HHsearch alignment for GI: 254780634 and conserved domain: PRK11207

>PRK11207 tellurite resistance protein TehB; Provisional.
Probab=98.68  E-value=5.8e-07  Score=67.08  Aligned_cols=135  Identities=17%  Similarity=0.279  Sum_probs=98.2

Q ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHCCCCEEHHHHCCHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCEEEECCC
Q ss_conf             66662586013468827999999861688100552498999999999875028860882155434457232467896275
Q gi|254780634|r  229 ITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQLHSSWESLRNLQEHFTTVLVDAP  308 (429)
Q Consensus       229 ~~~g~~vLD~CAapGGKt~~la~~~~~~g~i~A~D~~~~Rl~~l~~~~~r~g~~~v~~~~~~~~~~~~~~~fd~vl~DaP  308 (429)
T Consensus        29 ~~~-g~~LDlgcG~Grna~~La~~---G~~VtavD~s~~al~~~~~~a~~~~l~~v~~~~~Dl~~~~~~~~yDlIls---  101 (198)
T PRK11207         29 VKP-GRTLDLGCGNGRNSLYLAAN---GYDVTAWDKNPMSIANLERIKAAENLDNLHTRVVDLNNLTFDGEYDFILS---  101 (198)
T ss_pred             CCC-CCEEEECCCCCHHHHHHHHC---CCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCEEEE---
T ss_conf             899-74777247887869999868---98599997999999999999987599824656203123887777058978---


Q ss_pred             CCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEE--------CCC----CHHHCHHHHHHHHHH
Q ss_conf             44504444422366724967899999987899999999608983899977--------588----824299989999985
Q gi|254780634|r  309 CSGTGTWRRRPDIKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYIT--------CSI----LPEENIQQINYFLSK  376 (429)
Q Consensus       309 CSg~G~~rr~Pe~~w~~~~~~~~~~~~lQ~~iL~~a~~~lk~gG~lvYsT--------CS~----~~~Ene~vv~~fL~~  376 (429)
T Consensus       102 ---tvv~-------~fl~p~~~-------p~iia~mq~~t~PGG~~LIV~~~dt~d~p~~~~fpf~f~~gE-----L~~y  159 (198)
T PRK11207        102 ---TVVL-------MFLEAKTI-------PGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGE-----LRRY  159 (198)
T ss_pred             ---EEEE-------EECCHHHH-------HHHHHHHHHHCCCCCEEEEEEECCHHHCCCCCCCCCCCCHHH-----HHHH
T ss_conf             ---6452-------10486678-------999999999608994899999745423789989777668579-----9987


Q ss_pred             CCCCEEEECCCCCCCC
Q ss_conf             7997994143002223
Q gi|254780634|r  377 NPHFSIDSIIDDWNQL  392 (429)
Q Consensus       377 ~~~~~~~~~~~~~~~~  392 (429)
T Consensus       160 y~~W~il~YnE~~g~l  175 (198)
T PRK11207        160 YEGWEMVKYNEDVGEL  175 (198)
T ss_pred             HCCCEEEEECCCHHHH
T ss_conf             2799799843156888