BLAST/PSIBLAST alignment of GI: 254780635 and GI: 209551882 at iteration 1
>gi|209551882|ref|YP_002283799.1| hypothetical protein Rleg2_4315 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 424
>gi|209537638|gb|ACI57573.1| conserved hypothetical protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 424
 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 208/374 (55%), Positives = 272/374 (72%), Gaps = 1/374 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  + TP+   L++AR  WI+AR+PYQQ+EVYR
Sbjct: 32  VVKHYADVAHAKYEDSLTTAKALDAAIDAFLKTPDDATLKSARDAWIKARVPYQQTEVYR 91

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD SYG EN+EN+LY AN+IAN  I ++ K++D S
Sbjct: 92  FGNPIVDDWEGKVNAWPLDEGLIDYVDPSYGTENDENSLYVANVIANKTIKIDGKDVDAS 151

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+ NCT G
Sbjct: 152 KLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDLKNCTHG 211

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM   W  DG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 212 NCDRRAEYLKSASTLLVSDLQEMTDNWKADGAATKNVEADPKAGLVAILTGMGSLSYGEL 271

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G S+HDL
Sbjct: 272 AGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSGPSLHDL 331

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  +  L  E+  K + T+   + +  R E +E +DQMI E N EGN +V+  I+ LI 
Sbjct: 332 VAAKDEALDAEMEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAAIDGLID 391

Query: 388 QTESLRKIRIALDL 401
           QT+S++++  ALDL
Sbjct: 392 QTKSVQRVIAALDL 405