BLAST/PSIBLAST alignment of GI: 254780635 and GI: 325291722 at iteration 1
>gi|325291722|ref|YP_004277586.1| iron-regulated protein [Agrobacterium sp. H13-3] Length = 425
>gi|325059575|gb|ADY63266.1| putative iron-regulated protein [Agrobacterium sp. H13-3] Length = 425
 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 214/393 (54%), Positives = 287/393 (73%), Gaps = 6/393 (1%)

Query: 10  VFT-LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLE 68
            FT LP+ A +   +V     +++YA +AHAKYED+L  A+ LD AI+ L+ TP++  L+
Sbjct: 19  TFTALPASAATDAADV-----VKHYADVAHAKYEDSLTTAKALDKAIDALIATPSEGTLK 73

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
            AR  WI+AR+PYQQSEVYRFGN +VD W+ KVNAWPLDEG IDYVD SYG E++EN LY
Sbjct: 74  AAREAWIKARVPYQQSEVYRFGNPVVDAWEGKVNAWPLDEGLIDYVDGSYGTESDENELY 133

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
            ANIIAN KI ++ +++D S I+P+L+  LH A  ++ N+TTGYH IEFLLWGQDL    
Sbjct: 134 VANIIANPKIKISGEDVDTSKITPELIESLHEAGDVEANVTTGYHAIEFLLWGQDLNGTG 193

Query: 189 REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDI 248
              GNRPYTD+D  NCT G+C RR +YLK  S +L+ DL+EM+ AW P+G+ATK +  D 
Sbjct: 194 PGAGNRPYTDYDKKNCTNGNCDRRGDYLKSASTLLIKDLQEMVDAWAPEGEATKTVEADP 253

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
            AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI S+YT
Sbjct: 254 KAGLTAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIASAYT 313

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
           GEY R++G K+ GAS+ +L+   ++ L  E+  K + T+   H ++ RA+ +E++DQMI 
Sbjct: 314 GEYTRVDGTKMTGASLSELVGAKDKALNDEMTAKLNKTLDAMHAMEKRAQTVEAYDQMIG 373

Query: 369 ENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           E N EGN +V+  I+ L+ QT+++ ++  ALDL
Sbjct: 374 EGNKEGNAVVQAAIDGLLDQTKTVERVIAALDL 406