HHsearch alignment for GI: 254780635 and conserved domain: PRK10378

>PRK10378 hypothetical protein; Provisional.
Probab=100.00  E-value=1.9e-35  Score=231.24  Aligned_cols=242  Identities=18%  Similarity=0.268  Sum_probs=190.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH--HCCCCHHHHHHHHHCC
Q ss_conf             89999887886798899999999999999999994999889999999999999977765654--0154022100011001
Q gi|254780635|r   26 LEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY--RFGNKIVDTWDKKVNA  103 (412)
Q Consensus        26 ~~~vl~~yadiv~~~Y~d~~~~a~~L~~ai~af~a~Pt~~~L~aak~aw~~Ar~~we~~E~f--~fGpa~~~~~~~~in~  103 (412)
T Consensus       131 l~~a~~~Y~~YV~-------~q~~~L~~~t~~f~~Av~aGDl~~Ak~~y~~aR~~YERiePiae~Fg-----DlD~~ID~  198 (374)
T PRK10378        131 LGGPIAAYKAYVM-------AEVTQLVTDTKAFTDAVKAGDIEKAKALYAPTRQHYERIEPIAELFS-----DLDGSIDA  198 (374)
T ss_pred             HHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHC-----CCHHHHCC
T ss_conf             8778999999999-------99999999999999999768999999978987557788688897761-----42043224


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCHHHHHHHHHCCCCCCHHHCCHHHHHHHHCCCC
Q ss_conf             65762100011233344433333222333364334355222223203978887666416665102112789999862778
Q gi|254780635|r  104 WPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD  183 (412)
Q Consensus       104 WPl~~~~iD~v~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~d~~~it~~~l~~~~e~~~~~~~~~~GfhAiEyLLfg~~  183 (412)
T Consensus       199 R~dd----------------~e~------------------------------------g~~Dp~ftGfHRIE~~Lw~~~  226 (374)
T PRK10378        199 REDD----------------FEQ------------------------------------KAADPKFTGFHRLEKALFGDN  226 (374)
T ss_pred             CCHH----------------HCC------------------------------------CCCCCCCCHHHHHHHHHCCCC
T ss_conf             6011----------------001------------------------------------477888751589999861699


Q ss_pred             CCCCCCCCCCCCHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             77765555553034320113345404567999999999999999999952035541057762153445999999999998
Q gi|254780635|r  184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLS  263 (412)
Q Consensus       184 ~~~~~~~~~~r~~~d~~~~~~t~~~~~rr~~YL~ava~~l~~~~~~l~~~W~~~~~~~~~~~~~~~~~~~~i~~g~~~~~  263 (412)
T Consensus       227 s~----------------------------~g~~~~AdqL~~Dv~~L~~~v~~~~~~-----------P~~l~~gA~~l-  266 (374)
T PRK10378        227 TT----------------------------KGMDKYADQLYTDVVDLQKRISELAFP-----------PSKVVGGAAGL-  266 (374)
T ss_pred             CH----------------------------HHHHHHHHHHHHHHHHHHHHHHHCCCC-----------HHHHHHHHHHH-
T ss_conf             70----------------------------030689999999999999988757779-----------89986799999-


Q ss_pred             HHHHHHCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHCHHHHHHHHHHH
Q ss_conf             98764300224235788434466635272899999999999995033356665433564689999751887899999999
Q gi|254780635|r  264 YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKF  343 (412)
Q Consensus       264 ~~Ev~~~Ki~~pl~~~~pe~~Es~~S~~S~~d~~~Ni~gi~n~y~G~~~~~~g~~~~g~sl~d~l~~~~~~La~~i~~~f  343 (412)
T Consensus       267 Leeva~~kitG---------eEe~yShTDL~Df~ANveGa~~i~~~--------------lrPll~~~dp~L~~~id~~f  323 (374)
T PRK10378        267 IEEVAASKISG---------EEDRYSHTDLWDFQANVDGSQKIVDL--------------LRPLLQKANPELLAKVDANF  323 (374)
T ss_pred             HHHHHCCCCCC---------CCCCCCCCCHHHHHHHHHHHHHHHHH--------------HHHHHHHHCHHHHHHHHHHH
T ss_conf             99997065677---------43347855788888666779999998--------------76776400877899999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99999998311113114534575404998999999999999999999999998752876
Q gi|254780635|r  344 SNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI  402 (412)
Q Consensus       344 ~~a~~~l~ai~~~~~~~~~~D~~i~~~~~~~~~~v~~ai~aL~~~~~~i~~~~~~Lgl~  402 (412)
T Consensus       324 ~~v~~~L~~~~~-~dG~~~Y~~l----t~~~rk~L~~~v~aL---aE~Ls~l~~~lgl~  374 (374)
T PRK10378        324 KKVDTILAKYRT-KDGFETYDKL----TDADRNALKGPITAL---AEDLAQLRGVLGLD  374 (374)
T ss_pred             HHHHHHHHHHCC-CCCCCCHHHC----CHHHHHHHHHHHHHH---HHHHHHCCCCCCCC
T ss_conf             999999997137-9997473225----999999999999998---76777364201789