RPSBLAST alignment of GI: 254780633 and SCOP domain: d1v7za_

Alignment
>d1v7za_ c.125.1.1 (A:) Creatininase {Pseudomonas putida [TaxId: 303]} Length = 257
 Score =  165 bits (418), Expect = 4e-42
 Identities = 61/251 (24%), Positives = 94/251 (37%), Gaps = 31/251 (12%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A  D +++LP+GA EQHG H+ MN D ++   + +R    +  R+    MP    GY  +
Sbjct: 18  AAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKR----VAERIGALVMPGLQYGYKSQ 73

Query: 78  HM-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
                  +  GT +L  A        II  + + G R++V++N H  NS  +      A 
Sbjct: 74  QKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYENSMFIVEGIDLAL 133

Query: 133 MRFS-------MLVVSTSWSRFTIPQGIISFPETEI----GIHGGEIETSMMLALAPHLV 181
                       +VV + W     P  I              HGG  ETS+MLAL P LV
Sbjct: 134 RELRYAGIQDFKVVVLSYWDFVKDPAVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLV 193

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
            +D   +                      F          G + +A  A+ +KGE +L  
Sbjct: 194 DLDRVVDHPPA-----------TFPPYDVFPVDPARTPAPGTLSSAKTASREKGELILEV 242

Query: 242 FANCFIQLLND 252
                   + +
Sbjct: 243 CVQGIADAIRE 253

SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Creatininase
superfamily: Creatininase
family: Creatininase
domain: Creatininase
species: Pseudomonas putida [TaxId: 303]