RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780633|ref|YP_003065046.1| creatinine amidohydrolase
[Candidatus Liberibacter asiaticus str. psy62]
         (267 letters)



>1v7z_A Creatininase, creatinine amidohydrolase; Mn-activated
           creatininase, substrate complex; 1.60A {Pseudomonas SP}
           (A:)
          Length = 260

 Score =  203 bits (517), Expect = 2e-53
 Identities = 61/251 (24%), Positives = 93/251 (37%), Gaps = 31/251 (12%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A  D +++LP+GA EQHG H+ MN D ++   + +R+      R+    MP    GY  +
Sbjct: 20  AAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRV----AERIGALVMPGLQYGYKSQ 75

Query: 78  HMYV-----DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
                     GT +L  A        II  + + G R++V++N H  NS  +      A 
Sbjct: 76  QKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYENSMFIVEGIDLAL 135

Query: 133 MRFS-------MLVVSTSWSRFTIPQGIISFPETEI----GIHGGEIETSMMLALAPHLV 181
                       +VV + W     P  I              HGG  ETS+MLAL P LV
Sbjct: 136 RELRYAGIQDFKVVVLSYWDFVKDPAVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLV 195

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
            +D   +                      F          G + +A  A+ +KGE +L  
Sbjct: 196 DLDRVVDHPPATFPP-----------YDVFPVDPARTPAPGTLSSAKTASREKGELILEV 244

Query: 242 FANCFIQLLND 252
                   + +
Sbjct: 245 CVQGIADAIRE 255


>3c6c_A 3-keto-5-aminohexanoate cleavage enzyme; YP_293392.1,
           prokaryotic protein of unknown function (DUF849),
           structural genomics; HET: MSE; 1.72A {Ralstonia eutropha
           JMP134} (A:)
          Length = 316

 Score = 31.7 bits (72), Expect = 0.100
 Identities = 17/103 (16%), Positives = 31/103 (30%), Gaps = 22/103 (21%)

Query: 6   IFTDNSLPLCADARKDWIVVLPLGAY---EQHGPHLPMNTDTIIAAGLAERIKSILPPRL 62
              +N       +RK  +     G      +H P  P+    I  A +            
Sbjct: 10  HHHENLYFQ-GXSRKVILTCAVTGNAPFNPKH-PSXPITPAQIADACVE----------- 56

Query: 63  PVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRK 105
                     G S+ H++V   KT   +     +  ++D +R 
Sbjct: 57  ---AAKA---GASVAHIHVRDPKTGGGSRDPVLFKEVVDRVRS 93


>3lot_A Uncharacterized protein; protein of unknown function,
           structural genomics, joint center for structural
           genomics, JCSG; HET: MSE; 1.89A {Archaeoglobus fulgidus}
           (A:)
          Length = 314

 Score = 29.0 bits (65), Expect = 0.75
 Identities = 20/109 (18%), Positives = 33/109 (30%), Gaps = 28/109 (25%)

Query: 40  MNTDTIIAAGL--AERIKSILPPRLPVTCMPVEPI---------GYSIEHMYVDGTKTLT 88
            +   I+   +  A    S   P LPVT  P + +         G    H++    K   
Sbjct: 4   KDDVVIVTCAITGAIHTPSX-SPYLPVT--PDQIVEEAVKAAEAGAGXVHIHARDPKDGR 60

Query: 89  YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSM 137
               +E +  I   I+K               S +V  V+T       +
Sbjct: 61  PTTDVEVFRYICREIKK--------------QSDVVINVTTGGGGTLGI 95


>3e49_A Uncharacterized protein DUF849 with A TIM barrel fold;
           YP_556190.1; HET: MSE; 1.75A {Burkholderia xenovorans
           LB400} (A:)
          Length = 311

 Score = 28.2 bits (63), Expect = 1.2
 Identities = 16/121 (13%), Positives = 34/121 (28%), Gaps = 33/121 (27%)

Query: 19  RKDWIVVLPLGAYEQHG--PHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSI 76
           RK  I     GA       P+LP+  D +  A +                      G ++
Sbjct: 6   RKVIITCAVTGAIHTPSXSPYLPVTPDEVAQASIG--------------AAEA---GAAV 48

Query: 77  EHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFS 136
            H++    +     +    +   +  I+               N+  V  ++T      +
Sbjct: 49  IHLHARDPRDGRPTQDPAAFAEFLPRIKS--------------NTDAVINLTTGGSPHXT 94

Query: 137 M 137
           +
Sbjct: 95  V 95


>1f60_B Elongation factor EEF1BA; protein-protein complex,
          translation; 1.67A {Saccharomyces cerevisiae} (B:)
          Length = 94

 Score = 28.1 bits (63), Expect = 1.3
 Identities = 7/32 (21%), Positives = 14/32 (43%)

Query: 50 LAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
          +   +K+I    L        PIG+ I+ + +
Sbjct: 27 MVANVKAIEMEGLTWGAHQFIPIGFGIKKLQI 58


>1b64_A Elongation factor 1-beta; guanine nucleotide exchange
          factor, G-protein, translation elongation; NMR {Homo
          sapiens} (A:)
          Length = 91

 Score = 28.1 bits (63), Expect = 1.4
 Identities = 9/32 (28%), Positives = 16/32 (50%)

Query: 50 LAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
          L E ++SI    L      + P+GY I+ + +
Sbjct: 24 LEECVRSIQADGLVWGSSKLVPVGYGIKKLQI 55


>1gh8_A Translation elongation factor 1BETA; alpha-beta sandwich,
          gene regulation, structural genomics, PSI; NMR
          {Methanothermobacterthermautotrophicus} (A:)
          Length = 89

 Score = 27.3 bits (61), Expect = 2.3
 Identities = 7/32 (21%), Positives = 15/32 (46%)

Query: 50 LAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
          L + I+  +P    +  +  EPI + +  + V
Sbjct: 22 LKKEIQERIPEGTELHKIDEEPIAFGLVALNV 53


>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high
           resolution; 1.04A {Bos taurus} (A:108-122,A:289-395)
          Length = 122

 Score = 27.0 bits (60), Expect = 3.0
 Identities = 21/78 (26%), Positives = 31/78 (39%), Gaps = 13/78 (16%)

Query: 101 DAIRKMG--IRKIVIL-----NAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGI 153
           D +RK G  IR I IL     N +  NS  + I   +   +  + V   S++     QG 
Sbjct: 18  DRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGK 77

Query: 154 ISFPETEIGIHGGEIETS 171
                  I I    +ET+
Sbjct: 78  Y------IAIASTTVETT 89


>2yy3_A Elongation factor 1-beta; structural genomics, NPPSFA,
          national project on protein structural and functional
          analyses; 2.50A {Pyrococcus horikoshii OT3} (A:)
          Length = 91

 Score = 26.5 bits (59), Expect = 3.4
 Identities = 7/32 (21%), Positives = 17/32 (53%)

Query: 50 LAERIKSILPPRLPVTCMPVEPIGYSIEHMYV 81
          L E++K ++P +  +  +  EPI + +  +  
Sbjct: 24 LEEKLKKVIPEKYGLAKVEREPIAFGLVALKF 55


>1ej6_A Lambda2; icosahedral, non-equivalence, dsRNA virus,
          methylase, methyltransferase, guanylyltransferase, zinc
          finger, icosahedral virus; 3.60A {Reovirus SP}
          (A:421-433,A:791-1026)
          Length = 249

 Score = 26.8 bits (59), Expect = 3.4
 Identities = 7/19 (36%), Positives = 12/19 (63%)

Query: 53 RIKSILPPRLPVTCMPVEP 71
          +I  ++P   PVTC+ + P
Sbjct: 58 KILELIPATSPVTCVDIRP 76


>1gwe_A Catalase; oxidoreductase, hdyrogen-peroxide:hydrogen
           peroxide oxidoreductase; HET: HEM; 0.88A {Micrococcus
           luteus} (A:58-140,A:192-389)
          Length = 281

 Score = 26.4 bits (58), Expect = 4.5
 Identities = 15/74 (20%), Positives = 30/74 (40%), Gaps = 8/74 (10%)

Query: 144 WSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYL 203
             RF+   G +  P+T   + G         AL  +  + +     ++    FLR ++ +
Sbjct: 38  LLRFSTVAGELGSPDTWRDVRG--------FALRFYTEEGNYDLVGNNTPIFFLRTWREM 89

Query: 204 RAHGSHSFGWSMKD 217
             +GSH++ W    
Sbjct: 90  NGYGSHTYLWVNAQ 103


>3e35_A Uncharacterized protein SCO1997; alpha/beta/alpha structure,
           actinobacteria-specific protein, conserved protein,
           unknown function; 2.20A {Streptomyces coelicolor A3}
           (A:1-257)
          Length = 257

 Score = 26.1 bits (57), Expect = 5.5
 Identities = 12/86 (13%), Positives = 28/86 (32%), Gaps = 4/86 (4%)

Query: 98  AIIDAIRKMGIRKIVILNAHGGNSPLVS--IVSTEARMRFSMLVVSTSWSRFTIPQGIIS 155
           A+   + ++G+R  V  +      P      ++        +    + +    +P    +
Sbjct: 125 AVGQIVERLGVRLSVSFHGIPXGVPHTRPVGITPHGSRTDLVPGHRSPFEEAQVPGSAEA 184

Query: 156 FPETEIGIHGGEIETSMMLALAPHLV 181
             E  +   G   +   + A  PH V
Sbjct: 185 LVEYRLAQAG--HDVLGVAAHVPHYV 208


>3e02_A Uncharacterized protein DUF849; YP_555544.1, protein of
           unknown function (DUF849), structural genomics; HET:
           MSE; 1.90A {Burkholderia xenovorans LB400} (A:)
          Length = 311

 Score = 25.5 bits (56), Expect = 6.8
 Identities = 10/77 (12%), Positives = 27/77 (35%), Gaps = 14/77 (18%)

Query: 40  MNTDTIIAAGL--AERIKSILPPRLPVTCMPVEPI---------GYSIEHMYVDGTKTLT 88
            +   II   +  +    +   P LP+T  P E +         G +  H++        
Sbjct: 4   QSKKIIITCAVTGSIHTPTX-SPYLPIT--PEEIVKEGVAAAEAGAAXLHLHARDPLNGR 60

Query: 89  YAEAIEHWLAIIDAIRK 105
            ++  + +   +  +++
Sbjct: 61  PSQDPDLFXRFLPQLKE 77


>3kx2_B PRE-mRNA-splicing factor ATP-dependent RNA helicase PRP43;
           REC-A domains, OB fold, winged-helix domain,
           ATP-binding, mRNA processing; HET: ADP; 2.20A
           {Saccharomyces cerevisiae} (B:658-767)
          Length = 110

 Score = 25.7 bits (56), Expect = 7.0
 Identities = 2/27 (7%), Positives = 9/27 (33%)

Query: 167 EIETSMMLALAPHLVKMDLAENFSSRQ 193
            +    ++ +AP    +   +    + 
Sbjct: 55  SVRPEWLIEIAPAYYDLSNFQKGDVKL 81


>1wyo_A Protein EB3, microtubule-associated protein RP/EB family
           member 3; CH domain, microtubule-binding, structural
           genomics, NPPSFA; NMR {Homo sapiens} (A:)
          Length = 159

 Score = 25.6 bits (56), Expect = 7.2
 Identities = 10/34 (29%), Positives = 17/34 (50%)

Query: 172 MMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRA 205
            M  L P  V +   +  +  + E++ NFK L+A
Sbjct: 54  FMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQA 87


>1h70_A NG, NG-dimethylarginine dimethylaminohydrolase; DDAH, nitric
           oxide synthase inhibitor; HET: CIR; 1.8A {Pseudomonas
           aeruginosa} (A:1-61,A:245-255)
          Length = 72

 Score = 25.1 bits (55), Expect = 9.4
 Identities = 7/25 (28%), Positives = 14/25 (56%)

Query: 89  YAEAIEHWLAIIDAIRKMGIRKIVI 113
           YA+A+E   A I A++   +   ++
Sbjct: 29  YAKALEQHNAYIRALQTCDVDITLL 53


>2zqe_A MUTS2 protein; alpha/beta, ATP-binding, DNA-binding,
           nucleotide-binding, DNA binding protein; 1.70A {Thermus
           thermophilus HB8} (A:)
          Length = 83

 Score = 25.1 bits (55), Expect = 9.6
 Identities = 9/32 (28%), Positives = 17/32 (53%)

Query: 87  LTYAEAIEHWLAIIDAIRKMGIRKIVILNAHG 118
           LT AEA+      ++  R +G+  + +L+  G
Sbjct: 12  LTVAEALLEVDQALEEARALGLSTLRLLHGKG 43


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.322    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0625    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 2,096,182
Number of extensions: 93839
Number of successful extensions: 371
Number of sequences better than 10.0: 1
Number of HSP's gapped: 367
Number of HSP's successfully gapped: 32
Length of query: 267
Length of database: 4,956,049
Length adjustment: 87
Effective length of query: 180
Effective length of database: 2,015,014
Effective search space: 362702520
Effective search space used: 362702520
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (24.8 bits)