEVSQKDKKVYNIIPEFFQKIMGLDDSEPYLLIQKEDHDEPPVNDENPYMDIH 191

Query: 165 GGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV 224
            G  ETS+ML     LV  ++A+ F S +      F+ LR       G   +++ P G  
Sbjct: 192 AGGFETSLMLLEFKELVNEEMAKGFESSK----TTFELLRKW--QQGGVEGREITPLGYC 245

Query: 225 GNAMDATVKKGEGLLSYFANCFIQLLND 252
           GN  +  +K+ +     F    ++L+ D
Sbjct: 246 GNPSNINLKEAKEFTDAFVKLTVELIVD 273


>gi|169630912|ref|YP_001704561.1| hypothetical protein MAB_3832c [Mycobacterium abscessus ATCC 19977]
 gi|169242879|emb|CAM63907.1| Conserved hypothetical protein (creatininase?) [Mycobacterium
           abscessus]
          Length = 248

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 55/239 (23%), Positives = 92/239 (38%), Gaps = 26/239 (10%)

Query: 16  ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL---PPRLPVTCMPVEPI 72
             + +   +  PLG+ EQHGPHLP++TDT IA  +A    + L            P    
Sbjct: 22  ELSDEAITLFTPLGSTEQHGPHLPLDTDTRIAGAVATGAAAELAADGGDGRTALAPAIAY 81

Query: 73  GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
           G S EH    GT ++         +    +  +   R+IVI+N HGGN   +       R
Sbjct: 82  GASGEHQSFAGTISIGTEVLGRLLVEYARSAIQW-CRRIVIVNGHGGNIQGLVSAVRLLR 140

Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSR 192
                +     W    +  G           H G +ETS++L ++P +V+ +     +  
Sbjct: 141 SEGRDVA----WWACAVEGG---------DAHAGHVETSLLLHISPDVVRREEVLAGNVA 187

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLN 251
               L     +RA G  +       ++  GV+G+   A+ + G  +L          + 
Sbjct: 188 PLHELMAP--MRAGGVAA-------VSAIGVLGDPTTASSQDGARMLETMTRQCADAVR 237


>gi|302339939|ref|YP_003805145.1| creatinine amidohydrolase [Spirochaeta smaragdinae DSM 11293]
 gi|301637124|gb|ADK82551.1| creatinine amidohydrolase, putative [Spirochaeta smaragdinae DSM
           11293]
          Length = 372

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 56/270 (20%), Positives = 93/270 (34%), Gaps = 20/270 (7%)

Query: 11  SLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVT--CMP 68
                A  +K+ +V++P+G  E HG H     DT +   + E ++     +       +P
Sbjct: 65  RAEAVAKRKKNDVVLVPIGCSECHGDHNNTGLDTFMVTQICEGVRRYTAKQGREVNLALP 124

Query: 69  VEPI-GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
                G+   H+ + GT  +      E  +  +  +   G RKI+++N HG    LV   
Sbjct: 125 PINYGGHPYHHLGMPGTIIIPGEIVREMVIYTMLGLWNDGYRKIILVNNHGHLWNLVD-A 183

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGII------SFPETEIGIHGGEIETSMMLALAPHLV 181
             E   RF +  +          +            ET   IH  E ETS  L L   +V
Sbjct: 184 IQEFMKRFQLPAIVQVIDWHRAVREFFFCTDKKDSMETNF-IHAAEAETSTALLLFKEMV 242

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWS--------MKDLNPKGVVGNAMDATVK 233
            M    +          +F            WS         +   P+GVVG    A   
Sbjct: 243 NMKYVRDAVGEGFLPDGHFDLSVDPYRRPHRWSEGEGHSAIERAATPEGVVGFPSKADPY 302

Query: 234 KGEGLLSYFANCFIQLLNDI-NSFDVSIFD 262
           K +  ++        ++NDI ++F      
Sbjct: 303 KAKRPIAAILKYLTMMVNDILDAFPAGTLP 332


>gi|326329217|ref|ZP_08195543.1| creatininase family protein [Nocardioidaceae bacterium Broad-1]
 gi|325952952|gb|EGD44966.1| creatininase family protein [Nocardioidaceae bacterium Broad-1]
          Length = 231

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 53/222 (23%), Positives = 94/222 (42%), Gaps = 27/222 (12%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP-RLPVT 65
             D + P      +  ++++P+G+ EQHGPHLP +TDT IA+ + + +   L    +   
Sbjct: 4   LGDATWPHV---HRGTVLLVPVGSLEQHGPHLPFDTDTAIASAVTQGVADRLAEQGVESW 60

Query: 66  CMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125
             P   IG S EH    GT ++         + ++ + R     ++V++N HGGN+  ++
Sbjct: 61  VAPPIAIGSSGEHQSFAGTVSIGSDALHLVVVELVRSARTW-AERVVLVNGHGGNAAALT 119

Query: 126 IVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDL 185
               +                       +     +  +H G  ETS+ML L P  V++DL
Sbjct: 120 SAVNQLAYE-------------RQSACWLPCRTEDYDLHAGRTETSLMLHLRPESVRLDL 166

Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNA 227
           AE   +R          +R  G  +       ++  GV+G+ 
Sbjct: 167 AEPGDTR--PLAEILPAMRVGGVAA-------VSANGVLGDP 199


>gi|262198265|ref|YP_003269474.1| creatininase [Haliangium ochraceum DSM 14365]
 gi|262081612|gb|ACY17581.1| Creatininase [Haliangium ochraceum DSM 14365]
          Length = 257

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 53/249 (21%), Positives = 89/249 (35%), Gaps = 11/249 (4%)

Query: 6   IFTDNSLPLCADAR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPR-LP 63
              + +    A    +    +LP+GA E HGPHLP+ TD IIA  +A R    L  R L 
Sbjct: 5   RLAEMTWEEVAALPLRRTAALLPVGAVEAHGPHLPLATDVIIAEAMARRGAERLQARGLS 64

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
              +P      +       GT  +         + I   +   G   + I NAH   + +
Sbjct: 65  AVLLPPLAYTAAGFAAGFAGTLAMRPETVTAMVVDIGRGLAAHGFGLLAIANAHLDPTHI 124

Query: 124 VSI-VSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI-HGGEIETSMMLALAPHLV 181
            S+  + E      + +          P  +    E   G  H G+ E SM+LA  P LV
Sbjct: 125 GSLKRAGEELADSGVTIGFAFPDVTRKPWALRLSDEFRSGACHAGQYEGSMVLAERPELV 184

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
           + +L    +   +      +        + G       P+   G+   AT  +G+  ++ 
Sbjct: 185 REELRAQLAPNPASLSVAIRAGHTSFEEAGG-------PRAYFGDPAAATADEGQATIAT 237

Query: 242 FANCFIQLL 250
                 + +
Sbjct: 238 LGEILEEAV 246


>gi|170289672|ref|YP_001736488.1| creatininase [Candidatus Korarchaeum cryptofilum OPF8]
 gi|170173752|gb|ACB06805.1| Creatininase [Candidatus Korarchaeum cryptofilum OPF8]
          Length = 248

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/200 (23%), Positives = 84/200 (42%), Gaps = 10/200 (5%)

Query: 1   MNPLIIFTDNSLPLCADARKDW-IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
           M+   I+   +L    +A +D  + +LP+G  E HGPHLP+ TD +I   +A  +   L 
Sbjct: 1   MSERRIWL-MNLREFREAIEDTDLAILPVGVCEAHGPHLPLGTDFLIPEWIALNLAERL- 58

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG- 118
                   P    G ++      GT  ++ +        ++  + + G  K++++N HG 
Sbjct: 59  ---NALIAPPINYGVTLGLTGYFGTLRVSESTMESLMYDVLVDLMRNGFEKVIVMNGHGG 115

Query: 119 -GNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
            G    +S     A + + +     +W      + +        G H G  ET+M+L + 
Sbjct: 116 SGQVEAISRAMRRAWLDYGLKSAMINWWNLA--RDLTEEIFGGSGGHAGVDETAMILEID 173

Query: 178 PHLVKMDLAENFSSRQSEFL 197
           P LVK ++      R  E +
Sbjct: 174 PSLVKGEMEREEIYRTREGI 193


>gi|319951175|ref|ZP_08025019.1| creatinine amidohydrolase [Dietzia cinnamea P4]
 gi|319435163|gb|EFV90439.1| creatinine amidohydrolase [Dietzia cinnamea P4]
          Length = 229

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 59/228 (25%), Positives = 87/228 (38%), Gaps = 26/228 (11%)

Query: 17  DARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
            A    + VLPLGA EQHGPHLP  TDT+          +       V  +P    G S 
Sbjct: 10  RAGAGVLAVLPLGATEQHGPHLPPETDTL-----LATATARALAPGDVRVLPGLAYGASG 64

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
           EH   DGT ++         + +  ++      ++V++N HGGN   + +     R    
Sbjct: 65  EHQAFDGTVSIGTEALAGTIIELGRSVSAW-ADRLVVVNGHGGNVDALRLAVPRLRYEGR 123

Query: 137 MLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEF 196
                                E     H G  ETS++L L P LV++DLA          
Sbjct: 124 DAAWLPC-----------RTSEDPTDTHAGHAETSLLLHLHPDLVRVDLAAPG--CVEPL 170

Query: 197 LRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
            R    LR  G  +       ++P GV+G+   A+  +G  L     +
Sbjct: 171 PRILPALREGGVAA-------VSPNGVLGDPTTASADEGRRLWEALLD 211


>gi|13472999|ref|NP_104566.1| hypothetical protein mlr3472 [Mesorhizobium loti MAFF303099]
 gi|14023747|dbj|BAB50352.1| mlr3472 [Mesorhizobium loti MAFF303099]
          Length = 313

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 47/266 (17%), Positives = 89/266 (33%), Gaps = 40/266 (15%)

Query: 5   IIFTDNSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
           +   D +     D        +++P+G  EQ GP + +    +    LAE+I   L   L
Sbjct: 69  VFLEDQTWTELRDRINAGTTTIIVPIGGTEQSGPAMALGKHNVRVKFLAEKIAGQLGNAL 128

Query: 63  PVTCMPVEPIG---YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGG 119
               +   P G       HM   GT T++     +   +   + R  G + IV++  HGG
Sbjct: 129 VAPVISYVPEGTIDPPSAHMRFPGTITISDEIFEQLLASAARSFRLHGFKTIVLIGDHGG 188

Query: 120 NSPLVSIVSTEARMRF---SMLVVSTSWSRFTIPQGIIS------FPETEIGIHGGEIET 170
                  V+      +    + V +            +         ++EIG H G  +T
Sbjct: 189 YQADERHVADRLNAEWSKSPVRVFAALQYYQITQGAYVDKLLSAGARQSEIGTHAGLADT 248

Query: 171 SMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV-GNAMD 229
           S+MLA+ P +V+ D         +                           GV  G+   
Sbjct: 249 SLMLAIDPSMVRKDRLAAAPKLDAG-------------------------DGVYGGDPAR 283

Query: 230 ATVKKGEGLLSYFANCFIQLLNDINS 255
           ++ + G+  +    +   + + +   
Sbjct: 284 SSAEFGQLGVDMIVSGTTEAIREFAR 309


>gi|15922840|ref|NP_378509.1| hypothetical protein ST2507 [Sulfolobus tokodaii str. 7]
 gi|15623631|dbj|BAB67618.1| 231aa long conserved hypothetical protein [Sulfolobus tokodaii str.
           7]
          Length = 231

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 104/235 (44%), Gaps = 25/235 (10%)

Query: 23  IVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVD 82
           I ++P+G+ EQHGPHLPM TD+II   +A+RI+ +L  +  +   P      SIEH    
Sbjct: 19  IPLIPIGSIEQHGPHLPMGTDSIIVEEIAKRIEKMLSDK--ILLFPTIYYTCSIEHGDFP 76

Query: 83  GTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVST 142
               ++Y   I +   +++ + +    K +ILN HGGN  ++ IV      +     +  
Sbjct: 77  -YFGVSYITMISYLTELVNQLSRY-FDKAIILNGHGGNESILDIVKRSINFQNKHFKL-- 132

Query: 143 SWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKY 202
               F++    + + +    +H G +E+S++  + P LV+ +  ++      + + N   
Sbjct: 133 --YIFSVVGKGLEYFKIR-DLHAGTVESSIIKYINPRLVREERLKDIDYTVKDGVFN--- 186

Query: 203 LRAHGSHSFGWSMKDLNPKGVV---GNAMDATVKKGEGLLSYFANCFIQLLNDIN 254
                      +  D NP G++   G  +    K GE  +S   N     +  + 
Sbjct: 187 ---------TITTSDANPHGIINLDGK-VKIDEKLGEEFISRVVNDLYSFILSLE 231


>gi|295696603|ref|YP_003589841.1| Creatininase [Bacillus tusciae DSM 2912]
 gi|295412205|gb|ADG06697.1| Creatininase [Bacillus tusciae DSM 2912]
          Length = 231

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 64/236 (27%), Positives = 105/236 (44%), Gaps = 14/236 (5%)

Query: 25  VLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGT 84
           VLP+GA EQHGP LP++TD  IAA LAE+++ +L     V  +P  P   S EH    G 
Sbjct: 2   VLPMGAVEQHGPILPIDTDLRIAALLAEKLEEVLG-THRVLRLPPIPFTLSWEHRGFPGV 60

Query: 85  KTLTYAEAIEHWLAIIDAIRKM---GIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVS 141
            +L+          ++ ++R     G   +V+++ HGGN  L S+ +         LVV 
Sbjct: 61  ISLSVVTLHHILDDLMTSLRAWGSYGPSLVVLVSWHGGNQALESLAAELGARHNLPLVVL 120

Query: 142 TSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFK 201
            S    +  +           +H G +ETS++ A  P L       N ++   E    F+
Sbjct: 121 PS----SKSRRAAYQMAGPQDVHAGSLETSIITAFWPDL-----LANRTAMLQEDAPPFQ 171

Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257
            +        G  M+ ++  GV GNA + +V  G+  +          + ++ SF+
Sbjct: 172 AMDVQT-ALQGLGMRRISSSGVWGNAANPSVDAGKAGIQQLVAQMAAEVREMLSFE 226


>gi|299470174|emb|CBN78202.1| creatininase subfamily [Ectocarpus siliculosus]
          Length = 415

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 53/302 (17%), Positives = 81/302 (26%), Gaps = 62/302 (20%)

Query: 10  NSLPLCADARKDWI----------VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
            +        K             V++P+GA EQHGP+  + TD + A  +A  +  +  
Sbjct: 1   MTWMEVETRVKRDTAEATQTGKAAVIVPVGATEQHGPNGLIGTDHMTAEAVARGVCEMTG 60

Query: 60  PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNA--- 116
                   P    G S  H    GT TL  A  +     +  ++   G   ++ +N    
Sbjct: 61  ----AILAPTINYGMSHHHESFPGTVTLRPATFVAVVRDVAASLSGAGFTHVLFVNGTSR 116

Query: 117 -------------HGGNSPLV----------SIVSTEARMRFS---------------ML 138
                        HGGN                 + E     +                 
Sbjct: 117 SQPYRVVFGRCPGHGGNVGPAFKAFADFAAEKQQAREMEEEEAESSGGGGGGGGGDSTAR 176

Query: 139 VVSTSWSRFTIPQGII-SFPETEIGIHGGEIETSMMLALAPHLVK-----MDLAENFSSR 192
           V   SW        +       E+G H    E ++   L P  VK        A   +  
Sbjct: 177 VKLISWYAGRESSTLAKELYGGEVGQHATPDEVAVTQHLFPESVKSGVELDPAAIQVAKD 236

Query: 193 QSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV-GNAMDATVKKGEGLLSYFANCFIQLLN 251
                +  K      S       +   P G +  N   AT + G  LL          L 
Sbjct: 237 LGGMTKRIKDAETGLSVMDVQDFRRRFPDGRMFSNPALATPEHGRRLLEAAVRDATDALG 296

Query: 252 DI 253
             
Sbjct: 297 KF 298


>gi|330834690|ref|YP_004409418.1| creatininase [Metallosphaera cuprina Ar-4]
 gi|329566829|gb|AEB94934.1| creatininase [Metallosphaera cuprina Ar-4]
          Length = 229

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 57/251 (22%), Positives = 108/251 (43%), Gaps = 26/251 (10%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +   + +     ++ K  I +LP+G+ EQHGPHLPM TD+I+A  +A+ +  +       
Sbjct: 1   MKLAELT----KESLKASIGLLPIGSVEQHGPHLPMGTDSIVAESVAQEVDKL---ERDT 53

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              P    G SIEH  +    ++     +     ++D+ +++GI+ ++++N HGGNS L+
Sbjct: 54  LLFPTVYYGCSIEHGNLPH-VSVNDLNFMSFVYDLLDSTKRLGIKGVILINGHGGNSELL 112

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMD 184
            +VS +                  +    +   +    +H G +ETS+M  L P LVK D
Sbjct: 113 QVVSRKVNFT------LMRPKVKVVNLLSLEEFKRFDDLHAGTVETSLMKFLRPELVKED 166

Query: 185 LAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFAN 244
                +         F  L +    + G   K     G +    +  V+ G+ +     +
Sbjct: 167 KIPVTTDYSEH---TFSLLTSEKGGTDGIVTK-----GTI----EVNVEIGKRVFEEMIS 214

Query: 245 CFIQLLNDINS 255
              + ++ + S
Sbjct: 215 LVRKEISTLRS 225


>gi|257790913|ref|YP_003181519.1| Creatininase [Eggerthella lenta DSM 2243]
 gi|317488372|ref|ZP_07946929.1| creatininase [Eggerthella sp. 1_3_56FAA]
 gi|325830522|ref|ZP_08163975.1| creatininase [Eggerthella sp. HGA1]
 gi|257474810|gb|ACV55130.1| Creatininase [Eggerthella lenta DSM 2243]
 gi|316912525|gb|EFV34077.1| creatininase [Eggerthella sp. 1_3_56FAA]
 gi|325487431|gb|EGC89872.1| creatininase [Eggerthella sp. HGA1]
          Length = 276

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/274 (18%), Positives = 94/274 (34%), Gaps = 31/274 (11%)

Query: 1   MNPLIIFTDN---SLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSI 57
           M P +   +    +        KD +V +P+GA EQHG H+ M  D  +   +A      
Sbjct: 1   MKPTVYMEEMDAFTYRE--KLAKDAVVFIPVGALEQHGSHMAMCVDAALTKAMAGATAEA 58

Query: 58  LPPRLP----VTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGI 108
           L                  GY     S    ++ GT +L+    I     ++  +   G 
Sbjct: 59  LVADTDGAMEAVVAAPINYGYRSQQRSGGGFHLSGTTSLSGTTLIALAKDVVFGLILHGA 118

Query: 109 RKIVILNAHGGNSPLVSIVSTEARMRF------SMLVVSTSWSRFTIPQGIISFPETEIG 162
           RKIV++N H  N   +   +  A  +        + +   S+  F   + I +       
Sbjct: 119 RKIVLMNGHYENYQFIFEGAELALEKARENGIRDVKIQLLSYWDFVDDETIEALYPDGFT 178

Query: 163 I----HGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDL 218
                H G +ETS+ML   P LV +   ++              +               
Sbjct: 179 GWDLEHAGVMETSLMLLFHPDLVDLGKTDDPLYEGLPAELPNYDVLPIVPGYTP------ 232

Query: 219 NPKGVVGNAMDATVKKGEGLLSYFANCFIQLLND 252
            P G + + ++++ +KG  L +      ++ +  
Sbjct: 233 -PSGCLSSPVESSREKGAILRNVAVKHMVEAVKH 265


>gi|110634703|ref|YP_674911.1| hypothetical protein Meso_2360 [Mesorhizobium sp. BNC1]
 gi|110285687|gb|ABG63746.1| Uncharacterized protein putative amidase-like protein
           [Chelativorans sp. BNC1]
          Length = 254

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/247 (19%), Positives = 86/247 (34%), Gaps = 12/247 (4%)

Query: 24  VVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDG 83
           +++PLG+ E  GP  PM  D ++   LA  +      R      P  P G++     V G
Sbjct: 2   IIIPLGSQETQGPCNPMG-DFMLVRRLANEVA----SRTGCLVAPTVPFGFADCFSTVPG 56

Query: 84  TKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTS 143
              ++    +     ++ +    G+R++VI+N H GNS L+ +     R     LV   +
Sbjct: 57  GIQVSPETFMSLVRDVLLSFLNHGLRRLVIMNGHTGNSALIDLTVRRLRQERGALVPWIN 116

Query: 144 WSRFTIPQGIISFPETEIG---IHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNF 200
                             G    HG +   S+     P+L + +LA    + ++ F    
Sbjct: 117 IWPLASTGRRNEAHGANAGQATGHGADPIGSVYEYYYPNLTRRELATTEGTGKTFFGLPT 176

Query: 201 KYLR----AHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF 256
             L+    A         + D     V G+   A    G     +    F +L+  +   
Sbjct: 177 SGLQSVDLAGTPVHLPVRVDDHCDYVVGGDPSLANAAAGRIFADFIVAEFSKLVEHVAGL 236

Query: 257 DVSIFDK 263
                 +
Sbjct: 237 PAEQLVE 243


>gi|134287762|ref|YP_001109928.1| creatininase [Burkholderia vietnamiensis G4]
 gi|134132412|gb|ABO60147.1| Creatininase [Burkholderia vietnamiensis G4]
          Length = 272

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/265 (17%), Positives = 83/265 (31%), Gaps = 40/265 (15%)

Query: 2   NPLIIFTDNSLPLCADARK--DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILP 59
              +   D +     D        +++P+G  EQ GP + +         L++RI   L 
Sbjct: 26  PKTVQLEDLTWTELRDQIHAGKTTIIIPIGGTEQSGPDVALGKHNARVKVLSQRIAEGLG 85

Query: 60  PRLPVTCMPVEPIG---YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNA 116
             L    +   P G       HM   GT T+      +   +  ++ +  G   IV L  
Sbjct: 86  NALVAPVIAYVPEGGYAPPTSHMRFPGTITVPDDVFEKTLESAANSFKVHGFTNIVFLGD 145

Query: 117 HGGNSPLVSIVSTEARMRF---SMLVVSTSWSRFTIPQGII------SFPETEIGIHGGE 167
           HGG    +     +    +                   G         + + EIG H G 
Sbjct: 146 HGGYQNDIRRAVAQLNKTWAGSGARAFVPPEYYSASSDGYAQILRQHGYRDDEIGTHAGL 205

Query: 168 IETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV-GN 226
            +TS++LA+AP +V+++   N                                 GV  G+
Sbjct: 206 ADTSLLLAVAPQMVRLERLRNGPKLGPA-------------------------DGVYGGD 240

Query: 227 AMDATVKKGEGLLSYFANCFIQLLN 251
              ++ + G+       +  I  + 
Sbjct: 241 PRRSSAEIGQLGTDAIVSRTIDAVK 265


>gi|294341807|emb|CAZ90236.1| Creatinine amidohydrolase [Thiomonas sp. 3As]
          Length = 263

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 63/237 (26%), Positives = 97/237 (40%), Gaps = 23/237 (9%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           MNP ++    S     D  A  D ++ LP GA EQHGPHLP+ TD ++    A  + +  
Sbjct: 1   MNP-VMMERMSWMAYRDRIAEDDPVMFLPCGALEQHGPHLPLGTDALL----ATAVAAGA 55

Query: 59  PPRLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVI 113
             RL     P    GY          +  GT +L     I+    +I  + + GI+++V+
Sbjct: 56  AARLEGLVAPALSYGYKSQPKCGGGQHFPGTTSLDATSLIQMTRDVIRELARHGIKRLVV 115

Query: 114 LNAHGGNSPL----VSIVSTEARMRFSMLVVSTSWSRFTIPQGIIS-FPETEIGI---HG 165
           +  H  N       + +   E     ++ V+   +  F   Q +   FPE   G    H 
Sbjct: 116 VVGHYENQWFVTEGIDLALRELGPACALRVMRLEYWDFLTEQTLARVFPEGFPGFALEHA 175

Query: 166 GEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSH--SFGWSMKDLNP 220
             IETS+ML   P LV+MDL  +    Q      +  LR       +  W  K ++ 
Sbjct: 176 AVIETSLMLHHHPELVRMDLLPDDGPAQFPPYDIYP-LRPERELFSNEAWLQKQVSK 231


>gi|284043671|ref|YP_003394011.1| creatininase [Conexibacter woesei DSM 14684]
 gi|283947892|gb|ADB50636.1| Creatininase [Conexibacter woesei DSM 14684]
          Length = 256

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/216 (23%), Positives = 87/216 (40%), Gaps = 10/216 (4%)

Query: 5   IIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPV 64
           +     +         D +  + +GA EQHGPHLPM TDT IA  L   + + +   L  
Sbjct: 4   VELERITWQQAEAIGADAVGFVAIGATEQHGPHLPMGTDTEIARALTRAVGARVAVPLAA 63

Query: 65  TCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLV 124
              PV   G S  H+   GT +L+         A +  + +MG+R++ +++ HGGN   +
Sbjct: 64  --TPVISCGLSDHHLGFPGTISLSEETVAGVLDAHLAGLARMGVRRVALVSGHGGNFAFL 121

Query: 125 SIVSTEARMRFSMLVVSTSWSRFTIPQGII------SFPETEIGIHGGEIETSMMLALAP 178
              +     R   L V      +   + +                H G++ETS+ LA+  
Sbjct: 122 GRYAQRCGERHPDLAVVAFDDLWAFLEAMTAAGRAHGLDPVACDSHAGQLETSVALAIYG 181

Query: 179 HL-VKM-DLAENFSSRQSEFLRNFKYLRAHGSHSFG 212
              V+  D  E +++ + ++          G  + G
Sbjct: 182 EQGVRPFDDVEGYTASEPDWAERMFREGLRGFAASG 217


>gi|225570205|ref|ZP_03779230.1| hypothetical protein CLOHYLEM_06301 [Clostridium hylemonae DSM
           15053]
 gi|225161000|gb|EEG73619.1| hypothetical protein CLOHYLEM_06301 [Clostridium hylemonae DSM
           15053]
          Length = 339

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 48/265 (18%), Positives = 94/265 (35%), Gaps = 19/265 (7%)

Query: 11  SLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMP-- 68
              +    +K+ +V++P+G  E HG H     DT     + E ++           +   
Sbjct: 34  RWKVVEKRKKNDVVLVPVGCTECHGMHTVSALDTFQCQSIVEGVRRATAKDGREVSLAYN 93

Query: 69  VEPIG-YSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV 127
             P G +   H+ + GT  +    A+E  +A +  +   G RK + +N H G   ++   
Sbjct: 94  PLPYGAHPYHHLGMPGTVMVPQRVAVEVLVATMLGLWNDGFRKQIYINNH-GQLWVLETA 152

Query: 128 STEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG-----IHGGEIETSMMLALAPH-LV 181
             E   R+ +  +          +        E       +H  E ETS+ +   P  +V
Sbjct: 153 LHEFLYRYQLPCIIQVMDWHRAIREFFYPGAKEDMVKTPFVHADECETSVGMLCFPEGMV 212

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDL--------NPKGVVGNAMDATVK 233
            +  A+    +       F            WS  ++         P+GVVG+   A  +
Sbjct: 213 DLSHADETHPKSYFEPGRFDNSTDSFHRPQRWSETEMTSPITYKGTPEGVVGSPAIAEAR 272

Query: 234 KGEGLLSYFANCFIQLLNDI-NSFD 257
           K +  +          +++I ++F 
Sbjct: 273 KAKRPILAACEYLTFCVDEILDAFP 297


>gi|302344594|ref|YP_003809123.1| creatininase [Desulfarculus baarsii DSM 2075]
 gi|301641207|gb|ADK86529.1| Creatininase [Desulfarculus baarsii DSM 2075]
          Length = 240

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 54/235 (22%), Positives = 91/235 (38%), Gaps = 19/235 (8%)

Query: 5   IIFTDNSLP-LCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLP 63
           ++  + ++P      R+    +LP+G  EQHGPHLP+  D + A  LA+   +I P    
Sbjct: 1   MLMHELTMPGFVQQRRQVEAAILPIGVMEQHGPHLPLGLDAMHALALAQAAAAIEP---- 56

Query: 64  VTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL 123
              +P    G         GT  ++          I   +   GIR + +L  H G +  
Sbjct: 57  CFVLPPLFYGICRSTANHPGTIGISGDALRAVLHDIGQGVWSQGIRCLCLLTGHAGGTHQ 116

Query: 124 VSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKM 183
            +++    R+  S  +   +     +        +     H GE+ETS+ + L P LV+ 
Sbjct: 117 SALIEAGERLLTSTGLQVATVCVLDLLAEARPILQCPGDSHAGEVETSLAMHLWPGLVQG 176

Query: 184 DLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGL 238
             AE + S     L   K              +   P GV G+   A+ +KG  +
Sbjct: 177 SAAEEYPSFPRFRLVRDK--------------RAHWPGGVWGDPTKASAEKGRLI 217


>gi|288919782|ref|ZP_06414107.1| Creatininase [Frankia sp. EUN1f]
 gi|288348790|gb|EFC83042.1| Creatininase [Frankia sp. EUN1f]
          Length = 273

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 62/265 (23%), Positives = 101/265 (38%), Gaps = 32/265 (12%)

Query: 7   FTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLA---------ERIKSI 57
               + P    A    +V++P+G+ EQHGPHLP+ TDT IA  +A          +    
Sbjct: 3   LAARAWPAVPTA---PLVLVPVGSCEQHGPHLPLTTDTTIAVAVAEGAAEHLRQHQHLRQ 59

Query: 58  LPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
               +PV   P      S EH    GT ++         + ++ ++R      IV +NAH
Sbjct: 60  HGAAVPVLVAPPVIYTASGEHQGFPGTMSIGTQALRLLLVELVRSMRDWS-GPIVFVNAH 118

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEI----------GIHGGE 167
           GGN   ++   ++ R     +    S +         +  +               H G 
Sbjct: 119 GGNLRGLAEAVSQLRHEGHDVAWLASGAGRDSASRGSAGHDDAGHDDAGRDAATDSHAGF 178

Query: 168 IETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNA 227
            ETS+ML LAP  V+M  A+  ++     L          + +         P GV+G+ 
Sbjct: 179 TETSLMLHLAPEQVRMRRAQPGNTAPLAELMPAIAAGGVAAVA---------PSGVLGDP 229

Query: 228 MDATVKKGEGLLSYFANCFIQLLND 252
             A+ + GE LL         L++ 
Sbjct: 230 TAASARAGEELLRAIIENVSALIDH 254


>gi|187776648|ref|ZP_02993121.1| hypothetical protein CLOSPO_00163 [Clostridium sporogenes ATCC
           155