RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780634|ref|YP_003065047.1| NOL1/NOP2/SUN family signature
protein [Candidatus Liberibacter asiaticus str. psy62]
         (429 letters)



>gnl|CDD|30493 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation,
           ribosomal structure and biogenesis].
          Length = 355

 Score =  248 bits (634), Expect = 2e-66
 Identities = 106/352 (30%), Positives = 159/352 (45%), Gaps = 32/352 (9%)

Query: 97  FSPPLPKESVIKSFHSRQLENAPLH------------IQGNIPQWLQSSFQSYFK-DTWL 143
            +     +     F +  L                   + + P+WL          D   
Sbjct: 13  AAKERLGKDRAAKFVNAVLRRLERSEEALLEEILRPAFRYSHPEWLVEKLPDALGEDEAE 72

Query: 144 KEAKSLSMRAPLDLRTNTLKVNRCKLFKNLCHYGVH--HSSISRFGLRIPATKGKSRLPN 201
             A +L    P  LR NTLK +  +L + L   GV      +    LRI A+    RLP 
Sbjct: 73  AIAAALLRPPPRSLRVNTLKADVEELLEALEEAGVLDEKPWVLDEVLRIEASGPIGRLP- 131

Query: 202 VMNDITFQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKG-QIH 260
                 F  G   +QDE SQ+ + +       ++LD CA  GGKT  L+ L+ N+G  + 
Sbjct: 132 -----EFAEGLIYVQDEASQLPALVLDPKPGERVLDLCAAPGGKTTHLAELMENEGAIVV 186

Query: 261 AWDNNKSRMAPIVARIKRAGIHNVQLH----SSWESLRNLQEHFTTVLVDAPCSGTGTWR 316
           A D +  R+  +   +KR G+ NV +          L    E F  +L+DAPCSGTG  R
Sbjct: 187 AVDVSPKRLKRLRENLKRLGVRNVIVVNKDARRLAELLPGGEKFDRILLDAPCSGTGVIR 246

Query: 317 RRPDIKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSK 376
           R PD+KWR + +++ E  + QK+IL  + + ++P G LVY TCS+ PEEN + +  FL +
Sbjct: 247 RDPDVKWRRTPEDIAELAKLQKEILAAALKLLKPGGVLVYSTCSLTPEENEEVVERFLER 306

Query: 377 NPHFSIDSIIDDWNQLYDLKNHPSLFIENGCCV-LTPFLTNTDGFFFCRLKR 427
           +P F ++ +   W  L        L  E G    L P +  TDGFF  +L++
Sbjct: 307 HPDFELEPVRLPWGPL-----FEGLGSELGKTRRLYPHVHGTDGFFIAKLRK 353


>gnl|CDD|36338 KOG1122, KOG1122, KOG1122, tRNA and rRNA cytosine-C5-methylase
           (nucleolar protein NOL1/NOP2) [RNA processing and
           modification].
          Length = 460

 Score =  154 bits (391), Expect = 3e-38
 Identities = 83/286 (29%), Positives = 127/286 (44%), Gaps = 17/286 (5%)

Query: 151 MRAPLDLRTNTLKVNRCKLFKNLCHYGVHH---SSISRFGLRIPATKGKSRLPNVMNDIT 207
              P+ +RTNTLK  R  L   L + GV+       S+ GL +        +        
Sbjct: 163 KPRPVTIRTNTLKTRRRDLAVELSNRGVNLDPLGKWSKVGLVV--FDSVVPIGATPE--- 217

Query: 208 FQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKS 267
           +  G + +Q+  S +           +ILD CA  GGKT  ++ L+ N G I A D+N++
Sbjct: 218 YLAGHYMLQNASSFLPVMALDPQPGERILDMCAAPGGKTTHIAALMKNTGVIFANDSNEN 277

Query: 268 RMAPIVARIKRAGIHN---VQLHSSWESLRNLQEHFTTVLVDAPCSGTGTWRRRPDIKWR 324
           R+  + A + R G+ N             +     F  VL+DAPCSGTG   +   +K  
Sbjct: 278 RLKSLKANLHRLGVTNTIVSNYDGREFPEKEFPGSFDRVLLDAPCSGTGVISKDQSVKTN 337

Query: 325 LSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNPHFSIDS 384
            + K+++     Q+++L  +   V+  G LVY TCSI  EEN   ++Y L K P   +  
Sbjct: 338 KTVKDILRYAHLQRELLLSAIDLVKAGGVLVYSTCSITVEENEAVVDYALKKRPEVKLVP 397

Query: 385 IIDDWNQ---LYDLKNHPSLFIENGCCVLTPFLTNTDGFFFCRLKR 427
              D          + HPSL +        P + N DGFF  +LK+
Sbjct: 398 TGLDIGGEGRFRGGRFHPSLKLTR---RFYPHVHNMDGFFVAKLKK 440


>gnl|CDD|144689 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family. 
          Length = 277

 Score =  146 bits (371), Expect = 9e-36
 Identities = 96/283 (33%), Positives = 134/283 (47%), Gaps = 21/283 (7%)

Query: 152 RAPLDLRTNTLKVNRCKLFKNLCHYGVHHSSISRF-----GLRIPATKGKSRLPNVMNDI 206
             P  LR N LK  R  L + L   GV    + R+        +P + G   LP   N  
Sbjct: 8   SPPGTLRKNVLKTKRWSLLQALELAGVQLEPLGRYPHALPVGDLPYSIG--SLPPFEN-- 63

Query: 207 TFQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNK 266
               G   +QD  SQ+ +          ILD CA  GGKT  ++ L+ N+G + A D NK
Sbjct: 64  ----GAVTVQDASSQLDAIALNPQEDEFILDMCAAPGGKTTHIAELMKNEGTVVAVDRNK 119

Query: 267 SRMAPIVARIKRAG---IHNVQLHSSWESLRNLQEHFTTVLVDAPCSGTGTWRRRPDIKW 323
            R+  + A I+R G   I   +  +     + L   F  +L+DAPCSGTG  RR PDIKW
Sbjct: 120 QRLKRVYANIQRLGVFNIIVQEGDARQIDQKLLGGEFDRILLDAPCSGTGVIRRDPDIKW 179

Query: 324 RLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNPHFSID 383
              + ++ +  E QK++L+ +   V+P G LVY TCS+LPEEN   I YFL K P   ++
Sbjct: 180 LRREADIAQLAELQKELLKAAWDLVKPGGVLVYSTCSVLPEENEAVIKYFLQKRP--DVE 237

Query: 384 SIIDDWNQLYDLKNHPSLFIENGCCVLTPFLTNTDGFFFCRLK 426
            +    ++           I  G     P   N DGFFF +L+
Sbjct: 238 LVPTGLSEGKIALAKR---IVKGGLQSLPHELNRDGFFFAKLR 277


>gnl|CDD|37571 KOG2360, KOG2360, KOG2360, Proliferation-associated nucleolar
           protein (NOL1) [Cell cycle control, cell division,
           chromosome partitioning].
          Length = 413

 Score = 84.3 bits (208), Expect = 6e-17
 Identities = 63/224 (28%), Positives = 104/224 (46%), Gaps = 17/224 (7%)

Query: 208 FQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKS 267
           ++ G F +QD+ S + ++L      S+++D CA  G KT  L+ ++ N+G+I+A++ +  
Sbjct: 190 YKNGKFILQDKASCLPAHLLDPRPGSRVIDTCAAPGNKTSHLAAIMRNQGKIYAFERDAK 249

Query: 268 RMAPIVARIKRAGIHNVQLHSSWESLRNLQEHF---TTVLVDAPCSGTGTWRRRPDIKWR 324
           R A +   +K AG+  V+            E F   T +LVD  CSG+G   R+ +    
Sbjct: 250 RAATLRKLLKIAGVSIVESVEGDFLNTATPEKFRDVTYILVDPSCSGSGMVSRQDEDPG- 308

Query: 325 LSQKNLIERTEE----QKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNPHF 380
            ++    ER E     Q +IL+ +  F   +  LVY TCS+  EEN Q +   L +NP  
Sbjct: 309 -AETESPERLENLQSFQIRILKHALTFPNLK-RLVYSTCSLHREENEQVVQEVLQQNPDA 366

Query: 381 ---SIDSIIDDWNQLYDLKNHPSLFIENGCCVLTPFLTNTDGFF 421
              +   ++  W          +      C   +P  T T GFF
Sbjct: 367 KRLAPKKVLPAWPHRGL----STFSGAEHCLRASPKSTLTIGFF 406


>gnl|CDD|37409 KOG2198, KOG2198, KOG2198, tRNA cytosine-5-methylases and related
           enzymes of the NOL1/NOP2/sun superfamily [Translation,
           ribosomal structure and biogenesis].
          Length = 375

 Score = 78.1 bits (192), Expect = 4e-15
 Identities = 54/201 (26%), Positives = 83/201 (41%), Gaps = 17/201 (8%)

Query: 180 HSSISRFGLRIPATKGKSRLPNVMNDITFQRGWFEIQDEGSQIVSNLTAITNSSQILDFC 239
              +    +R       SR    +   T   G    Q+  S +      +    ++LD C
Sbjct: 107 EKDVKLDEIRKSPPL--SRFHGFLKLET-GVGNIYRQEAVSMLPVLALGVKPGDKVLDMC 163

Query: 240 AGGGGKTLAL---SMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQLH----SSWES 292
           A  GGKT  L         +G + A D +  R+  +V ++KR    N+ +     S + +
Sbjct: 164 AAPGGKTAQLLEALHKDPTRGYVVANDVDPKRLNMLVHQLKRLPSPNLLVTNHDASLFPN 223

Query: 293 LR------NLQEHFTTVLVDAPCSGTGTWRRRPDI-KWRLSQKNLIERTEEQKKILEESA 345
           +         Q  F  VLVD PCSG GT R+ P+I K     +  +     Q +IL    
Sbjct: 224 IYLKDGNDKEQLKFDRVLVDVPCSGDGTLRKNPNIWKEGWKTQRALGLHALQLRILRRGL 283

Query: 346 QFVRPEGYLVYITCSILPEEN 366
           + ++  G LVY TCS+ P EN
Sbjct: 284 RLLKVGGRLVYSTCSLNPIEN 304


>gnl|CDD|110227 pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransferase family. 
          Length = 233

 Score = 34.3 bits (79), Expect = 0.066
 Identities = 21/94 (22%), Positives = 38/94 (40%), Gaps = 5/94 (5%)

Query: 201 NVMNDITFQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIH 260
           ++MND+      F I             +   ++ LD   G G  T  LS    + G++ 
Sbjct: 21  DLMNDVIS----FGIHRLWKDFTMKCMGVKRGNKFLDVAGGTGDWTFGLSDSAGSSGKVV 76

Query: 261 AWDNNKSRMAPIVARIKRAGIHNVQ-LHSSWESL 293
             D N++ +     + K  G +N++ L  + E L
Sbjct: 77  GLDINENMLKEGEKKAKEEGKYNIEFLQGNAEEL 110


>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent
           methyltransferases (SAM or AdoMet-MTase), class I;
           AdoMet-MTases are enzymes that use
           S-adenosyl-L-methionine (SAM or AdoMet) as a substrate
           for methyltransfer, creating the product
           S-adenosyl-L-homocysteine (AdoHcy). There are at least
           five structurally distinct families of AdoMet-MTases,
           class I being the largest and most diverse. Within this
           class enzymes can be classified by different substrate
           specificities (small molecules, lipids, nucleic acids,
           etc.) and different target atoms for methylation
           (nitrogen, oxygen, carbon, sulfur, etc.)..
          Length = 107

 Score = 33.6 bits (77), Expect = 0.12
 Identities = 24/125 (19%), Positives = 41/125 (32%), Gaps = 25/125 (20%)

Query: 235 ILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQL-HSSWESL 293
           +LD   G G   LAL++      ++   D +   +             NV++     E L
Sbjct: 2   VLDLGCGTGA--LALALASGPGARVTGVDISPVALELARKAAAALLADNVEVLKGDAEEL 59

Query: 294 RNLQ-EHFTTVLVDAPCSGTGTWRRRPDIKWRLSQKNLIERTEEQKKILEESAQFVRPEG 352
                E F  ++ D P                          E+  + LEE+ + ++P G
Sbjct: 60  PPEADESFDVIISDPPLHHLV---------------------EDLARFLEEARRLLKPGG 98

Query: 353 YLVYI 357
            LV  
Sbjct: 99  VLVLT 103


>gnl|CDD|31823 COG1636, COG1636, Uncharacterized protein conserved in bacteria
           [Function unknown].
          Length = 204

 Score = 29.5 bits (66), Expect = 1.7
 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 341 LEESAQFVRPEGYLVYITC-SILPEENIQQIN 371
           LE++A+  +  G+ V+ T   I P++N+ QIN
Sbjct: 99  LEKTAKKAKELGFDVFTTTLLISPKKNMNQIN 130


>gnl|CDD|31268 COG1070, XylB, Sugar (pentulose and hexulose) kinases [Carbohydrate
           transport and metabolism].
          Length = 502

 Score = 29.6 bits (66), Expect = 1.8
 Identities = 13/59 (22%), Positives = 25/59 (42%), Gaps = 1/59 (1%)

Query: 50  VHDVLRKYLSSAYIMD-SDDPESLVYAVIMKDWDIPWEKMLSMLKEDLFSPPLPKESVI 107
           + D LR  L+  +  + SD   + +  +  + WD      L + + DL  P +    V+
Sbjct: 161 IKDYLRYRLTGEFATEISDASGTGLLDIRTRKWDWELLAALGLPERDLLPPVVEPGEVL 219


>gnl|CDD|33880 COG4123, COG4123, Predicted O-methyltransferase [General function
           prediction only].
          Length = 248

 Score = 28.7 bits (64), Expect = 3.6
 Identities = 31/190 (16%), Positives = 71/190 (37%), Gaps = 26/190 (13%)

Query: 202 VMNDITFQRGWFEIQDEG-------SQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLN 254
           +++++   + +F IQD         + +++    +    +ILD  AG G   L L+    
Sbjct: 8   LIDNLFTFKQFFIIQDRCGFRYGTDAILLAAFAPVPKKGRILDLGAGNGALGLLLAQRT- 66

Query: 255 NKGQIHAWDNNKSRMAPIVAR-------IKRAGIHNVQLHSSWESLRNLQEHFTTVLVDA 307
            K +I   +  +   A +  R        +R  +    +    ++L      F  ++ + 
Sbjct: 67  EKAKIVGVEIQE-EAAEMAQRNVALNPLEERIQVIEADIKEFLKALV--FASFDLIICNP 123

Query: 308 PCSGTGTWRRRPDIKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENI 367
           P    G+      +  R   ++ I    E   ++  +A+ ++P G L +    +   E +
Sbjct: 124 PYFKQGSRLNENPL--RAIARHEITLDLED--LIRAAAKLLKPGGRLAF----VHRPERL 175

Query: 368 QQINYFLSKN 377
            +I   L   
Sbjct: 176 AEIIELLKSY 185


>gnl|CDD|31410 COG1217, TypA, Predicted membrane GTPase involved in stress
           response [Signal transduction mechanisms].
          Length = 603

 Score = 28.2 bits (63), Expect = 5.0
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 5/48 (10%)

Query: 291 ESLRNLQ-----EHFTTVLVDAPCSGTGTWRRRPDIKWRLSQKNLIER 333
           E +RN+      +H  T LVDA    +GT+R R ++  R+   N +E+
Sbjct: 3   EDIRNIAIIAHVDHGKTTLVDALLKQSGTFREREEVAERVMDSNDLEK 50


>gnl|CDD|37290 KOG2079, KOG2079, KOG2079, Vacuolar assembly/sorting protein VPS8
           [Intracellular trafficking, secretion, and vesicular
           transport].
          Length = 1206

 Score = 28.0 bits (62), Expect = 5.5
 Identities = 10/28 (35%), Positives = 15/28 (53%)

Query: 73  VYAVIMKDWDIPWEKMLSMLKEDLFSPP 100
           V      D+D P  ++LS +  D+FSP 
Sbjct: 592 VNNKAFNDYDTPLVELLSRISNDIFSPS 619


>gnl|CDD|31289 COG1092, COG1092, Predicted SAM-dependent methyltransferases
           [General function prediction only].
          Length = 393

 Score = 28.0 bits (62), Expect = 5.6
 Identities = 14/74 (18%), Positives = 32/74 (43%), Gaps = 16/74 (21%)

Query: 290 WESLRNLQEH---FTTVLVDAPCSGTGTWRRRPDIKWRLSQKNLIERTEEQKKILEESAQ 346
           ++ LR  +     F  +++D P     ++ R    ++   Q++        K + + + +
Sbjct: 278 FKWLRKAERRGEKFDLIILDPP-----SFARSKKQEFSA-QRDY-------KDLNDLALR 324

Query: 347 FVRPEGYLVYITCS 360
            + P G LV  +CS
Sbjct: 325 LLAPGGTLVTSSCS 338


>gnl|CDD|144984 pfam01596, Methyltransf_3, O-methyltransferase.  Members of this
           family are O-methyltransferases. The family includes
           catechol o-methyltransferase, caffeoyl-CoA
           O-methyltransferase, and a family of bacterial
           O-methyltransferases that may be involved in antibiotic
           production.
          Length = 204

 Score = 27.7 bits (62), Expect = 6.9
 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 8/82 (9%)

Query: 205 DITFQRGWFEIQ---DEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHA 261
           + T +    ++Q   +EG Q +S L  +  + + L+     G   LA ++ L   G+I A
Sbjct: 16  EATAKLPLSQMQISPEEG-QFLSMLVKLVGAKRTLEIGVFTGYSLLATALALPEDGKITA 74

Query: 262 WDNNKSRMAPIVAR--IKRAGI 281
            D    R A  +    I++AG+
Sbjct: 75  CD--IDREAYEIGLPFIQKAGV 94


>gnl|CDD|30621 COG0272, Lig, NAD-dependent DNA ligase (contains BRCT domain type
           II) [DNA replication, recombination, and repair].
          Length = 667

 Score = 27.5 bits (61), Expect = 7.3
 Identities = 33/151 (21%), Positives = 63/151 (41%), Gaps = 33/151 (21%)

Query: 268 RMAPIV---ARIKRAGIHNVQLHSSWESLRNLQEHFTTVLVDAPCSGTGTWRRRPDIKWR 324
           R+ P+      + RA +HNV      +          TV+V          R+  D+  +
Sbjct: 341 RLEPVELAGVTVSRATLHNVDEIKRKDIRIG-----DTVVV----------RKAGDVIPQ 385

Query: 325 LSQKNLIERTEEQKKILEES------AQFVRPEGYLVYITCS---ILPEENIQQINYFLS 375
           +    L +R   +K I   +      ++ VR EG  V I C+     P +  +++ +F+S
Sbjct: 386 VVGVVLEKRPGNEKPIPFPTHCPVCGSELVREEG-EVVIRCTNGLNCPAQLKERLIHFVS 444

Query: 376 KNPHFSIDSIIDD-WNQLYD---LKNHPSLF 402
           +N    ID + +    QL++   +K+   L+
Sbjct: 445 RNA-LDIDGLGEKIIEQLFEKGLIKDIADLY 474


>gnl|CDD|153277 cd07593, BAR_MUG137_fungi, The Bin/Amphiphysin/Rvs (BAR) domain of
           Schizosaccharomyces pombe Meiotically Up-regulated Gene
           137 protein and similar proteins.  BAR domains are
           dimerization, lipid binding and curvature sensing
           modules found in many different proteins with diverse
           functions including organelle biogenesis, membrane
           trafficking or remodeling, and cell division and
           migration. This subfamily is composed predominantly of
           uncharacterized fungal proteins with similarity to
           Schizosaccharomyces pombe Meiotically Up-regulated Gene
           137 protein (MUG137), which may play a role in meiosis
           and sporulation in fission yeast. MUG137 contains an
           N-terminal BAR domain and a C-terminal SH3 domain,
           similar to endophilins. Endophilins play roles in
           synaptic vesicle formation, virus budding, mitochondrial
           morphology maintenance, receptor-mediated endocytosis
           inhibition, and endosomal sorting. BAR domains form
           dimers that bind to membranes, induce membrane bending
           and curvature, and may also be involved in
           protein-protein interactions.
          Length = 215

 Score = 27.3 bits (61), Expect = 7.3
 Identities = 14/50 (28%), Positives = 16/50 (32%), Gaps = 8/50 (16%)

Query: 130 LQSSFQSYFKDTWLK-------EAKSL-SMRAPLDLRTNTLKVNRCKLFK 171
           LQ  F     DT+L        E K   S R  L+ R         K  K
Sbjct: 90  LQEEFADRLSDTFLANIERSLAEMKEYHSARKKLESRRLAYDAALTKSQK 139


>gnl|CDD|38902 KOG3698, KOG3698, KOG3698, Hyaluronoglucosaminidase
           [Posttranslational modification, protein turnover,
           chaperones].
          Length = 891

 Score = 27.3 bits (60), Expect = 7.3
 Identities = 15/70 (21%), Positives = 25/70 (35%), Gaps = 13/70 (18%)

Query: 104 ESVIKSFHSRQLENA----PLHIQGNIPQWLQSSFQSYFKDTWLKEAKSLS-MRAPLDLR 158
           E +  S H   +E      P  I  N P W+++ F          +A     M+  + + 
Sbjct: 790 EFIQNSQHPMDIEEWYPKIPDQIFENFPAWVETYF--------GMDASDAHPMKKMIQVL 841

Query: 159 TNTLKVNRCK 168
             TL  N  +
Sbjct: 842 LVTLAANGSR 851


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.320    0.135    0.417 

Gapped
Lambda     K      H
   0.267   0.0709    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 5,390,464
Number of extensions: 283367
Number of successful extensions: 730
Number of sequences better than 10.0: 1
Number of HSP's gapped: 716
Number of HSP's successfully gapped: 25
Length of query: 429
Length of database: 6,263,737
Length adjustment: 97
Effective length of query: 332
Effective length of database: 4,167,664
Effective search space: 1383664448
Effective search space used: 1383664448
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (26.5 bits)