BLAST/PSIBLAST alignment of GI: 254780635 and GI: 159184243 at iteration 1
>gi|159184243|ref|NP_353318.2| hypothetical protein Atu0288 [Agrobacterium tumefaciens str. C58] Length = 425
>gi|159139571|gb|AAK86103.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] Length = 425
 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 218/402 (54%), Positives = 292/402 (72%), Gaps = 5/402 (1%)

Query: 5   TIISIVFTL--PSHALSIVPNVSLEK---VLQNYATIAHAKYEDALMCARTLDSAIETLV 59
           TI+S  F L   S A + +P  +      V+++YA +AHAKYED+L  A+ LD AI+ L+
Sbjct: 5   TILSASFVLLAASAAFTALPAQAATDAAAVIKHYADVAHAKYEDSLTTAKALDKAIDALI 64

Query: 60  TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYG 119
            TP+++ L+ AR  WI+AR+PYQQSEVYRFGN +VD W+ KVNAWPLDEG IDYVD+SYG
Sbjct: 65  ATPSEETLKAAREAWIKARVPYQQSEVYRFGNPLVDAWEGKVNAWPLDEGLIDYVDASYG 124

Query: 120 KENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
            E++EN LY ANIIAN KI ++ +E+D S I+P+L+  LH A  ++ N+TTGYH IEFLL
Sbjct: 125 TESDENELYVANIIANPKIKISGEEVDASKITPELIESLHEAGDVEANVTTGYHAIEFLL 184

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           WGQDL       GNRPYTD+D   CT G+C RR +YLK  S +LV DL+EM+ AW P+G+
Sbjct: 185 WGQDLNGTGPGAGNRPYTDYDKAKCTNGNCDRRADYLKSASSLLVKDLQEMVDAWAPEGE 244

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
           ATK +  D  AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND
Sbjct: 245 ATKTVEADPKAGLTAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLND 304

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
            IGI S+YTG+Y R++G K+ GAS+ +L+   ++ L  E+  K + T+   H ++ RA+ 
Sbjct: 305 AIGIASAYTGDYTRVDGTKMTGASLAELVGAKDKALNDEMTAKLNKTLNAMHAMEKRAQT 364

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           +E++DQMI E N EGN +V+  I+ LI QT+++ ++  ALDL
Sbjct: 365 VEAYDQMIGEGNKEGNAVVQAAIDGLIDQTKTVERVIAALDL 406