BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780635|ref|YP_003065048.1| hypothetical protein
CLIBASIA_02610 [Candidatus Liberibacter asiaticus str. psy62]
         (412 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780635|ref|YP_003065048.1| hypothetical protein CLIBASIA_02610 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040312|gb|ACT57108.1| hypothetical protein CLIBASIA_02610 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 412

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/412 (100%), Positives = 412/412 (100%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT
Sbjct: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
           TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK
Sbjct: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
           ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW
Sbjct: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA
Sbjct: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
           TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV
Sbjct: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI
Sbjct: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP 412
           ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP
Sbjct: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP 412


>gi|315122173|ref|YP_004062662.1| hypothetical protein CKC_02115 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495575|gb|ADR52174.1| hypothetical protein CKC_02115 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 433

 Score =  635 bits (1639), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 302/405 (74%), Positives = 354/405 (87%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M+F TII+ + T PS+ LS+V +V    VL+NYATIAHAKYEDA++ ARTL+ AIETLV+
Sbjct: 27  MHFFTIITFILTFPSNVLSVVIDVDPIDVLRNYATIAHAKYEDAVISARTLNRAIETLVS 86

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
           +P++KNL+NARLQWI+ARIPYQQSE+YRFG+ IV+ WDKK+NAWP+DEG IDYVD SYGK
Sbjct: 87  SPSQKNLDNARLQWIKARIPYQQSEIYRFGSTIVNAWDKKINAWPIDEGVIDYVDISYGK 146

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
            N+EN LY ANIIAN+KI  + KEID SIISP LLRKLH  NGIDTNITTGYHVIEFLLW
Sbjct: 147 HNDENELYAANIIANTKISFDGKEIDTSIISPKLLRKLHFINGIDTNITTGYHVIEFLLW 206

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           GQDLKTNV   G RPYTDFDI  CTGG+C+RR+EYLKVVSKILVSDLEE+MK W PDG+ 
Sbjct: 207 GQDLKTNVHGSGERPYTDFDIKKCTGGNCQRRIEYLKVVSKILVSDLEELMKVWKPDGEE 266

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
           T ++MKD N GL++IITGMTSLSYNELAGERMNLGLILHDP+QE+DCFSDNTYASYLN+V
Sbjct: 267 TLNIMKDTNLGLDTIITGMTSLSYNELAGERMNLGLILHDPKQELDCFSDNTYASYLNNV 326

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           IGI+SSYTGEY R+NGE+IHG SIHDLI + N+NL+ EI +KF++TMKDF+ L +RAE+I
Sbjct: 327 IGILSSYTGEYTRINGEEIHGPSIHDLIKNKNKNLSAEIKNKFAHTMKDFYALAERAEHI 386

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           ES+DQMIS NNPEGNKIV NLI+DLITQT SL+K+RIALDL E N
Sbjct: 387 ESYDQMISANNPEGNKIVLNLIDDLITQTNSLKKLRIALDLKEIN 431


>gi|159184243|ref|NP_353318.2| hypothetical protein Atu0288 [Agrobacterium tumefaciens str. C58]
 gi|159139571|gb|AAK86103.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 425

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 218/402 (54%), Positives = 292/402 (72%), Gaps = 5/402 (1%)

Query: 5   TIISIVFTL--PSHALSIVPNVSLEK---VLQNYATIAHAKYEDALMCARTLDSAIETLV 59
           TI+S  F L   S A + +P  +      V+++YA +AHAKYED+L  A+ LD AI+ L+
Sbjct: 5   TILSASFVLLAASAAFTALPAQAATDAAAVIKHYADVAHAKYEDSLTTAKALDKAIDALI 64

Query: 60  TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYG 119
            TP+++ L+ AR  WI+AR+PYQQSEVYRFGN +VD W+ KVNAWPLDEG IDYVD+SYG
Sbjct: 65  ATPSEETLKAAREAWIKARVPYQQSEVYRFGNPLVDAWEGKVNAWPLDEGLIDYVDASYG 124

Query: 120 KENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
            E++EN LY ANIIAN KI ++ +E+D S I+P+L+  LH A  ++ N+TTGYH IEFLL
Sbjct: 125 TESDENELYVANIIANPKIKISGEEVDASKITPELIESLHEAGDVEANVTTGYHAIEFLL 184

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           WGQDL       GNRPYTD+D   CT G+C RR +YLK  S +LV DL+EM+ AW P+G+
Sbjct: 185 WGQDLNGTGPGAGNRPYTDYDKAKCTNGNCDRRADYLKSASSLLVKDLQEMVDAWAPEGE 244

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
           ATK +  D  AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND
Sbjct: 245 ATKTVEADPKAGLTAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLND 304

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
            IGI S+YTG+Y R++G K+ GAS+ +L+   ++ L  E+  K + T+   H ++ RA+ 
Sbjct: 305 AIGIASAYTGDYTRVDGTKMTGASLAELVGAKDKALNDEMTAKLNKTLNAMHAMEKRAQT 364

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           +E++DQMI E N EGN +V+  I+ LI QT+++ ++  ALDL
Sbjct: 365 VEAYDQMIGEGNKEGNAVVQAAIDGLIDQTKTVERVIAALDL 406


>gi|222147269|ref|YP_002548226.1| hypothetical protein Avi_0335 [Agrobacterium vitis S4]
 gi|221734259|gb|ACM35222.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 425

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 213/376 (56%), Positives = 284/376 (75%), Gaps = 1/376 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           VL++YA +A AKY+D+L  A+TLD+A++ L+  P+K  L  AR  WI+AR+PYQQSEVYR
Sbjct: 33  VLKHYAELAEAKYQDSLTTAKTLDAAVDALLAKPSKSTLNKARSAWIKARVPYQQSEVYR 92

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGNKIVD W+ KVNAWPLDEG IDYVD SYG E++ N LYTAN+IAN+KI +N +E+D +
Sbjct: 93  FGNKIVDDWEGKVNAWPLDEGLIDYVDKSYGTESDTNALYTANVIANTKIKINGEEVDAT 152

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++PD L  KL  A G++ N+ TGYH IEFLLWGQDL       GNRP+TD+D+ NCTGG
Sbjct: 153 NLTPDFLANKLQEAGGVEANVATGYHAIEFLLWGQDLNGTGPGAGNRPFTDYDLKNCTGG 212

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           HC RR +YLK  S +LVSDL+EM+ AW P+G+ATK L+ D  +GL +I+TGM SLSY EL
Sbjct: 213 HCDRRAQYLKSASTLLVSDLQEMVDAWKPEGEATKTLLADPTSGLKAILTGMGSLSYGEL 272

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNT+ S+  D +GI S+YTG+Y R++G K+ G S+ DL
Sbjct: 273 AGERMKLGLLLHDPEEEHDCFSDNTHNSHYYDALGIRSAYTGKYTRIDGTKMTGPSLSDL 332

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L +E+  K + TMK    L  RA+++E +DQMI+ENN +GN  V+  I+ LI 
Sbjct: 333 VAAKDKALDKEMKSKLNTTMKAMTALVKRAKSVEHYDQMIAENNKDGNATVQAGIDGLID 392

Query: 388 QTESLRKIRIALDLIE 403
           QT+S++++  ALDL E
Sbjct: 393 QTKSIQRVVAALDLGE 408


>gi|325291722|ref|YP_004277586.1| iron-regulated protein [Agrobacterium sp. H13-3]
 gi|325059575|gb|ADY63266.1| putative iron-regulated protein [Agrobacterium sp. H13-3]
          Length = 425

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 214/393 (54%), Positives = 287/393 (73%), Gaps = 6/393 (1%)

Query: 10  VFT-LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLE 68
            FT LP+ A +   +V     +++YA +AHAKYED+L  A+ LD AI+ L+ TP++  L+
Sbjct: 19  TFTALPASAATDAADV-----VKHYADVAHAKYEDSLTTAKALDKAIDALIATPSEGTLK 73

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
            AR  WI+AR+PYQQSEVYRFGN +VD W+ KVNAWPLDEG IDYVD SYG E++EN LY
Sbjct: 74  AAREAWIKARVPYQQSEVYRFGNPVVDAWEGKVNAWPLDEGLIDYVDGSYGTESDENELY 133

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
            ANIIAN KI ++ +++D S I+P+L+  LH A  ++ N+TTGYH IEFLLWGQDL    
Sbjct: 134 VANIIANPKIKISGEDVDTSKITPELIESLHEAGDVEANVTTGYHAIEFLLWGQDLNGTG 193

Query: 189 REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDI 248
              GNRPYTD+D  NCT G+C RR +YLK  S +L+ DL+EM+ AW P+G+ATK +  D 
Sbjct: 194 PGAGNRPYTDYDKKNCTNGNCDRRGDYLKSASTLLIKDLQEMVDAWAPEGEATKTVEADP 253

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
            AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI S+YT
Sbjct: 254 KAGLTAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIASAYT 313

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
           GEY R++G K+ GAS+ +L+   ++ L  E+  K + T+   H ++ RA+ +E++DQMI 
Sbjct: 314 GEYTRVDGTKMTGASLSELVGAKDKALNDEMTAKLNKTLDAMHAMEKRAQTVEAYDQMIG 373

Query: 369 ENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           E N EGN +V+  I+ L+ QT+++ ++  ALDL
Sbjct: 374 EGNKEGNAVVQAAIDGLLDQTKTVERVIAALDL 406


>gi|209551882|ref|YP_002283799.1| hypothetical protein Rleg2_4315 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537638|gb|ACI57573.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 424

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 208/374 (55%), Positives = 272/374 (72%), Gaps = 1/374 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  + TP+   L++AR  WI+AR+PYQQ+EVYR
Sbjct: 32  VVKHYADVAHAKYEDSLTTAKALDAAIDAFLKTPDDATLKSARDAWIKARVPYQQTEVYR 91

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD SYG EN+EN+LY AN+IAN  I ++ K++D S
Sbjct: 92  FGNPIVDDWEGKVNAWPLDEGLIDYVDPSYGTENDENSLYVANVIANKTIKIDGKDVDAS 151

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+ NCT G
Sbjct: 152 KLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDLKNCTHG 211

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM   W  DG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 212 NCDRRAEYLKSASTLLVSDLQEMTDNWKADGAATKNVEADPKAGLVAILTGMGSLSYGEL 271

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G S+HDL
Sbjct: 272 AGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSGPSLHDL 331

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  +  L  E+  K + T+   + +  R E +E +DQMI E N EGN +V+  I+ LI 
Sbjct: 332 VAAKDEALDAEMEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAAIDGLID 391

Query: 388 QTESLRKIRIALDL 401
           QT+S++++  ALDL
Sbjct: 392 QTKSVQRVIAALDL 405


>gi|86355961|ref|YP_467853.1| hypothetical protein RHE_CH00304 [Rhizobium etli CFN 42]
 gi|86280063|gb|ABC89126.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 424

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/374 (54%), Positives = 274/374 (73%), Gaps = 1/374 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  +  P  + L+ AR  WI+AR+PYQQ+EVYR
Sbjct: 32  VVKHYAEVAHAKYEDSLTTAKALDAAIDAFLKAPTDETLKAARDAWIKARVPYQQTEVYR 91

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD+SYG E++EN+LY AN+IA+  I ++ K++D +
Sbjct: 92  FGNPIVDDWEGKVNAWPLDEGLIDYVDASYGTESDENSLYVANVIASKTIKIDGKDVDAT 151

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+ NCT G
Sbjct: 152 KLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDLKNCTHG 211

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 212 NCDRRAEYLKSASTLLVSDLQEMTDDWKPDGAATKNVEADPKAGLVAILTGMGSLSYGEL 271

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG+Y R++G K+ G S+HDL
Sbjct: 272 AGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGDYTRVDGTKLGGPSLHDL 331

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L  E+  K + T+   + +  R E +E +DQMI+E N EGN +V+  I+ LI 
Sbjct: 332 VAAKDKALDAEMEGKLNKTLDAMNAMAKRGETVEKYDQMIAEGNKEGNAVVQAAIDGLID 391

Query: 388 QTESLRKIRIALDL 401
           QT S++++  ALDL
Sbjct: 392 QTTSIQRVIAALDL 405


>gi|116250090|ref|YP_765928.1| iron-regulated protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254738|emb|CAK05812.1| putative iron-regulated protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 424

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/374 (54%), Positives = 272/374 (72%), Gaps = 1/374 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  +  P    L+ AR  WI+AR+PYQQ+EVYR
Sbjct: 32  VVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPTDATLKAAREAWIKARVPYQQTEVYR 91

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD+SYG E++EN+LY AN+IAN  I ++ K++D S
Sbjct: 92  FGNPIVDDWEGKVNAWPLDEGLIDYVDASYGTESDENSLYVANVIANKTIKIDGKDVDAS 151

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ +   L  A GI+ N+ TGYH IEFLLWGQDL       G+RP TD+D+ NCT G
Sbjct: 152 KLTPEFISGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGDRPATDYDLKNCTHG 211

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 212 NCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGSLSYGEL 271

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G S+HDL
Sbjct: 272 AGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSGPSLHDL 331

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L  E+  K + T+   + +  R E +E +DQMI E N EGN +V+  I+ LI 
Sbjct: 332 VAAKDKALDAEVEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAAIDGLID 391

Query: 388 QTESLRKIRIALDL 401
           QT+S++++  ALDL
Sbjct: 392 QTKSVQRVIAALDL 405


>gi|241207259|ref|YP_002978355.1| hypothetical protein Rleg_4578 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861149|gb|ACS58816.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 424

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/374 (54%), Positives = 272/374 (72%), Gaps = 1/374 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  +  P    L+ AR  WI+AR+PYQQ+EVYR
Sbjct: 32  VVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPTDATLKAAREAWIKARVPYQQTEVYR 91

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD+SYG E++EN+LY AN+IAN  I ++ K++D S
Sbjct: 92  FGNPIVDDWEGKVNAWPLDEGLIDYVDASYGTESDENSLYVANVIANKTIKIDGKDVDAS 151

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       G+RP TD+D+ NCT G
Sbjct: 152 KLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGDRPATDYDLKNCTHG 211

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LV+DL+EM   W PDG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 212 NCDRRAEYLKSASTLLVTDLQEMTDNWTPDGAATKNVEADPKAGLVAILTGMGSLSYGEL 271

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G S+HDL
Sbjct: 272 AGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSGPSLHDL 331

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L  E+  K + T+   + +  R E +E +DQMI E N EGN +V+  I+ LI 
Sbjct: 332 VAAKDKALDAEVEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAAIDGLID 391

Query: 388 QTESLRKIRIALDL 401
           QT+S++++  ALDL
Sbjct: 392 QTKSVQRVIAALDL 405


>gi|190889971|ref|YP_001976513.1| hypothetical protein RHECIAT_CH0000341 [Rhizobium etli CIAT 652]
 gi|190695250|gb|ACE89335.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 424

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/374 (54%), Positives = 273/374 (72%), Gaps = 1/374 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  +  P  + L+ AR  WI+AR+PYQQ+EVYR
Sbjct: 32  VVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPTDETLKAARDAWIKARVPYQQTEVYR 91

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN +VD W+ KVNAWPLDEG IDYVD SYG E++EN+LY AN+IAN  I ++ K++D S
Sbjct: 92  FGNPVVDEWEGKVNAWPLDEGLIDYVDPSYGSESDENSLYVANVIANKTIKIDGKDVDAS 151

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+ NCT G
Sbjct: 152 KLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDLKNCTHG 211

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 212 NCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGSLSYGEL 271

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G S+HDL
Sbjct: 272 AGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSGPSLHDL 331

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L  E+  K + T+   + +  R E +E +DQMI+E N +GN +V+  I+ LI 
Sbjct: 332 VAAKDKALDAELEGKLNKTLDAMNSMAKRGETVEKYDQMIAEGNKDGNAVVQAAIDGLID 391

Query: 388 QTESLRKIRIALDL 401
           QT+S++++  ALDL
Sbjct: 392 QTKSIQRVIAALDL 405


>gi|222084586|ref|YP_002543115.1| hypothetical protein Arad_0521 [Agrobacterium radiobacter K84]
 gi|221722034|gb|ACM25190.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 425

 Score =  448 bits (1152), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 203/374 (54%), Positives = 274/374 (73%), Gaps = 1/374 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           ++++YA +AHAKYED+L+ A+ LD AI+ L+  P+ K L+ A+  WI+AR+PYQQSEVYR
Sbjct: 32  IIKHYAEVAHAKYEDSLITAKALDKAIDALLANPSDKTLKAAQAAWIKARVPYQQSEVYR 91

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVN+WPLDEG IDYVD+SYG E++EN+LY AN+IAN  I +N K++D S
Sbjct: 92  FGNPIVDDWEGKVNSWPLDEGLIDYVDASYGTESDENSLYVANVIANKTIKINGKDVDTS 151

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   LH+A G++ N+ TGYH IEFLLWGQDL       G RP TD+D+ NCT G
Sbjct: 152 HLTPEFLSGTLHQAGGVEANVATGYHAIEFLLWGQDLHGTGPGAGERPATDYDLKNCTHG 211

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM + W PDG+ATK +  D  AGL +I+TGM SLSY EL
Sbjct: 212 NCDRRAEYLKSASTLLVSDLQEMTEKWTPDGEATKHVEADPKAGLAAILTGMGSLSYGEL 271

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNTY S+ ND IGI ++Y G Y R++G+K+ G S+HDL
Sbjct: 272 AGERMKLGLLLHDPEEEHDCFSDNTYNSHNNDAIGIAAAYNGNYTRIDGKKLKGPSLHDL 331

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L +E+  K + T+     +  R E +E +DQMI E N  GN  V+  I+ L+ 
Sbjct: 332 VAAKDKALDKEVETKLNATLDAMKAMVHRGETVEKYDQMIGEGNTVGNATVQKAIDGLLD 391

Query: 388 QTESLRKIRIALDL 401
           QT+S++++  ALDL
Sbjct: 392 QTKSIQRVVAALDL 405


>gi|327192006|gb|EGE58987.1| hypothetical protein RHECNPAF_2530063 [Rhizobium etli CNPAF512]
          Length = 424

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 204/374 (54%), Positives = 272/374 (72%), Gaps = 1/374 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  +  P  + L+ AR  WI+AR+PYQQ+EVYR
Sbjct: 32  VVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPTDETLKAARDAWIKARVPYQQTEVYR 91

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN +VD W+ KVNAWPLDEG IDYVD SYG E++EN+LY AN+IAN  I ++ K++D S
Sbjct: 92  FGNPVVDEWEGKVNAWPLDEGLIDYVDPSYGSESDENSLYVANVIANKTIKIDGKDVDAS 151

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+ NCT G
Sbjct: 152 KLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDLKNCTHG 211

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 212 NCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGSLSYGEL 271

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNT  S+LND IGI ++YTG Y R++G K+ G S+HDL
Sbjct: 272 AGERMKLGLLLHDPEEEHDCFSDNTDNSHLNDAIGIAAAYTGNYTRVDGTKLSGPSLHDL 331

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L  E+  K + T+   + +  R E +E +DQMI+E N +GN +V+  I+ LI 
Sbjct: 332 VAAKDKALDAELEGKLNKTLDAMNAMAKRGETVEKYDQMIAEGNKDGNAVVQAAIDGLID 391

Query: 388 QTESLRKIRIALDL 401
           QT+S++++  ALDL
Sbjct: 392 QTKSIQRVIAALDL 405


>gi|15964075|ref|NP_384428.1| putative signal peptide protein [Sinorhizobium meliloti 1021]
 gi|307301219|ref|ZP_07580981.1| Peptidase M75, Imelysin [Sinorhizobium meliloti BL225C]
 gi|307317890|ref|ZP_07597327.1| Peptidase M75, Imelysin [Sinorhizobium meliloti AK83]
 gi|15073251|emb|CAC41759.1| Hypothetical signal peptide protein [Sinorhizobium meliloti 1021]
 gi|306896292|gb|EFN27041.1| Peptidase M75, Imelysin [Sinorhizobium meliloti AK83]
 gi|306903675|gb|EFN34262.1| Peptidase M75, Imelysin [Sinorhizobium meliloti BL225C]
          Length = 426

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 203/374 (54%), Positives = 271/374 (72%), Gaps = 1/374 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYEDAL  A  L+ A++ L+  P+++ L+ AR  W+RAR PYQ++EVYR
Sbjct: 34  VVKHYAAVAHAKYEDALATAEALEKAVDALIAGPSEETLKAAREAWLRARNPYQETEVYR 93

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD+SYG E++EN L+TAN+IAN  I V+ +++D +
Sbjct: 94  FGNTIVDEWEGKVNAWPLDEGLIDYVDASYGSESDENALFTANVIANKTIKVDGQDVDAT 153

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            I+P+LL   L  A GI+ N+ TGYH IEFLLWGQDL       GNRPYTDFD   CT G
Sbjct: 154 NITPELLSGTLQEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPYTDFDTKACTNG 213

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR  YLK  + +LVSDLEEM+  W PDG ATK +  D  AGL +I+TGM SLSY EL
Sbjct: 214 NCDRRAAYLKAATSLLVSDLEEMVANWTPDGAATKAVEADPKAGLVAILTGMGSLSYGEL 273

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNT+ S+L+D IGI S+Y+GEY R++G K+ G S+ +L
Sbjct: 274 AGERMKLGLLLHDPEEEHDCFSDNTHNSHLHDAIGIQSAYSGEYTRVDGSKLTGPSLSEL 333

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  +  L +E+ D  + T++   ++  RAE  E++DQMI E N EGN  V+  I+ LI 
Sbjct: 334 VAAKDAALDKEMKDGLATTVEKMQVMAKRAETGEAYDQMIGEGNAEGNATVQAAIDGLIA 393

Query: 388 QTESLRKIRIALDL 401
           Q +++ ++  ALDL
Sbjct: 394 QAKTVERVIAALDL 407


>gi|218673655|ref|ZP_03523324.1| putative iron-regulated protein [Rhizobium etli GR56]
          Length = 429

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 202/368 (54%), Positives = 268/368 (72%), Gaps = 1/368 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  +  P+   L+ AR  WI+AR+PYQQ+EVYR
Sbjct: 60  VVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPSDATLKAAREAWIKARVPYQQTEVYR 119

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN +VD W+ KVNAWPLDEG IDYVD SYG E++EN+LY AN+IAN  I ++ K++D S
Sbjct: 120 FGNPVVDEWEGKVNAWPLDEGLIDYVDPSYGTESDENSLYVANVIANKTIKIDGKDVDAS 179

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+ NCT G
Sbjct: 180 KLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDLKNCTHG 239

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 240 NCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGSLSYGEL 299

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G S+HDL
Sbjct: 300 AGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLTGPSLHDL 359

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L  E+  K + T+   + +  R E +E +DQMI E N EGN +V+  I+ LI 
Sbjct: 360 VAAKDKALDAEMEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAAIDGLID 419

Query: 388 QTESLRKI 395
           QT+S++++
Sbjct: 420 QTKSIQRV 427


>gi|150398713|ref|YP_001329180.1| putative iron-regulated protein [Sinorhizobium medicae WSM419]
 gi|150030228|gb|ABR62345.1| putative iron-regulated protein [Sinorhizobium medicae WSM419]
          Length = 426

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 200/403 (49%), Positives = 278/403 (68%), Gaps = 4/403 (0%)

Query: 3   FITIISIVFTLPSHALSI---VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLV 59
           FI   ++     + AL++           V+++YA +AHAKYEDAL  A  LD A++ L+
Sbjct: 5   FIRTAALALMTATSALALQPANAAPDAAAVVKHYAAVAHAKYEDALTTAEALDKAVDALI 64

Query: 60  TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYG 119
            +P+++ L+ AR  W++AR PYQ++EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG
Sbjct: 65  ASPSEETLKAAREAWLKARNPYQETEVYRFGNTIVDEWEGKVNAWPLDEGLIDYVDASYG 124

Query: 120 KENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFL 178
            E++EN L+TAN+IAN  + ++ +++D + I+P+L+   L  A GI+ N+ TGYH IEFL
Sbjct: 125 TESDENALFTANVIANKVLKIDGQDVDATSITPELISGTLQEAGGIEANVATGYHAIEFL 184

Query: 179 LWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           LWGQDL       GNR YTDFD   CT G+C RR  YLK  + +LV+DL+EM+  W PDG
Sbjct: 185 LWGQDLNGTGPGAGNRSYTDFDTEACTNGNCDRRAAYLKAATSLLVADLKEMVANWTPDG 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            ATK +  D  AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+L+
Sbjct: 245 AATKAVEADPKAGLVAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTHNSHLH 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D IGI S+Y+GEY R++G K+ G S+ +L+   +  L +E+ D    T++    +  RAE
Sbjct: 305 DAIGIQSAYSGEYTRVDGGKLTGPSLSELVGAKDAALDKEMKDNLGATVEKMQAMAKRAE 364

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            +E++DQMI E N EGN  V+  I+ LI Q +++ ++  AL+L
Sbjct: 365 TVEAYDQMIGEGNAEGNATVQAAIDGLIAQAKTVERVIAALEL 407


>gi|227824161|ref|YP_002828134.1| hypothetical protein NGR_c36600 [Sinorhizobium fredii NGR234]
 gi|227343163|gb|ACP27381.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 426

 Score =  421 bits (1082), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 193/374 (51%), Positives = 264/374 (70%), Gaps = 1/374 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYEDAL  A  LD A++ L+  P+++ L+ AR  W++AR PYQ++EVYR
Sbjct: 34  VVKHYAAVAHAKYEDALTTAEALDKAVDALIAGPSEETLKAARDAWLKARNPYQETEVYR 93

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD SYG E++EN L+TAN+IAN  I ++ K++D +
Sbjct: 94  FGNAIVDEWEGKVNAWPLDEGLIDYVDPSYGTESDENALFTANVIANKTIKIDGKDVDAT 153

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            I+P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       G R YTDFD   CT G
Sbjct: 154 NITPEFLAGTLQEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGKRTYTDFDTKACTNG 213

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR  YLK  + +LV+DL+EM+  W P+G A K +  D  AGL +I+TGM SLSY EL
Sbjct: 214 NCDRRAAYLKAATDLLVADLKEMVANWAPEGAAAKAVEADPKAGLAAILTGMGSLSYGEL 273

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DC SDNT+ S+L+D IGI S+YTGEY R++G K+ G S+ +L
Sbjct: 274 AGERMKLGLLLHDPEEEHDCSSDNTHNSHLHDAIGIQSAYTGEYTRVDGTKLAGPSLSEL 333

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  +  L +E+    + T++    +  RAE  E++DQMI+E N +GN  V+  I+ LI 
Sbjct: 334 VAAKDAALDKEMATNLATTVEKMQAMAKRAEAGEAYDQMIAEGNKDGNATVQAAIDGLIA 393

Query: 388 QTESLRKIRIALDL 401
           Q +++ ++  AL+L
Sbjct: 394 QAKTVERVIAALEL 407


>gi|311107741|ref|YP_003980594.1| imelysin [Achromobacter xylosoxidans A8]
 gi|310762430|gb|ADP17879.1| imelysin family protein 2 [Achromobacter xylosoxidans A8]
          Length = 432

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 201/391 (51%), Positives = 266/391 (68%), Gaps = 13/391 (3%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V  + V+  Y+ +A A YED+L  A+TL +AI+ L+  P+ + L+ AR  W+ AR+PYQQ
Sbjct: 23  VEPKAVVATYSDLALAGYEDSLTSAKTLRTAIDALIAKPSAETLKAAREAWLAARVPYQQ 82

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           +E YRFGN IVD W+ +VNAWPLDEG IDYVD+SYG EN+EN  Y  N+IANSKI V  K
Sbjct: 83  TEAYRFGNPIVDDWEGRVNAWPLDEGLIDYVDASYGTENDENAYYAVNVIANSKISVGGK 142

Query: 144 EIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDL------------KTNVRE 190
            +D+S I+P LL + LH A+G + N+ TGYH IEFLLWGQDL                R 
Sbjct: 143 TVDVSKITPKLLSEILHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPADRKGTPQERH 202

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
            GNRP+TDFD   CTGGHC RRVE+LK V+ +LV+DLEEM+  W  DG A K + +D  A
Sbjct: 203 AGNRPHTDFDTKQCTGGHCERRVEFLKAVTDLLVTDLEEMVGNWKKDGAARKAVEEDPKA 262

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
           GL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D IGI + Y G 
Sbjct: 263 GLIAMLTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYDQIGIRNVYLGA 322

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
           Y R++G+ + GAS+ +L+   +  L  E+  K   T+     +K RAE +E++DQMIS+ 
Sbjct: 323 YTRIDGKTVKGASLSELVKARDPKLDAEVRAKLDATVAAMQAMKTRAETVETYDQMISDG 382

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           N EGN +V+  I+ L+ QT SL ++   LDL
Sbjct: 383 NKEGNAVVQAAIDRLVDQTRSLERVIALLDL 413


>gi|260462002|ref|ZP_05810247.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032249|gb|EEW33515.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 429

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 200/398 (50%), Positives = 268/398 (67%), Gaps = 7/398 (1%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           + + VF LP+ A         + V+  Y+ IA AKYED+L  A+ LD A++ L+  P+  
Sbjct: 18  LTAAVFVLPAKA-----QTDAKAVVTTYSDIALAKYEDSLTTAQALDKAVDALLANPSAD 72

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
            L  AR  W  +R+PYQQ+EVYRFGNKIVD W+ KVN+WPLDEG IDYV  SYG E++ N
Sbjct: 73  TLNAARDAWKASRVPYQQTEVYRFGNKIVDDWEGKVNSWPLDEGLIDYVAKSYGTESDAN 132

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDL 184
           +LYTAN+IAN +I +N K++D S +SP+ L   L  A G++ N+ TGYH IEFLLWGQDL
Sbjct: 133 SLYTANVIANKEIEINGKKVDASKLSPEFLSGTLQEAGGVEANVATGYHAIEFLLWGQDL 192

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
                  G RPYTD+D+ NCTGG+C RR EYLK  S +LVSDL+EM+  W  DG A K L
Sbjct: 193 HGTGPGAGERPYTDYDLKNCTGGNCDRRAEYLKSASTLLVSDLQEMVDDWKADGAARKAL 252

Query: 245 M-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
              + N  +++I TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI
Sbjct: 253 ADGEPNTAISTIFTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGI 312

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESF 363
            ++Y   Y R++G  + G S+H+++   +  + +E++DK   T+     +K RAE  E++
Sbjct: 313 RAAYLASYTRLDGTVVSGPSVHEMVKTADPAIDKELSDKLDVTVAKMEAIKARAEAGEAY 372

Query: 364 DQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           DQ I+E N EGN  V+  I+ LI QT+S+ +   +L L
Sbjct: 373 DQQIAEGNTEGNATVQAAIDALIDQTKSIERAVGSLKL 410


>gi|163761540|ref|ZP_02168612.1| hypothetical protein HPDFL43_21352 [Hoeflea phototrophica DFL-43]
 gi|162281254|gb|EDQ31553.1| hypothetical protein HPDFL43_21352 [Hoeflea phototrophica DFL-43]
          Length = 427

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/403 (48%), Positives = 275/403 (68%), Gaps = 3/403 (0%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           Y  ++++    +   A +   +V+ E V+++YA IA AKYED+L  A  LD+AIE  + +
Sbjct: 6   YTKSLLAASTLMVGFAGTAFADVAPEAVIKHYADIAQAKYEDSLATANALDAAIEAFLAS 65

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS-SYGK 120
           P++  L+  +  W+ AR+PYQQ+EVYRFGN IVD W+ +VNAWPLDEG IDYVD+ +YG 
Sbjct: 66  PSEAGLQAVKEAWLAARVPYQQTEVYRFGNAIVDDWEGRVNAWPLDEGLIDYVDAGAYGD 125

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLL 179
           E++EN LYTAN+IAN  I +N + ID S I+P+L+ + L  A GI+ N+ +GYH IEFLL
Sbjct: 126 ESDENTLYTANVIANPSITINGETIDASKITPELISETLQEAGGIEANVASGYHAIEFLL 185

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           WGQDL  N    GNRPYTDF + NC+  HC RR +YL   S +L++DLEEM   W   G 
Sbjct: 186 WGQDLNGNDAGAGNRPYTDFSLENCSNDHCDRRRQYLSAASDLLIADLEEMAANWQEGGA 245

Query: 240 ATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
           A KDLM K ++ GL +I+TGM SLSY ELAGERM LGL+L DPE+E DCFSDNT+ S+L 
Sbjct: 246 ARKDLMDKGVSGGLVTILTGMGSLSYGELAGERMKLGLLLGDPEEEHDCFSDNTHNSHLY 305

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D +GI ++Y G Y R++G ++ G S+ +L++ +  ++  E+      T++    +  RAE
Sbjct: 306 DAVGIRNAYLGTYDRVDGTQLTGPSLSELVASSAPDVDAELKADLDATVEAMEAMASRAE 365

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
             E++DQMI+  N EGN  V+  I+DL+ QT S+ ++  ALDL
Sbjct: 366 TTEAYDQMIANGNAEGNATVQAAIDDLVKQTRSIERVIAALDL 408


>gi|254503368|ref|ZP_05115519.1| hypothetical protein SADFL11_3407 [Labrenzia alexandrii DFL-11]
 gi|222439439|gb|EEE46118.1| hypothetical protein SADFL11_3407 [Labrenzia alexandrii DFL-11]
          Length = 420

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/377 (52%), Positives = 257/377 (68%), Gaps = 2/377 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           VL  Y+ IA+AKY D+L  A+TL SAI+ L+  P   NL  AR  WI AR PYQQ+E YR
Sbjct: 27  VLGTYSDIAYAKYSDSLETAKTLQSAIDKLIAEPTDTNLAAARKAWIEARNPYQQTEAYR 86

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD SYG+++EEN  Y AN+IAN  + V  + ID S
Sbjct: 87  FGNAIVDDWEGKVNAWPLDEGLIDYVDVSYGEDSEENAFYAANVIANPSLKVGGETIDAS 146

Query: 149 IISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
           +I+P LL + L  A  ++ N+ TGYH IEFLLWGQDL       GNRP +DFD  NCTGG
Sbjct: 147 VITPALLAESLQEAGEVEANVATGYHAIEFLLWGQDLNGTDAGAGNRPASDFDTANCTGG 206

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL-MKDINAGLNSIITGMTSLSYNE 266
           +C RR +YL   + +L++DLEEM+ AW P G A ++L  K    GL +I+TGM SLSY E
Sbjct: 207 NCERRAQYLNSATDLLITDLEEMVAAWAPGGAAREELGGKGEAGGLATILTGMGSLSYGE 266

Query: 267 LAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD 326
           LAGERM LGL+LHDPE+E DCFSDNT+ S+ NDV+GI + Y GEY    G  + GAS+ +
Sbjct: 267 LAGERMKLGLMLHDPEEEHDCFSDNTHMSHYNDVVGIRNVYFGEYKSPLGNDVKGASLAE 326

Query: 327 LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLI 386
           +++  +  LA+E+  K   T+  F  +K RAE  E++DQMI E N EGN +V+  +N L+
Sbjct: 327 MVAAKDPALAEEMQAKLDATLAAFEAMKARAEAGEAYDQMIGEGNDEGNAVVQAAVNALV 386

Query: 387 TQTESLRKIRIALDLIE 403
            QT S+ ++   L+L E
Sbjct: 387 DQTTSIERVVKVLELDE 403


>gi|110633000|ref|YP_673208.1| imelysin [Mesorhizobium sp. BNC1]
 gi|110283984|gb|ABG62043.1| imelysin. Metallo peptidase. MEROPS family M75 [Chelativorans sp.
           BNC1]
          Length = 417

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 199/396 (50%), Positives = 263/396 (66%), Gaps = 1/396 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           + +  T  +  +S V       VL  YA IA A YED+L  AR+L SA+  L+ TP++  
Sbjct: 3   VPVAVTAVALGISAVHAEEPSAVLVTYADIAFAGYEDSLESARSLQSAVNALIATPSEDT 62

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  W+ AR+PYQQ+E +RFGN IVD W+ +VNAWPLDEG IDYVD+ YG E++ N 
Sbjct: 63  LVAARQAWLAARVPYQQTEAFRFGNPIVDEWEGRVNAWPLDEGLIDYVDAGYGTESDTNA 122

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
            YT N+IAN K+ V  + ID S I+P+L+R LH A GI++N+ TGYH IEFLLWGQDL  
Sbjct: 123 FYTVNVIANDKVSVGGEIIDTSQITPELIRSLHEAGGIESNVATGYHAIEFLLWGQDLNG 182

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
                G RP+TDFD  NCTGGHC RR +YL   + +LVSDL+EM+  W   G A   L +
Sbjct: 183 TGPGAGIRPHTDFDPANCTGGHCERRGQYLNAATALLVSDLQEMVSNWDAGGAARNALTQ 242

Query: 247 -DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
            D   GL +++TG+ SLSY ELAGERM LGL+L+DPE+E DCFSDNT+ S+  DV GI +
Sbjct: 243 GDPKVGLTALLTGLGSLSYGELAGERMKLGLLLNDPEEEHDCFSDNTHNSHFYDVQGIRN 302

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQ 365
            Y G Y RM GE + G+S+  L+   +  LA E+  K + T +    LK RAE++E++DQ
Sbjct: 303 VYFGRYERMGGEVVEGSSLAALVREKDAALADEMEAKLNATYEAAKNLKARAESVEAYDQ 362

Query: 366 MISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           MI E N EGN  V+ +I+ L+ QT SL ++  ALD+
Sbjct: 363 MIGEGNAEGNATVQAVIDGLVDQTRSLERVIAALDI 398


>gi|293606599|ref|ZP_06688955.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292814984|gb|EFF74109.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 432

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 198/391 (50%), Positives = 265/391 (67%), Gaps = 13/391 (3%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V    V+  Y+ +A A YED+L  A+TL +AI  LV  P+   L+ AR  W+ AR+PYQQ
Sbjct: 23  VEPRAVVATYSDLALAGYEDSLAAAKTLRTAINALVAKPSPDTLQAARQAWLAARVPYQQ 82

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           +E YRFGN IVD W+ +VNAWPLDEG IDYVD+SYG +N+EN  Y+ N+IANSKI V  K
Sbjct: 83  TEAYRFGNPIVDDWEGRVNAWPLDEGLIDYVDASYGTDNDENAYYSVNVIANSKISVGGK 142

Query: 144 EIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDL------------KTNVRE 190
            +D+S I+P LL + LH A+G + N+ TGYH IEFLLWGQDL                R 
Sbjct: 143 TVDVSKITPQLLSEVLHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPADRKGTPQERH 202

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
            GNRP+TDFD   CTGGHC RR+E+LK V+ +LV+DLEEM+  W  DG A K + +D  A
Sbjct: 203 AGNRPHTDFDTKQCTGGHCERRIEFLKAVTDLLVTDLEEMVGNWKKDGAARKAVEEDPKA 262

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
           GL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D IGI + Y G 
Sbjct: 263 GLIAMLTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYDQIGIRNVYLGT 322

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
           Y R++G+++ GAS+ +L+   +  L  E+  K   T+     +K RAE +E++DQMI++ 
Sbjct: 323 YTRIDGKQVTGASLSELVKARDPKLDAEVRAKLDATVAAMQAMKTRAETVETYDQMIADG 382

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           N EGN +V+  I+ L+ QT SL ++   L+L
Sbjct: 383 NKEGNAVVQAGIDRLVDQTRSLERVITLLEL 413


>gi|317404824|gb|EFV85200.1| exported protein [Achromobacter xylosoxidans C54]
          Length = 432

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/386 (51%), Positives = 263/386 (68%), Gaps = 13/386 (3%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+ NY+ +A A YEDAL  A+TL  AI  LV  P+   L+ AR  W+ AR+PYQQ+E +R
Sbjct: 28  VVTNYSDLALAGYEDALTSAKTLREAINALVAKPSADTLKAARQAWLDARVPYQQTEAFR 87

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ +VNAWPLDEG IDYVD+SYG EN+EN  Y  N+IANSKI V  K +D+S
Sbjct: 88  FGNPIVDDWEGRVNAWPLDEGLIDYVDASYGTENDENAYYAVNVIANSKISVGGKTVDVS 147

Query: 149 IISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP------------GNRP 195
            I+P LL + LH A+G + N+ TGYH IEFLLWGQDL      P            GNRP
Sbjct: 148 EITPKLLSEVLHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPADRKGTPQERHSGNRP 207

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI 255
           +TD+D+  CTGG+C RR+ YLK V+ +LV+DLEEM+  W  DG A K + +D  AGL ++
Sbjct: 208 HTDYDVKQCTGGNCERRIAYLKAVTDLLVTDLEEMVGNWQKDGAARKAVEEDPKAGLVAM 267

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           +TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  + IGI + Y G Y R++
Sbjct: 268 LTGVGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHFYNQIGIRNVYLGAYTRVD 327

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGN 375
           G+++ GAS+ +L+   +  L  E+  K   T+     +K RAE +E++DQMI++ N EGN
Sbjct: 328 GKQVSGASLSELVKARDPKLDAEVRAKLDATVAAMQAMKTRAETVETYDQMIADGNKEGN 387

Query: 376 KIVRNLINDLITQTESLRKIRIALDL 401
            +V+  I+ L+ QT SL ++   LDL
Sbjct: 388 AVVQAAIDRLVDQTRSLERVIALLDL 413


>gi|187479059|ref|YP_787084.1| hypothetical protein BAV2579 [Bordetella avium 197N]
 gi|115423646|emb|CAJ50191.1| putative exported protein [Bordetella avium 197N]
          Length = 430

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 198/386 (51%), Positives = 263/386 (68%), Gaps = 13/386 (3%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V++ Y+ IA A Y+DAL  A+TL  AI+ L+  P++  L+ AR  WI AR PYQQ+EV+R
Sbjct: 28  VVKTYSDIAAAGYQDALTSAKTLQQAIDALIAQPSEATLKAAREAWIVARAPYQQTEVFR 87

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN +VD W+ +VNAWPLDEG IDYVD+ YG E+++N  Y  N+IANSKI V  K ID  
Sbjct: 88  FGNPVVDDWEGRVNAWPLDEGLIDYVDAGYGTESDDNAFYAVNVIANSKISVGGKTIDAG 147

Query: 149 IISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDL------------KTNVREPGNRP 195
            ++P+LL + LH A+G + N+ TGYH IEFLLWGQDL                R  GNRP
Sbjct: 148 KLTPELLAEVLHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPKDRKGTPQERHAGNRP 207

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI 255
           +TDFD  +CTGG+C RRV YLKVV+++LV DL+EM   W  DG A K + +D  AGL ++
Sbjct: 208 HTDFDPKHCTGGNCERRVAYLKVVTQLLVDDLKEMAGQWQDDGDARKVVQEDPKAGLVAM 267

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           +TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  + IGI + Y G Y R +
Sbjct: 268 LTGMGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYNQIGIRNVYLGAYTRPD 327

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGN 375
           G+++ GAS+ DL+   +  L  E+  K + T+     ++DRAE +E++DQMI+E N EGN
Sbjct: 328 GKQVSGASLSDLVKEKDPKLDTEVRAKLNATVAAMQAMRDRAEKVETYDQMIAEGNKEGN 387

Query: 376 KIVRNLINDLITQTESLRKIRIALDL 401
            IV+  I+ LI QT S  ++   LDL
Sbjct: 388 AIVQAAIDRLIDQTRSFERVIALLDL 413


>gi|13474605|ref|NP_106174.1| hypothetical protein mlr5523 [Mesorhizobium loti MAFF303099]
 gi|14025359|dbj|BAB51960.1| mlr5523 [Mesorhizobium loti MAFF303099]
          Length = 439

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/398 (49%), Positives = 270/398 (67%), Gaps = 7/398 (1%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           + + VF LP+ A         + V++ Y+ IA AKYED+L  A+ LD A++ L+  P+ +
Sbjct: 28  LTAAVFVLPAKA-----ETDAKAVIRTYSDIALAKYEDSLTTAQALDKAVDALLAKPSAE 82

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
            L  AR  W  AR+PYQQ+EVYRFGNKIVD W+ +VN+WPLDEG IDYV  SYG E++ N
Sbjct: 83  TLNVARDAWKAARVPYQQTEVYRFGNKIVDDWEGEVNSWPLDEGLIDYVAKSYGTESDTN 142

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDL 184
           +LYTAN+IAN +I +N K++D S +SP+ L   L +A G++ N+ TGYH IEFLLWGQDL
Sbjct: 143 SLYTANVIANKEIEINGKKVDASKLSPEFLSGTLQQAGGVEANVATGYHAIEFLLWGQDL 202

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
                  G RPYTD+D+ NCTGG+C RR EYLK  + +LVSDL++M+  W  DG A K+L
Sbjct: 203 HGTGPGAGERPYTDYDLRNCTGGNCDRRAEYLKSATTLLVSDLQKMVNDWKEDGAARKNL 262

Query: 245 M-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           +  + N  ++ I TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+L D IGI
Sbjct: 263 VDGEPNTAISVIFTGMGSLSYGELAGERMKLGLMLHDPEEEQDCFSDNTYNSHLYDAIGI 322

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESF 363
            ++Y   Y R++G  + G S+HD++   +  + +E++DK   T+     +K RAE  E++
Sbjct: 323 RAAYLASYTRLDGTVVSGPSVHDMVKAADPAIDKELSDKLDVTVAKMEAIKARAEAGEAY 382

Query: 364 DQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           DQ I+E N  GN  V+  I+ LI QT+S+ +   +L L
Sbjct: 383 DQQIAEGNTAGNATVQAAIDALIDQTKSIERAVGSLKL 420


>gi|254475879|ref|ZP_05089265.1| insulin-cleaving metalloproteinase outer membrane protein [Ruegeria
           sp. R11]
 gi|214030122|gb|EEB70957.1| insulin-cleaving metalloproteinase outer membrane protein [Ruegeria
           sp. R11]
          Length = 422

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/370 (52%), Positives = 254/370 (68%), Gaps = 2/370 (0%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +VL  YA IA AKYED+L+ A+TL SA++ L+  P+ + LE AR  W+ AR+PYQQSEV+
Sbjct: 28  EVLTTYANIAQAKYEDSLITAKTLQSAVDALIAAPSAEALEAARKAWLAARVPYQQSEVF 87

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN L   N+IAN +  ++ K ID 
Sbjct: 88  RFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDENTLAALNVIANPQFELSGKAIDA 147

Query: 148 SIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCT 205
           S I+P LL   LH A+G++ N+ TGYH IEFLLWGQDL       G+RP+TDF  G  CT
Sbjct: 148 SAITPALLENTLHEADGVEANVATGYHAIEFLLWGQDLNGTDHGAGDRPWTDFAAGETCT 207

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYN 265
           GGHC RR EYLK  + +LVSDLE M   WG  G+A   LM D +AG+ +++TGM SLSY 
Sbjct: 208 GGHCDRRGEYLKAATDLLVSDLEWMAAQWGDAGEARSTLMADEDAGITAMLTGMGSLSYG 267

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G+ + Y GEY+R+NGE + GAS+ 
Sbjct: 268 EQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGVQNVYLGEYVRVNGELVSGASLS 327

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           DL++  +  L  E+  K + TM+    +K  AE   S+DQM+   N  G  +V   +N L
Sbjct: 328 DLVAEQDSALDSELRGKLAQTMQALGRIKTAAEAGFSYDQMLEAGNEAGEALVMGGVNGL 387

Query: 386 ITQTESLRKI 395
           I QT S+ ++
Sbjct: 388 IDQTRSIERV 397


>gi|328542028|ref|YP_004302137.1| Insulin-cleaving metalloproteinase outer membrane protein
           [polymorphum gilvum SL003B-26A1]
 gi|326411778|gb|ADZ68841.1| Insulin-cleaving metalloproteinase outer membrane protein
           [Polymorphum gilvum SL003B-26A1]
          Length = 439

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 200/399 (50%), Positives = 265/399 (66%), Gaps = 4/399 (1%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           T I     +   AL+  P  +   VL  Y  +A A YED+L  AR L +A+E LV +P+ 
Sbjct: 24  TAIVAGAVVTGSALADAPKPA--DVLATYGDVAQAGYEDSLATARALKAAVEALVASPSD 81

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
             L  AR  W+ AR+PYQQ+E +RFGN IVD W+ KVNAWPLDEG IDYVD++YG  +EE
Sbjct: 82  DTLAAARQAWLAARVPYQQTEAFRFGNAIVDDWEGKVNAWPLDEGLIDYVDTAYGDSSEE 141

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQD 183
           N  Y AN+IAN K+ V  +EID S I+P LL + L  A  I+ N+ TGYH IEFLLWGQD
Sbjct: 142 NPFYAANVIANPKLTVAGEEIDASEITPALLSETLQEAGEIEANVATGYHAIEFLLWGQD 201

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
           L       G RP +D+D  NCTGG+C RR+ YL+ V+ +L++DLEEM  AW P G A  +
Sbjct: 202 LNGTDAGAGARPASDYDTANCTGGNCDRRIAYLRAVTDLLIADLEEMAVAWAPGGAARAE 261

Query: 244 LM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
           L  K    GL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  DV+G
Sbjct: 262 LAAKGEGGGLATILTGMGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHLSHYYDVVG 321

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           I + Y GEY R++G K+ GAS+ D+++  +  LA+E+  +   T+  F  LK RAE +E+
Sbjct: 322 IRNVYFGEYARVDGSKVEGASLADMVAARDPALAEEMKARLDATLAAFEALKTRAETVEA 381

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           +DQMI E N EGN +V+  ++ L+ QT S+ ++   L L
Sbjct: 382 YDQMIGEGNAEGNAVVQAAVDALVDQTRSIERVVAVLGL 420


>gi|254470644|ref|ZP_05084047.1| insulin-cleaving metalloproteinase outer membrane protein
           [Pseudovibrio sp. JE062]
 gi|211959786|gb|EEA94983.1| insulin-cleaving metalloproteinase outer membrane protein
           [Pseudovibrio sp. JE062]
          Length = 422

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/389 (51%), Positives = 271/389 (69%), Gaps = 7/389 (1%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           +L + A++  P+     VL  Y  IA A +ED+L  A+TL  AI+ LV  P + NL+ AR
Sbjct: 16  SLSTVAVAATPS----DVLATYGDIAQAAFEDSLTTAKTLQVAIDKLVAEPTEDNLKAAR 71

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             WI AR PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD +YG E+EEN  Y AN
Sbjct: 72  RAWIAARNPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDGAYGNESEENPYYAAN 131

Query: 132 IIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
           IIAN+K+ V  +EID + I+P LL  +L  A  ++ N+ TGYH IEFLLWGQDL    + 
Sbjct: 132 IIANAKVTVAGEEIDATEITPALLADQLQEAGEVEANVATGYHAIEFLLWGQDLNGTGKG 191

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM-KDIN 249
            GNRP +DFD  NCTGG+C RRV+YL+  + +L++DLEEM+ AW  DG A KDL  K   
Sbjct: 192 AGNRPASDFDTANCTGGNCERRVQYLQAATTLLITDLEEMVAAWQADGAARKDLADKGEA 251

Query: 250 AGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTG 309
           AG+ +I+TGM SLSY ELAGERM LGL+L+DPE+E DCFSDNT+ S+ NDV+GI + + G
Sbjct: 252 AGIATILTGMGSLSYGELAGERMKLGLMLNDPEEEHDCFSDNTHMSHYNDVVGINNVFQG 311

Query: 310 EYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISE 369
           +Y R++G  + GAS+ DL++  +  ++ E+  K + ++  F  LK RAE  E++DQMI E
Sbjct: 312 KYTRVDGTVVEGASLKDLLAKADSAVSAELEGKLNASLGAFTALKTRAETTEAYDQMIGE 371

Query: 370 NNPEGNKIVRNLINDLITQTESL-RKIRI 397
            N EGN +V+  ++ L+ QT S+ R +++
Sbjct: 372 GNTEGNAVVQAAVDSLVDQTSSIERAVKV 400


>gi|319779791|ref|YP_004139267.1| peptidase M75, Imelysin [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317165679|gb|ADV09217.1| Peptidase M75, Imelysin [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 429

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/398 (49%), Positives = 269/398 (67%), Gaps = 7/398 (1%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           + + VF LP+ A        ++ V++ Y+ IA AKYED+L  A+ LD A++ L+ TP+ +
Sbjct: 18  LTAAVFVLPAKA-----ETDVKAVIKTYSDIALAKYEDSLTTAQALDKAVDALLATPSVE 72

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
            L  AR  W  +R+PYQQ+EVYRFGNKIVD W+ KVN+WPLDEG IDYV  SYG E++ N
Sbjct: 73  TLNAARDAWKASRVPYQQTEVYRFGNKIVDDWEGKVNSWPLDEGLIDYVAKSYGTESDAN 132

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDL 184
            LYTAN+IAN +I +N K++D S +SP+ L   L  A GI+ N+ TGYH IEFLLWGQDL
Sbjct: 133 ALYTANVIANKEIEINGKKVDASKLSPEFLSGTLQGAGGIEANVATGYHAIEFLLWGQDL 192

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
                  G RPYTD+D+ NCTGG+C RR EYLK  S +LVSDL+EM+  W  DG A K L
Sbjct: 193 HGTGPGAGERPYTDYDLKNCTGGNCDRRAEYLKSASDLLVSDLQEMVGNWKEDGAARKAL 252

Query: 245 M-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           +  + +  +++I TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+L D IGI
Sbjct: 253 VDGEPSTAISTIFTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLYDAIGI 312

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESF 363
            ++Y   Y R++G  + G S+ D++   +  + +E++DK   ++     +K RA   E++
Sbjct: 313 RAAYHASYTRLDGTIVSGPSVADMVKAADPAIDKELSDKLDVSVAKMEAIKARALAGEAY 372

Query: 364 DQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           DQ I+E N EGN  V+  I+ LI QT+S+ +   +L L
Sbjct: 373 DQQIAEGNIEGNATVQAAIDALIDQTKSIERAVGSLKL 410


>gi|33596872|ref|NP_884515.1| hypothetical protein BPP2269 [Bordetella parapertussis 12822]
 gi|33573573|emb|CAE37567.1| putative exported protein [Bordetella parapertussis]
          Length = 434

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/411 (47%), Positives = 273/411 (66%), Gaps = 17/411 (4%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++  T P    +  P      V+Q Y+ IA A Y+DAL  A+ L +AI+ L+  P+
Sbjct: 9   VLALALGMTTPLAVAAAQPKA----VVQTYSDIALAGYQDALASAQALRTAIDALIAAPS 64

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
            + L+ AR  W+ AR+PYQQ+E +RFGN +VD W+ +VNAWPLDEG IDYVD++YG E++
Sbjct: 65  AQTLQAARQAWLAARVPYQQTEAFRFGNPVVDDWEGRVNAWPLDEGLIDYVDAAYGTESD 124

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
            N  YT N+IAN++I V  K ID S I+P LL + LH A+G + N+ TGYH IEFLLWGQ
Sbjct: 125 ANAFYTVNVIANARISVGGKTIDASKITPQLLSEVLHEADGNEANVATGYHAIEFLLWGQ 184

Query: 183 DL---------KTNV---REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEM 230
           DL         +T     R  G+RP+TDFD   CTGG+C RRV+YLK V+ +LV DL+EM
Sbjct: 185 DLNGTGPAPKDRTGTPQERHAGDRPHTDFDPRQCTGGNCERRVQYLKAVTDLLVDDLQEM 244

Query: 231 MKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSD 290
           +  W   G A K + +D  AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSD
Sbjct: 245 VDNWKAGGAARKVVEEDPKAGLIAMMTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSD 304

Query: 291 NTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDF 350
           NT+ S+  + IGI + Y G Y R++G+ + GAS+ DL+   +  L  E+  K   T++  
Sbjct: 305 NTHNSHYYNQIGIRNVYLGNYARIDGKTVSGASLSDLVKAKDAKLDAEVRAKLDATVQAM 364

Query: 351 HILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
             +K RAE +E++DQMI++ N EGN +V+  I+ L+ QT SL ++  AL+L
Sbjct: 365 EAMKQRAETVETYDQMIAQGNKEGNAVVQAAIDRLVDQTRSLERVIAALEL 415


>gi|33600706|ref|NP_888266.1| hypothetical protein BB1721 [Bordetella bronchiseptica RB50]
 gi|33568306|emb|CAE32218.1| putative exported protein [Bordetella bronchiseptica RB50]
          Length = 434

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/394 (48%), Positives = 267/394 (67%), Gaps = 13/394 (3%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V     + V+Q Y+ IA A Y+DAL  A+ L +AI+ L+  P+ + L+ AR  W+ AR+P
Sbjct: 22  VAAAQPKAVVQTYSDIALAGYQDALASAQALRTAIDALIAAPSAQTLQAARQAWLAARVP 81

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           YQQ+E +RFGN +VD W+ +VNAWPLDEG IDYVD++YG E++ N  YT N+IAN++I V
Sbjct: 82  YQQTEAFRFGNPVVDDWEGRVNAWPLDEGLIDYVDAAYGTESDANAFYTVNVIANARISV 141

Query: 141 NEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDL---------KTNV-- 188
             K ID S I+P LL + LH A+G + N+ TGYH IEFLLWGQDL         +T    
Sbjct: 142 GGKTIDASKITPQLLSEVLHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPKDRTGTPQ 201

Query: 189 -REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKD 247
            R  G+RP+TDFD   CTGG+C RRV+YLK V+ +LV DL+EM+  W   G A K + +D
Sbjct: 202 ERHAGDRPHTDFDPRQCTGGNCERRVQYLKAVTDLLVDDLQEMVDNWKAGGAARKVVEED 261

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSY 307
             AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  + IGI + Y
Sbjct: 262 PKAGLIAMMTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYNQIGIRNVY 321

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI 367
            G Y R++G+ + GAS+ DL+   +  L  E+  K   T++    +K RAE +E++DQMI
Sbjct: 322 LGNYARIDGKTVSGASLSDLVKAKDAKLDAEVRAKLDATVQAMEAMKQRAETVETYDQMI 381

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           ++ N EGN +V+  I+ L+ QT SL ++  AL+L
Sbjct: 382 AQGNKEGNAVVQAAIDRLVDQTRSLERVIAALEL 415


>gi|163857778|ref|YP_001632076.1| hypothetical protein Bpet3465 [Bordetella petrii DSM 12804]
 gi|163261506|emb|CAP43808.1| putative exported protein [Bordetella petrii]
          Length = 432

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/390 (50%), Positives = 266/390 (68%), Gaps = 13/390 (3%)

Query: 27  EKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEV 86
           + V+Q YA IA A YED+L  A+ L +A+E L+  P+ + L+ AR  W+ AR+PYQQ+E 
Sbjct: 26  KAVVQTYADIALAGYEDSLASAQALRAAVEALIEQPSAQTLQAARAAWLAARVPYQQTEA 85

Query: 87  YRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEID 146
           +RFGN +VD W+  VNAWPLDEG IDYVD+SYG E+++N  Y  N+IANSKI V  K ID
Sbjct: 86  FRFGNPVVDDWEGSVNAWPLDEGLIDYVDASYGTESDQNAFYAVNVIANSKISVGGKTID 145

Query: 147 LSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP------------GN 193
            + I+P+LL + LH A+G + N+ TGYH IEFLLWGQDL  +   P            GN
Sbjct: 146 ATTITPELLAETLHEADGNEANVATGYHAIEFLLWGQDLNGSGPAPADRQGTPQERHAGN 205

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
           RP+TDFD   CTGGHC RRV+YL+ V+ +LV+DLE M+  W  DGQA K + +D  AGL 
Sbjct: 206 RPHTDFDPAQCTGGHCERRVQYLRAVTDLLVADLETMVANWKADGQARKAVEQDPKAGLV 265

Query: 254 SIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR 313
           +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  + IGI + Y G Y R
Sbjct: 266 AMLTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHFYNQIGIRNVYLGSYAR 325

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPE 373
           +NG+ + GAS+ DL+   +  L  E+  K   T+     ++DRA+ +E++DQMI+  N E
Sbjct: 326 INGKTVAGASVSDLVKARDPKLDAEMRAKLDATVAAMQAMRDRADKVETYDQMIASGNAE 385

Query: 374 GNKIVRNLINDLITQTESLRKIRIALDLIE 403
           GN +V+  I+ L+ QT SL ++   L+L E
Sbjct: 386 GNAVVQAAIDRLVDQTRSLERVIAVLELGE 415


>gi|33592652|ref|NP_880296.1| hypothetical protein BP1561 [Bordetella pertussis Tohama I]
 gi|33572298|emb|CAE41851.1| putative exported protein [Bordetella pertussis Tohama I]
 gi|332382069|gb|AEE66916.1| hypothetical protein BPTD_1544 [Bordetella pertussis CS]
          Length = 436

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/394 (48%), Positives = 267/394 (67%), Gaps = 13/394 (3%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V     + V+Q Y+ IA A Y+DAL  A+ L +AI+ L+  P+ + L+ AR  W+ AR+P
Sbjct: 24  VAAAQPKAVVQTYSDIALAGYQDALASAQALRTAIDALIAAPSAQTLQAARQAWLAARVP 83

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           YQQ+E +RFGN +VD W+ +VNAWPLDEG IDYVD++YG E++ N  YT N+IAN++I V
Sbjct: 84  YQQTEAFRFGNPVVDDWEGRVNAWPLDEGLIDYVDAAYGTESDANAFYTVNVIANARISV 143

Query: 141 NEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDL---------KTNV-- 188
             K ID S I+P LL + LH A+G + N+ TGYH IEFLLWGQDL         +T    
Sbjct: 144 GGKTIDASKITPQLLSEVLHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPKDRTGTPQ 203

Query: 189 -REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKD 247
            R  G+RP+TDFD   CTGG+C RRV+YLK V+ +LV DL+EM+  W   G A K + +D
Sbjct: 204 ERHAGDRPHTDFDPRQCTGGNCERRVQYLKAVTDLLVDDLQEMVDNWKAGGAARKVVEED 263

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSY 307
             AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  + IGI + Y
Sbjct: 264 PKAGLIAMMTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYNQIGIRNVY 323

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI 367
            G Y R++G+ + GAS+ DL+   +  L  E+  K   T++    +K RAE +E++DQMI
Sbjct: 324 LGNYARIDGKTVSGASLSDLVKARDAKLDAEVRAKLDATVQAMEAMKQRAETVETYDQMI 383

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           ++ N EGN +V+  I+ L+ QT SL ++  AL+L
Sbjct: 384 AQGNKEGNAVVQVAIDRLVDQTRSLERVIAALEL 417


>gi|307943588|ref|ZP_07658932.1| imelysin [Roseibium sp. TrichSKD4]
 gi|307773218|gb|EFO32435.1| imelysin [Roseibium sp. TrichSKD4]
          Length = 421

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/379 (51%), Positives = 250/379 (65%), Gaps = 2/379 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
           S ++VL  Y  IA A Y D+L  A+ L SAI+TL+  P + NL  AR  W+ AR PYQQ+
Sbjct: 24  SPKEVLGTYGDIAQAGYADSLESAKLLQSAIDTLIAEPTEANLATARSAWVAARNPYQQT 83

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EVYRFGN IVD W+ +VNAWPLDEG IDYVD+SYG E EEN+ Y AN+IAN  + V  + 
Sbjct: 84  EVYRFGNAIVDNWEGRVNAWPLDEGLIDYVDASYGTEAEENDFYVANVIANPTLKVGGET 143

Query: 145 IDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           ID ++I+  LL+  L  A  ++ N+ TGYH IEFLLWGQDL       GNRP TDFD  N
Sbjct: 144 IDATVINASLLQDTLQEAGEVEANVATGYHAIEFLLWGQDLNGTGPGAGNRPTTDFDTAN 203

Query: 204 CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL-MKDINAGLNSIITGMTSL 262
           CTGG+C RR +YLK  + +L+SDLEEM+ AW P G A +DL  K    GL +I+TGM SL
Sbjct: 204 CTGGNCERRSQYLKAATDLLISDLEEMVAAWAPGGAAREDLGSKGDTGGLATILTGMGSL 263

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           SY ELAGERM LGL+LHDPE+E DCFSDNT+ S+ NDV+GI + Y G Y    G  + GA
Sbjct: 264 SYGELAGERMKLGLMLHDPEEEHDCFSDNTHMSHYNDVVGIRNVYFGTYKSDFGRDVSGA 323

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+  ++   +  LA E+  K   T+  F  +  R    E++DQ+I E N EGN +V+  I
Sbjct: 324 SLAHMVEDKDPALAAEMKTKLDATLAAFEAVNARVAQGEAYDQLIGEGNAEGNALVQAAI 383

Query: 383 NDLITQTESLRKIRIALDL 401
           + L+ QT S+ ++   L L
Sbjct: 384 DALVDQTTSIERVVKVLGL 402


>gi|163738590|ref|ZP_02146004.1| lipoprotein, putative [Phaeobacter gallaeciensis BS107]
 gi|163743022|ref|ZP_02150405.1| lipoprotein, putative [Phaeobacter gallaeciensis 2.10]
 gi|161383705|gb|EDQ08091.1| lipoprotein, putative [Phaeobacter gallaeciensis 2.10]
 gi|161387918|gb|EDQ12273.1| lipoprotein, putative [Phaeobacter gallaeciensis BS107]
          Length = 422

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/376 (50%), Positives = 256/376 (68%), Gaps = 2/376 (0%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +VL  YA IAHAKY+D+L  A+TL +A+++L+  P+ + LE AR  W+ AR+PYQQSEV+
Sbjct: 28  EVLTTYANIAHAKYQDSLETAKTLQTAVDSLIAEPSAEALEAARKAWLAARVPYQQSEVF 87

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   +EN L   NI+AN    ++ K ID 
Sbjct: 88  RFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPTDENTLAALNIVANPSFELSGKSIDA 147

Query: 148 SIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCT 205
           S I+P+LL   LH A+G++ N+ TGYH IEFLLWGQDL       G+R +TD+  G +CT
Sbjct: 148 SAITPELLETTLHEADGVEANVATGYHAIEFLLWGQDLNGTDHGAGSRAWTDYAAGEDCT 207

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYN 265
            G+C RR EYLK  + +L+SDLE M   WG +G+A   L+ D NAG+ +++TGM SLSY 
Sbjct: 208 NGNCDRRGEYLKAATDLLISDLEWMAAQWGTEGEARGTLLSDENAGITAMLTGMGSLSYG 267

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G+ + Y GEYIR +G  + GAS+ 
Sbjct: 268 ETAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGVQNVYLGEYIRTDGSMVSGASLS 327

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           DL+   +  L  E+  K S TM+    +K  AE   S+DQM+ + N  G  +V   +N L
Sbjct: 328 DLVQEIDPALDGEMRSKLSTTMRALGQIKTAAEAGFSYDQMLEQGNEAGEALVMGGVNGL 387

Query: 386 ITQTESLRKIRIALDL 401
           + QT S+ ++  ALDL
Sbjct: 388 VDQTRSIERVVTALDL 403


>gi|118592450|ref|ZP_01549842.1| hypothetical protein SIAM614_26521 [Stappia aggregata IAM 12614]
 gi|118435108|gb|EAV41757.1| hypothetical protein SIAM614_26521 [Stappia aggregata IAM 12614]
          Length = 420

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/396 (51%), Positives = 264/396 (66%), Gaps = 8/396 (2%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           S +F  P  AL+  P+     +L  Y  IA AKY D+L  A+TL +AI+ LV  P + NL
Sbjct: 12  SALFVTP--ALAAAPS----DILSTYGDIAQAKYADSLATAKTLKTAIDKLVAEPTEANL 65

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           E AR  W  AR PYQQ+E YRFGN IVD W+ KVNAWPLDEG IDYVD+SYG E+EEN+ 
Sbjct: 66  EAARTAWKDARDPYQQTEAYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGDESEENDF 125

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
           Y AN+IAN  + V  + ID + I+P LL   L  A  ++TN+ TGYH IEFLLWGQDL  
Sbjct: 126 YVANVIANPSLKVGGETIDATEITPALLADTLQEAGEVETNVATGYHAIEFLLWGQDLNG 185

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM- 245
                G RP TDFD  NCTGG+C RR++YL+  + +L+SDLEEM  AW PDG A ++L  
Sbjct: 186 TDAGAGKRPATDFDPANCTGGNCERRIQYLQAATDLLISDLEEMAAAWAPDGAAREELAS 245

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
           K    GL +I+TGM SLSY ELAGER+ LGL+LHDPE+E DCFSDNT+ S+ NDV+GI +
Sbjct: 246 KGEAGGLATILTGMGSLSYGELAGERIKLGLMLHDPEEEHDCFSDNTHMSHYNDVVGIRN 305

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQ 365
            Y G Y    G  + GAS+ +L++  +  LA+E+  K   T+  F  +K RAE  E++DQ
Sbjct: 306 VYFGSYKSPVGNDVSGASLAELVAEKDPALAEEMKTKLDATLAAFEAMKARAEAGEAYDQ 365

Query: 366 MISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           MI E N EGN +V+  ++ L+ QT S+ ++   L+L
Sbjct: 366 MIGEGNEEGNAVVQAAVDALVDQTASIERVVKVLEL 401


>gi|114706077|ref|ZP_01438980.1| hypothetical protein FP2506_16464 [Fulvimarina pelagi HTCC2506]
 gi|114538923|gb|EAU42044.1| hypothetical protein FP2506_16464 [Fulvimarina pelagi HTCC2506]
          Length = 425

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/397 (47%), Positives = 268/397 (67%), Gaps = 6/397 (1%)

Query: 9   IVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLE 68
           + F+ P+    +  +VS E +L+NYA IA A Y DAL  A+TLD+A + L+  P+++ L 
Sbjct: 16  LAFSTPA----LAQDVSKEAILKNYADIALAAYTDALETAKTLDAATDELIAKPSEETLT 71

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
            AR  W  +R  YQQ+EVYRFGN IVD W+ +VNAWPLDEG IDYVDSSYG  ++ N LY
Sbjct: 72  AARKAWKESRPSYQQTEVYRFGNPIVDAWEGRVNAWPLDEGLIDYVDSSYGTGSDSNQLY 131

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
           TAN+IA  ++ +  + +D+S I+P L++ +L  A G++ N+ TGYH +EFLLWGQDL   
Sbjct: 132 TANVIAADEVTIGGETVDVSTITPALIQDQLQEAGGVEANVATGYHAVEFLLWGQDLNGT 191

Query: 188 VREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
               G RP TDF  G+ CT G C +R EYL   + +LVSDLEEM+  W   G+A   LM+
Sbjct: 192 EAGAGERPATDFASGDECTNGSCDKRGEYLDAATDLLVSDLEEMVANWEDGGEARAALME 251

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
           D N GLN ++TGM SLSY E+AGERM LGL+LHDPE+E DCFSDNT+ S+L DV+GI + 
Sbjct: 252 DENQGLNMMLTGMGSLSYGEMAGERMKLGLLLHDPEEEHDCFSDNTHVSHLYDVVGIENV 311

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
           Y G Y +++G  + G ++ DL++  N  L +E+    + T++    + D AE+ E++DQ 
Sbjct: 312 YLGRYEKVDGSTVEGPALADLVAAENAELEEEMKADLTATLEAMRAISDAAESGEAYDQQ 371

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           I+E N EGN+ V+  ++ LI QT ++ ++  ALD+ E
Sbjct: 372 IAEGNSEGNERVQAAVDALIAQTRTIERVIAALDIGE 408


>gi|86136374|ref|ZP_01054953.1| lipoprotein, putative [Roseobacter sp. MED193]
 gi|85827248|gb|EAQ47444.1| lipoprotein, putative [Roseobacter sp. MED193]
          Length = 422

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/394 (49%), Positives = 258/394 (65%), Gaps = 4/394 (1%)

Query: 12  TLPSHALSIVPNVSLEK--VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
            L   AL   P ++ EK  VL NYA IA AKY+D+L  A TL  A++ L+ TP+ + L  
Sbjct: 10  ALAGLALCATPGLATEKAEVLANYANIAQAKYQDSLATAHTLQLAVDALIATPSAEALTA 69

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           AR  W+ AR+PYQQSEV+RFGN IVD W+ KVNAWPLDEG IDYVD++YG  ++EN L  
Sbjct: 70  ARQAWLAARVPYQQSEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDATYGGPSDENALAA 129

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
            N+IAN    ++ K ID S I+P LL + LH A+G++ N+ TGYH IEFLLWGQDL    
Sbjct: 130 LNVIANPTFDLSGKAIDTSAITPALLSETLHEADGVEANVATGYHAIEFLLWGQDLNGTD 189

Query: 189 REPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKD 247
              GNR +TD+  G NCT GHC RR +YLK  + +LVSDLE M   W   G A   L+ D
Sbjct: 190 HGAGNRSWTDYASGDNCTNGHCDRRGDYLKAATALLVSDLEWMAAQWDEAGDARISLLAD 249

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSY 307
             AG+++++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G+ + Y
Sbjct: 250 EGAGISAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGVQNIY 309

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI 367
            GEYIR+NGE I G S+ DL+   +  L  E+  K + TM+    +K  AE   S+DQM+
Sbjct: 310 LGEYIRVNGEMISGPSLSDLVVAADPALDSEMRMKLATTMRALGRIKSTAEAGLSYDQML 369

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           ++ N  G  ++   +N L+ QT S+ ++   L L
Sbjct: 370 AQGNTAGEALIMGGVNGLVDQTRSIERVVTLLSL 403


>gi|126738822|ref|ZP_01754518.1| lipoprotein, putative [Roseobacter sp. SK209-2-6]
 gi|126720003|gb|EBA16710.1| lipoprotein, putative [Roseobacter sp. SK209-2-6]
          Length = 422

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/387 (49%), Positives = 263/387 (67%), Gaps = 4/387 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   S   +L NYA IA AKY+D+L  A+ L SA+E L+ +P+ + LE AR  WI +R+P
Sbjct: 21  VLAASKADILTNYANIAEAKYQDSLHTAKQLQSAVEALIASPSAEALEAARAAWIASRVP 80

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           YQQSEV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN L   N+IAN    +
Sbjct: 81  YQQSEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDENALAALNVIANPSFDL 140

Query: 141 NEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
           + K ID S I+P+LL   LH A+GI+ N+ TGYH IEFLLWGQDLK      G+RP+TD+
Sbjct: 141 SGKSIDTSKITPELLSDTLHEADGIEANVATGYHAIEFLLWGQDLKGTEHGAGDRPWTDY 200

Query: 200 DIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITG 258
             G +CTGGHC RR EYLK  + +LVSDLE M   W   G+A   L+ D + G+++++TG
Sbjct: 201 ASGEDCTGGHCDRRGEYLKAATDLLVSDLEWMAAQWSASGEARGTLLGDEDVGISAMLTG 260

Query: 259 MTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEK 318
           M SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G+ + Y GEY+R++GE 
Sbjct: 261 MGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGVQNVYLGEYVRVSGEL 320

Query: 319 IHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIV 378
           + G S+ DL+S ++ +L  E+  K + TM+    +K  AE   S+DQM+   N  G  ++
Sbjct: 321 VSGPSLSDLVSASDSSLDSEMRSKLATTMQALGRIKLTAEAGTSYDQMLEAGNSAGEALI 380

Query: 379 RNLINDLITQTESLRKI--RIALDLIE 403
              +N L+ QT S+ ++   ++LD +E
Sbjct: 381 MGGVNGLVDQTRSIERVVKLLSLDGLE 407


>gi|114766834|ref|ZP_01445761.1| lipoprotein, putative [Pelagibaca bermudensis HTCC2601]
 gi|114540955|gb|EAU44014.1| lipoprotein, putative [Roseovarius sp. HTCC2601]
          Length = 419

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/375 (49%), Positives = 253/375 (67%), Gaps = 2/375 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           VL  YA IAHA YED+L+ A+ L  A++ L+  P+++ L  AR  W+ +R PYQQ+EVYR
Sbjct: 26  VLDTYADIAHAGYEDSLITAQALQEAVDALIAEPSEETLTAAREAWLASRNPYQQTEVYR 85

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD SYG   +EN     NIIAN  + +  +E+D S
Sbjct: 86  FGNAIVDDWEGKVNAWPLDEGLIDYVDDSYGGATDENEYAALNIIANPSVTLAGQEVDAS 145

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CTG 206
            I+P L+   L+ A+GI+TN+  GYH IEFLLWGQDL       G RPYTD+  G  CTG
Sbjct: 146 EITPTLIADTLNEADGIETNVARGYHAIEFLLWGQDLNGTEPGAGERPYTDYVTGEECTG 205

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNE 266
           G+C RR +YLK  + +LVSDLEEM+ AWG  G+A + +M+D NAG+ +++TGM SLSY E
Sbjct: 206 GNCDRRADYLKAATDLLVSDLEEMVAAWGEGGEARETVMEDENAGIVAMLTGMGSLSYGE 265

Query: 267 LAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD 326
            AGERM LGL+L+DPE+E DCFSDNT+ S+  D  GI + Y G Y R++G  + GAS+ D
Sbjct: 266 QAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGKGIQNVYLGSYTRVDGSTVEGASLSD 325

Query: 327 LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLI 386
           L++  +  L +E+  K   TM     +K+ AE   ++DQM++  + +G +++   +N LI
Sbjct: 326 LVAETDAALDEEMKAKLDTTMAALGAIKEAAEGGFAYDQMLALGDEKGEELIMGGVNGLI 385

Query: 387 TQTESLRKIRIALDL 401
            QT S+ ++   LDL
Sbjct: 386 DQTRSIERVVSTLDL 400


>gi|254466477|ref|ZP_05079888.1| insulin-cleaving metalloproteinase outer membrane protein
           [Rhodobacterales bacterium Y4I]
 gi|206687385|gb|EDZ47867.1| insulin-cleaving metalloproteinase outer membrane protein
           [Rhodobacterales bacterium Y4I]
          Length = 422

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/376 (50%), Positives = 255/376 (67%), Gaps = 2/376 (0%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
            VL NYA IA AKY+D+L  A+ L +A++ LV  P+ +NL+ AR  WI AR+PYQQSEV+
Sbjct: 28  AVLTNYANIAEAKYQDSLTTAQALKAAVDALVAQPSAENLQAARAAWIAARVPYQQSEVF 87

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ KVNAWPLDEG IDYVD++YG   EEN L   N+IAN    ++ K +D 
Sbjct: 88  RFGNAIVDDWEGKVNAWPLDEGLIDYVDAAYGGPTEENTLAALNVIANPSFELSGKAVDA 147

Query: 148 SIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CT 205
           + I+P+LL   LH A+GI+ N+ TGYH IEFLLWGQDL       G RP+TD+  G+ CT
Sbjct: 148 ARITPELLESTLHEADGIEANVATGYHAIEFLLWGQDLNGTGHGAGERPWTDYAQGDACT 207

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYN 265
            G+C RR +YL+  + +L+SDLE M   WG +G A   L+ D  AG+ +++TGM SLSY 
Sbjct: 208 NGNCGRRGDYLQAATDLLISDLEWMAAQWGAEGDARTALLADEYAGITAMLTGMGSLSYG 267

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G+ + Y GEY+R+NGE + G S+ 
Sbjct: 268 EQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGVQNVYLGEYVRVNGELVSGPSLS 327

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           DL++  +  L  E+  K ++TM     +K  AE   S+DQM+++ N  G  +V   +N L
Sbjct: 328 DLVAEKDAELDTEMRGKLADTMLALGRIKTAAEAGLSYDQMLAQGNAAGEALVMGGVNGL 387

Query: 386 ITQTESLRKIRIALDL 401
           I QT S+ ++  ALDL
Sbjct: 388 IGQTRSIERVVTALDL 403


>gi|144899636|emb|CAM76500.1| lipoprotein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 423

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/403 (47%), Positives = 254/403 (63%), Gaps = 2/403 (0%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           F+ + +    L     +    V  + VL  YA IAHAKYED+L+ A+ L  AI+ LV  P
Sbjct: 4   FVMVAASAAVLLGTGQAGAAGVDKKAVLTTYADIAHAKYEDSLIAAKQLKVAIDALVAAP 63

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS-SYGKE 121
           + + L  A+  WI AR+PYQQSE +RFGN  VD W+ KVNAWPLDEG IDYV++ +YG E
Sbjct: 64  SAETLATAKAAWIAARVPYQQSEAFRFGNTAVDEWEGKVNAWPLDEGLIDYVNADTYGTE 123

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
           + EN LYTANIIA+ K+ V  K ++ S I   LL K+H A G++ N+TTGYH IEF+LWG
Sbjct: 124 SGENPLYTANIIAHPKLKVGGKNVNASKIDKKLLAKMHEAGGVEANVTTGYHAIEFMLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           QD        GNRP +DFD  +CTGG+C RR  YL   + +LV DL+ M+  WG  G+  
Sbjct: 184 QDTNGTGPGAGNRPASDFDTKSCTGGNCDRRAAYLVTATDLLVDDLKTMVDGWGAKGKIR 243

Query: 242 KDLMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
             L+K   +AG+ +I+TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D 
Sbjct: 244 AKLLKGKADAGIATIVTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHFYDA 303

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
            GI + Y G+Y R +G ++ G ++ DL++  +  L  ++  K   TM    +L   AE  
Sbjct: 304 KGIQNIYLGKYTRTDGTEVKGPALADLVAAKDATLDGDMKAKLDATMTAMGVLVKTAEGG 363

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           E++DQMI   N  GN  V+  I+ L+ QT SL K    L L E
Sbjct: 364 EAYDQMIGAGNSAGNAKVQAAIDALVAQTRSLEKAVAVLALGE 406


>gi|90418784|ref|ZP_01226695.1| possible iron-regulated protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336864|gb|EAS50569.1| possible iron-regulated protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 447

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/375 (50%), Positives = 252/375 (67%), Gaps = 2/375 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           VL NY+ IA A Y+DAL  A+TLD A + L+  P++  L+ AR  W  AR  YQ++E +R
Sbjct: 54  VLANYSDIALAGYQDALAAAKTLDEATDALIAGPSEATLKAARDAWRAARPSYQETEAFR 113

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ +VNAWPLDEG IDYV  +YG E++ NNLYTAN+IAN  I +  + ID S
Sbjct: 114 FGNPIVDDWEGRVNAWPLDEGLIDYVAGTYGTESDANNLYTANVIANPSITIGGETIDAS 173

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CTG 206
            I+P+LL+ KL  A G++ N+ TGYH +EFLLWGQDL       G RP+TDF  G+ CTG
Sbjct: 174 TITPELLQDKLQEAGGVEANVATGYHAVEFLLWGQDLNGTDAGAGERPHTDFAGGDDCTG 233

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNE 266
           G+C RR +YL   + +LV+DLEEM+  W  DG A K L+     G+++I+TGM SLSY E
Sbjct: 234 GNCDRRGQYLDAATDLLVTDLEEMVGNWEKDGAARKALLDSPENGISAILTGMGSLSYGE 293

Query: 267 LAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD 326
           LAGERM LGL+LHDPE+E DCFSDNT+ S+L+D IGI + YTG Y R +G  + G S+ D
Sbjct: 294 LAGERMKLGLLLHDPEEEHDCFSDNTHISHLHDAIGIRNVYTGRYERTDGTIVEGPSVSD 353

Query: 327 LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLI 386
           L++ +   + QE+  K   T+     +   AE+ E++DQ I E N EGN  V+  I+ L+
Sbjct: 354 LVAASAPEIDQELRAKLDATVSAMETMAKAAEDGEAYDQQIGEGNDEGNARVQAAIDGLV 413

Query: 387 TQTESLRKIRIALDL 401
            QT ++ +   ALDL
Sbjct: 414 DQTRAIERAVAALDL 428


>gi|163745379|ref|ZP_02152739.1| lipoprotein, putative [Oceanibulbus indolifex HEL-45]
 gi|161382197|gb|EDQ06606.1| lipoprotein, putative [Oceanibulbus indolifex HEL-45]
          Length = 420

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/381 (46%), Positives = 252/381 (66%), Gaps = 4/381 (1%)

Query: 18  LSIVPNVSLEK--VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            +  P  + +K  VL  YA IA A YED+L  A+TL  A+  L+ TP+ + L+ A+  W+
Sbjct: 14  FAAAPAFAQDKAEVLGTYADIAQAGYEDSLTTAQTLQKAVNALIETPSAEALQAAKSAWL 73

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG E +EN L   N+IAN
Sbjct: 74  AARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGETDENQLAVLNVIAN 133

Query: 136 SKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNR 194
               +  +++D S I+PDLL  +LH A  ++ N+ TGYH IEFLLWGQDL       GNR
Sbjct: 134 PNFTLGGEKVDASAITPDLLEGQLHEAGAVEANVATGYHAIEFLLWGQDLNGTDHGAGNR 193

Query: 195 PYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
           P+TD+  G +CTGG+C RR +YLK  + +LVSDLE M   W   G A   +++D +AG+N
Sbjct: 194 PWTDYATGEDCTGGNCDRRGQYLKAATDLLVSDLEWMSGQWAEGGDARAAVLEDEDAGIN 253

Query: 254 SIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR 313
           +I+TGM SLSY E AGERM LG++L+DPE+E DCFSDNT+ S+  D +G+ + Y GEY+R
Sbjct: 254 AILTGMGSLSYGEQAGERMKLGVMLNDPEEEHDCFSDNTHNSHYYDGLGVRNVYLGEYLR 313

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPE 373
           ++G  + GAS+ DL++  +  +  ++      +M +   +K  AE   S+D M+   N E
Sbjct: 314 VDGRVVSGASLSDLVASADATVDADLRAGLDASMVELGQIKTAAEAGFSYDMMLERGNAE 373

Query: 374 GNKIVRNLINDLITQTESLRK 394
           G  ++ + ++ L+ QT ++ +
Sbjct: 374 GEALIMSAVDALVNQTRAIER 394


>gi|254488016|ref|ZP_05101221.1| insulin-cleaving metalloproteinase outer membrane protein
           [Roseobacter sp. GAI101]
 gi|214044885|gb|EEB85523.1| insulin-cleaving metalloproteinase outer membrane protein
           [Roseobacter sp. GAI101]
          Length = 420

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/376 (48%), Positives = 248/376 (65%), Gaps = 2/376 (0%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +VL  YA IA AKYED+L+ A+ L +A+  LV+ P+   L  AR  W+ AR+PYQQ+EVY
Sbjct: 26  EVLGTYADIAAAKYEDSLITAQRLQTAVAALVSDPSADTLTAARSAWLAARVPYQQTEVY 85

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ KVN+WPLDEG IDYVD+SYG  ++EN L   N+I++    ++  EID 
Sbjct: 86  RFGNPIVDDWEGKVNSWPLDEGLIDYVDASYGGPSDENELAGLNVISSPTFTLSGTEIDA 145

Query: 148 SIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CT 205
           S I+P  L   LH A+GI+ N+ TGYH IEFLLWGQDL  +    GNRP+TD+  G+ CT
Sbjct: 146 STITPAFLSDTLHEADGIEANVATGYHAIEFLLWGQDLNGHGDGAGNRPWTDYAKGDACT 205

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYN 265
             +C RR  YL   + +LVSDL  M   W  DG A  +L +D NAGL +I+TGM SLSY 
Sbjct: 206 NANCDRRGAYLTAATDLLVSDLTWMTAQWADDGAARAELTQDTNAGLAAILTGMGSLSYG 265

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI S+Y GEY+R++G  + G S+ 
Sbjct: 266 EQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIQSAYLGEYVRIDGTMVSGPSLA 325

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           D+++  + +L  E+  K S TM     +K  AE   ++DQM++  +  G  ++   ++ L
Sbjct: 326 DMVAETDADLNTEMQAKLSKTMMALGRIKTAAEAGFAYDQMLARGDAGGEALIMGGVDAL 385

Query: 386 ITQTESLRKIRIALDL 401
           I QT S+ ++   L L
Sbjct: 386 IDQTRSIERVVTTLGL 401


>gi|84684574|ref|ZP_01012475.1| lipoprotein, putative [Maritimibacter alkaliphilus HTCC2654]
 gi|84667553|gb|EAQ14022.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2654]
          Length = 444

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/388 (48%), Positives = 261/388 (67%), Gaps = 4/388 (1%)

Query: 18  LSIVPNVSLEK--VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
           L  VP  +  K  VL  YA IAHA YED+L  A+ L+ A+E L+ +P++  L  AR  W+
Sbjct: 38  LGTVPAFAATKGEVLTTYADIAHAGYEDSLTTAQALNDAVEALIASPSEDTLAAARAAWV 97

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD SYG   +EN     N+IAN
Sbjct: 98  AAREPYQQTEVYRFGNPIVDDWEGKVNAWPLDEGLIDYVDESYGGATDENPFAAVNVIAN 157

Query: 136 SKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNR 194
            ++ +  +E+D S I+P+L+   L+ A+GI++N+  GYH IEFLLWGQDL       G+R
Sbjct: 158 PQLTIAGQEVDASSITPELIADTLNEADGIESNVARGYHAIEFLLWGQDLNGTDAGAGDR 217

Query: 195 PYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
           PY+DF  G+ CT G+C RRV+YL+    +L+SDLEEM+ AWG  G+A + +M + +AG+ 
Sbjct: 218 PYSDFAQGDDCTNGNCDRRVDYLEASMDLLISDLEEMVAAWGQGGEAREAVMANEDAGII 277

Query: 254 SIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR 313
           +I+TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+ ND +G+ + Y G Y R
Sbjct: 278 AILTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHRSHYNDGLGVQNVYLGSYTR 337

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPE 373
           ++G  + G S+ DL++  N +L  E+ +K   TM     + D AEN  + DQM++  N E
Sbjct: 338 VDGTVVEGPSLSDLVAEANADLDAEMKEKLDTTMTAMTAISDAAENGMAVDQMLAPGNEE 397

Query: 374 GNKIVRNLINDLITQTESLRKIRIALDL 401
           G K++ + I+ LI QT ++ +I   L L
Sbjct: 398 GEKLMMDAIDGLIDQTATIERIVADLGL 425


>gi|87122310|ref|ZP_01078192.1| hypothetical protein MED121_03527 [Marinomonas sp. MED121]
 gi|86162453|gb|EAQ63736.1| hypothetical protein MED121_03527 [Marinomonas sp. MED121]
          Length = 427

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/406 (44%), Positives = 265/406 (65%), Gaps = 7/406 (1%)

Query: 3   FITIIS--IVFTLPSHALS--IVPN--VSLEKVLQNYATIAHAKYEDALMCARTLDSAIE 56
           F+T I+  +  TL +   S  + PN  ++   V+ NY+ IAHA Y D+L  A++L  A++
Sbjct: 4   FVTPIAACVAATLLTACGSQGVQPNKAITANDVVVNYSDIAHAIYTDSLTTAQSLKVAVD 63

Query: 57  TLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS 116
             +  P +  L NAR  WI +R+PYQQSEVYRFGN IVD W+ KVNAWPLDEG IDYV +
Sbjct: 64  AFIANPTEATLANARQAWIDSRVPYQQSEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVAT 123

Query: 117 SYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIE 176
            YG +++ N LYTAN++A++ + +  + +D S I+P LL +LH A+ ++ N+ TGYH IE
Sbjct: 124 DYGTDSDVNPLYTANVVASTSLTIAGQAVDTSNITPSLLEELHEADEVEANVATGYHAIE 183

Query: 177 FLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP 236
           FLLWGQDL       G RP TD+D+ NCTGG+C RR  YL   + +L++DLEEM   WG 
Sbjct: 184 FLLWGQDLNGTNPGAGERPATDYDVNNCTGGNCDRRAAYLVAATDLLITDLEEMAANWGA 243

Query: 237 DGQATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYAS 295
           +G+A + ++ +    GL +I+TGM SL+Y EL GER  LGL+LHDPE+E DCFSDNT+ S
Sbjct: 244 NGEARQAILDQGDKQGLATILTGMGSLAYGELGGERTKLGLMLHDPEEEHDCFSDNTHYS 303

Query: 296 YLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKD 355
           +  D  GI + Y GEY R++G  + GAS+  L+S  +  L  E+  K  NT +    + D
Sbjct: 304 HFYDAKGIQNVYLGEYQRVDGSWVKGASLSALVSAQDSILDAEMKGKLENTQEAGQAMVD 363

Query: 356 RAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            A+  ++FD +I+  N  GN++V++ ++ L+ +T +  +I   L+L
Sbjct: 364 AAKVGQTFDVLIAMGNQAGNQLVQDFVDSLVAETRTTEEIIRLLEL 409


>gi|83950301|ref|ZP_00959034.1| lipoprotein, putative [Roseovarius nubinhibens ISM]
 gi|83838200|gb|EAP77496.1| lipoprotein, putative [Roseovarius nubinhibens ISM]
          Length = 424

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/374 (48%), Positives = 245/374 (65%), Gaps = 2/374 (0%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +VL  YA IA A Y D+L  AR L  A+  L+  P++ NL  AR  WI AR+PYQQ+EV+
Sbjct: 30  EVLNTYADIAAAGYGDSLTTARALQEAVAALIADPSEANLAAARAAWIDARVPYQQTEVF 89

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   +EN     N++AN K  ++ +E+D 
Sbjct: 90  RFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGATDENGFAVLNVVANPKFTLSGQEVDA 149

Query: 148 SIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CT 205
           S I+P LL + LH A+G++ N+ TGYH IEFLLWGQDL  +    G+RP+TDF  G  CT
Sbjct: 150 SDITPALLAETLHEADGVEANVATGYHAIEFLLWGQDLNGHAAGAGDRPWTDFASGEACT 209

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYN 265
            G+C RR  YLK  + +LVSDL+ M   W  DG A   L+ D +AG+++++TGM SLSY 
Sbjct: 210 NGNCDRRAAYLKAATDLLVSDLDWMAAQWASDGAARATLLSDEDAGISAMLTGMGSLSYG 269

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G+ + Y G Y R++G K+ G S+ 
Sbjct: 270 EQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGVQNVYLGAYTRVDGSKVEGPSLA 329

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           DL++  +  L  E+  K S TM     LK  A+   S+D M+   N +G  ++   +N L
Sbjct: 330 DLVAAQDAALDAEMQAKLSTTMDALGALKSAADGGFSYDMMLERGNDKGEALIMGGVNGL 389

Query: 386 ITQTESLRKIRIAL 399
           I QT S+ ++  AL
Sbjct: 390 IDQTRSIERVVAAL 403


>gi|260427865|ref|ZP_05781844.1| hypothetical protein CSE45_1614 [Citreicella sp. SE45]
 gi|260422357|gb|EEX15608.1| hypothetical protein CSE45_1614 [Citreicella sp. SE45]
          Length = 425

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/376 (47%), Positives = 250/376 (66%), Gaps = 2/376 (0%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
            VL+ YA IA A YED+L  A+ L  A+E L+  P+++ L  AR  W+ +R PYQQ+EV+
Sbjct: 31  SVLETYADIALAGYEDSLSTAKALQEAVEALIAEPSEETLAAAREAWLVSRNPYQQTEVF 90

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ KVNAWPLDEG IDYV   Y    +EN     NIIA  +  +  +E+D 
Sbjct: 91  RFGNPIVDDWEGKVNAWPLDEGLIDYVSEEYEGPTDENEYAALNIIATPQATIAGQEVDA 150

Query: 148 SIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CT 205
           S I+P+L+   L+ A+GI+TN+  GYH IEFLLWGQDL       G RPYTD+  G+ CT
Sbjct: 151 SEITPELIADTLNEADGIETNVARGYHAIEFLLWGQDLNGTEPGAGERPYTDYATGDDCT 210

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYN 265
           GG+C RR +YLK  + +LVSDLEEM+ AWG DG+A   +++D NAG+ +++TGM SLSY 
Sbjct: 211 GGNCDRRADYLKAATTLLVSDLEEMVAAWGADGEARGAVLEDENAGITAMLTGMGSLSYG 270

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM LGL+L+DPE+E DCFSDNT+ S+  D  GI + Y G Y R++G  + GAS+ 
Sbjct: 271 EQAGERMRLGLMLNDPEEEHDCFSDNTHNSHFYDGKGIQNVYLGSYTRVDGSTVEGASLS 330

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           +L++  +  L  E+  K   TM     +K+ AE   ++DQM++  + +G +++   +N L
Sbjct: 331 ELVAATDPALDDEMKTKLDTTMTALGAIKEAAEGGFAYDQMLAIGDEKGEELIMGGVNGL 390

Query: 386 ITQTESLRKIRIALDL 401
           I QT ++ +I  ALDL
Sbjct: 391 IDQTRTIERIVGALDL 406


>gi|163792732|ref|ZP_02186709.1| hypothetical protein BAL199_17833 [alpha proteobacterium BAL199]
 gi|159182437|gb|EDP66946.1| hypothetical protein BAL199_17833 [alpha proteobacterium BAL199]
          Length = 429

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/372 (49%), Positives = 240/372 (64%), Gaps = 2/372 (0%)

Query: 32  NYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGN 91
           NY  IAHA Y+DA   A TL SA+  L  TP+ KNL+ AR+ WI AR  YQQ+E  RFGN
Sbjct: 39  NYEAIAHAMYQDAHASAVTLKSAVRALAKTPSAKNLKAARVAWIAARPAYQQTEALRFGN 98

Query: 92  KIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIIS 151
            IVD W+ +VNAWPLDEG IDYVD+ YG E + N LYTAN+IAN KI +    +D S I 
Sbjct: 99  AIVDDWEGRVNAWPLDEGLIDYVDAGYGTEADHNPLYTANVIANKKIRIGATMVDASKID 158

Query: 152 PDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRR 211
             L+ +LH A  ++ N++ GYH IEFLLWGQDL       GNRP+TDFD   CT G+C R
Sbjct: 159 KKLIAELHEAQEVEANVSIGYHAIEFLLWGQDLNGTGPGAGNRPHTDFDTRKCTNGNCDR 218

Query: 212 RVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL-MKDINAGLNSIITGMTSLSYNELAGE 270
           R  YL   + +LV DL EM+  W P G A  +L  K    GL +I+TG+ SLSY ELAGE
Sbjct: 219 RAAYLVAATDLLVDDLAEMVANWAPGGPARAELEAKGPEGGLATILTGIGSLSYGELAGE 278

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM LGLILHDPE+E DCFSDNT+ S+  D +G+++  +G Y+R +   I G  I DL + 
Sbjct: 279 RMKLGLILHDPEEEHDCFSDNTHNSHYYDQVGMVALASGRYVRSDKSVIKGPGILDLAAA 338

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIVRNLINDLITQT 389
            +   A+E+    + T     ++KD A+    ++DQMI E N  GNKIV+++I+ L+ QT
Sbjct: 339 KDPAAAKEMTAALATTSAKMQVMKDTADKGTMAYDQMIGEGNEAGNKIVQDVIDGLVAQT 398

Query: 390 ESLRKIRIALDL 401
            +  ++  AL+L
Sbjct: 399 RATERVVTALNL 410


>gi|110678258|ref|YP_681265.1| putative lipoprotein [Roseobacter denitrificans OCh 114]
 gi|109454374|gb|ABG30579.1| lipoprotein, putative [Roseobacter denitrificans OCh 114]
          Length = 408

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/384 (47%), Positives = 253/384 (65%), Gaps = 4/384 (1%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
            VL NYA IA AKYED+L  A+ L SA++TL+ TP+ + L+ A+  WIRAR+PYQQSEVY
Sbjct: 25  AVLDNYADIALAKYEDSLTTAQALQSAVDTLIATPSAEALQAAKEAWIRARVPYQQSEVY 84

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   + N     N+IAN    ++ + +D 
Sbjct: 85  RFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGATDANEYAVLNVIANPSFTLSGETLDA 144

Query: 148 SIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CT 205
           + I+P LL   LH A+ +++N+ TGYH IEFLLWGQDL  +    GNRP+TD+ +G  CT
Sbjct: 145 TQITPALLEGALHEADAVESNVATGYHAIEFLLWGQDLNGHGPGAGNRPWTDYAVGEACT 204

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYN 265
           GG+C RR +YL   +++LVSDLE M+  W   G A   L+ D NAG+++I+TGM SLSY 
Sbjct: 205 GGNCDRRGDYLSAATELLVSDLEWMVAQWQDGGAARTQLIADENAGISAILTGMGSLSYG 264

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM LGL+L+DPE+E DCF+DNT+ S+  D +GI + Y G Y R++G  + G S+ 
Sbjct: 265 EQAGERMKLGLMLNDPEEEHDCFADNTHNSHFYDAMGIRNVYLGSYTRIDGTIVSGPSLS 324

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
            L++  +  +  E+  K + TM +   +K  AE   ++D M+   N  G  ++   ++ L
Sbjct: 325 SLVAAADAGVDAELTAKLNTTMLEMSEMKTAAEAGFAYDMMLERGNAAGEALIMGAVDAL 384

Query: 386 ITQTESLRKIRIAL--DLIEPNRV 407
           + QT S+ +   AL  D IE  R+
Sbjct: 385 VEQTRSIERAVAALGVDQIEFERL 408


>gi|163735580|ref|ZP_02143012.1| lipoprotein, putative [Roseobacter litoralis Och 149]
 gi|161391200|gb|EDQ15537.1| lipoprotein, putative [Roseobacter litoralis Och 149]
          Length = 419

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/373 (47%), Positives = 250/373 (67%), Gaps = 2/373 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           VL NYA IA AKYED+L  A+ L SA++TL+ TP+ + L+ A+  WI+AR+PYQQSEVYR
Sbjct: 26  VLDNYADIALAKYEDSLTTAQALQSAVDTLIATPSAEALQAAKEAWIKARVPYQQSEVYR 85

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD+SYG   +EN     N+IAN    ++ + +D +
Sbjct: 86  FGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGATDENEYAVLNVIANPSFTLSGETLDAT 145

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CTG 206
            I+P LL   LH A+ +++N+ TGYH IEFLLWGQDL  +    GNRP+TD+ +G+ CTG
Sbjct: 146 EITPALLEGALHEADAVESNVATGYHAIEFLLWGQDLNGHGPGAGNRPWTDYAVGDACTG 205

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNE 266
           G+C RR +YL   +++LVSDL+ M+  W   G A   L  D NAG+++I+TGM SLSY E
Sbjct: 206 GNCDRRGDYLSAATELLVSDLDWMVAQWQDGGAARTQLTADENAGISTILTGMGSLSYGE 265

Query: 267 LAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD 326
            AGERM LGL+L+DPE+E DCF+DNT+ S+  D +GI + Y G Y R++G  + G S+  
Sbjct: 266 QAGERMKLGLMLNDPEEEHDCFADNTHNSHFYDAMGIRNVYLGSYTRIDGTVVSGPSLSS 325

Query: 327 LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLI 386
           L++  +  +  E+  K + TM +   +K  AE   ++D M+   N  G  ++   ++ L+
Sbjct: 326 LVAAADAGVDAELTAKLNTTMLEMSEMKTAAEAGFAYDMMLERGNEAGEALIMGAVDALV 385

Query: 387 TQTESLRKIRIAL 399
            QT S+ +  +AL
Sbjct: 386 DQTRSIERAVVAL 398


>gi|254451478|ref|ZP_05064915.1| insulin-cleaving metalloproteinase outer membrane protein
           [Octadecabacter antarcticus 238]
 gi|198265884|gb|EDY90154.1| insulin-cleaving metalloproteinase outer membrane protein
           [Octadecabacter antarcticus 238]
          Length = 406

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/384 (46%), Positives = 250/384 (65%), Gaps = 4/384 (1%)

Query: 22  PNVSLEK--VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
           P  ++EK  VL  YA IA AKY D+L+ A+ L +A+  LV  P+ +NL  AR  W+ AR+
Sbjct: 4   PAFAIEKADVLDTYADIAAAKYGDSLIMAQRLQTAVNALVADPSPENLTAARKAWLEARV 63

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKII 139
           PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN     N+IAN+   
Sbjct: 64  PYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDENEFAALNVIANATFT 123

Query: 140 VNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
           ++  EID + I+PDLL   L  A+G++ N+ TGYH IEFLLWGQDL  +    G RP+TD
Sbjct: 124 LSGTEIDATEITPDLLENTLQEADGVEANVATGYHAIEFLLWGQDLNGHGTGAGQRPWTD 183

Query: 199 FDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIIT 257
           + + N CT  +C RR EYL   + +LVSDLE M+  W   G A  ++M + +AGL +++T
Sbjct: 184 YALANDCTNANCDRRGEYLTAATDLLVSDLEWMVAQWADHGAARAEVMTNKDAGLAAMLT 243

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           GM SLSY E+AGERM LG++L+DPE+E  CF+DNT+  +  D +G+ + Y GEYIR++G 
Sbjct: 244 GMGSLSYGEVAGERMRLGVMLNDPEEEHSCFADNTHNDHFYDGMGVQNIYLGEYIRVDGT 303

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKI 377
            + G S+ DL+S  +  L  E+  K S TM     +K  AE   ++DQM+   N  G  +
Sbjct: 304 LVSGPSLADLVSETDAALDAEMQSKLSATMMALGRIKTTAEAGFAYDQMLERGNEAGEAL 363

Query: 378 VRNLINDLITQTESLRKIRIALDL 401
           +   +N  I QT S+ ++  +L L
Sbjct: 364 IMGGVNGFIDQTRSIERVVTSLGL 387


>gi|259416101|ref|ZP_05740021.1| hypothetical protein SCH4B_1473 [Silicibacter sp. TrichCH4B]
 gi|259347540|gb|EEW59317.1| hypothetical protein SCH4B_1473 [Silicibacter sp. TrichCH4B]
          Length = 422

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/380 (47%), Positives = 254/380 (66%), Gaps = 2/380 (0%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
            S   VL NYA IA AKYED+L+ A+ L +A++ L+  P+ +NLE A+  W+ AR+PYQQ
Sbjct: 24  ASKADVLTNYANIAEAKYEDSLITAKALQAAVDALIADPSAENLEAAKHAWLAARVPYQQ 83

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           +EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG   +EN     N++AN +  ++ K
Sbjct: 84  TEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPTDENAAAALNVVANPEFTLSGK 143

Query: 144 EIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG 202
            ID S I+P+LL + LH A+G++ N+ TGYH IEFLLWGQDL       G R +TD+  G
Sbjct: 144 TIDASDITPELLAETLHEADGVEANVATGYHAIEFLLWGQDLNGTEHGAGERAWTDYAAG 203

Query: 203 -NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTS 261
            +CT G+C RR  YLK  + +LVSDLE +   W   G+A + ++ D +AG+ +I+TGM S
Sbjct: 204 ESCTNGNCDRRGAYLKAATDLLVSDLEWITAQWAEGGEARETVLSDEDAGITTILTGMGS 263

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI + Y GEY+R+NG+ + G
Sbjct: 264 LSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIQNVYLGEYVRVNGDLVSG 323

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
            ++ DL+   +  L  E+  K S TM     +K  AE   S+DQM+++ +  G  +V   
Sbjct: 324 PALADLVEAADSELNAELTGKLSTTMMKLGRIKTAAEAGFSYDQMLAQGSDAGEALVMGG 383

Query: 382 INDLITQTESLRKIRIALDL 401
           ++ L+ QT S+ +   AL+L
Sbjct: 384 VDALVDQTRSIERAVAALEL 403


>gi|89092302|ref|ZP_01165256.1| hypothetical protein MED92_05803 [Oceanospirillum sp. MED92]
 gi|89083390|gb|EAR62608.1| hypothetical protein MED92_05803 [Oceanospirillum sp. MED92]
          Length = 427

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/397 (45%), Positives = 259/397 (65%), Gaps = 4/397 (1%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           +S+     +   +  P  +   +L NYA IAHA YED+L+ A+TL+  I+  + +P++ N
Sbjct: 12  VSVAVLSTTQTQAAAPATT--DILNNYANIAHATYEDSLLTAQTLNKVIDQFLASPSEAN 69

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L+ AR  W+ AR+PYQQSE YRFGN +VD W+ KVNAWPLDEG IDYVD+ YG E++EN 
Sbjct: 70  LKKARAAWVAARVPYQQSEAYRFGNALVDDWEGKVNAWPLDEGLIDYVDAGYGSESDENP 129

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLK 185
            YTANIIAN  + V    +D + I   LL + LH  + ++ N+ TGYH IEFLLWGQDL 
Sbjct: 130 FYTANIIANKTLKVGGVTVDSTNIDKKLLAETLHEIDEVEANVATGYHAIEFLLWGQDLN 189

Query: 186 TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM 245
                 GNRP +DFD+ NCTGG+C RR +YLK  +++L+ DL++M  +W  +G A +DLM
Sbjct: 190 GTNPGAGNRPASDFDLKNCTGGNCDRRRDYLKAATELLIDDLQDMTSSWANNGAARQDLM 249

Query: 246 -KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
            K    GL +I+TGM SL+Y ELAGER  LGL++HDPE+E DCF+DNT+AS+  D +GI 
Sbjct: 250 AKGPQGGLATILTGMGSLAYGELAGERTKLGLMVHDPEEEHDCFADNTHASHFYDALGIK 309

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y GEY R++G K+ GAS+  L++     + Q + +K   T     ++ D A    +FD
Sbjct: 310 NVYLGEYTRVDGSKVSGASLSQLVNAEAPVVDQNLRNKLDATQAAAQVMVDEAAKGNTFD 369

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            +I ENN  GN++V+  ++ L+ + E++      L L
Sbjct: 370 VLIGENNAAGNQVVQTFVDALVAEAEAIEHTIAVLKL 406


>gi|254460033|ref|ZP_05073449.1| insulin-cleaving metalloproteinase outer membrane [Rhodobacterales
           bacterium HTCC2083]
 gi|206676622|gb|EDZ41109.1| insulin-cleaving metalloproteinase outer membrane [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 420

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/400 (44%), Positives = 259/400 (64%), Gaps = 6/400 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +T  ++V  L + A +    V    VL  YA IA AKY D+L  A+TL +A+  L+  P+
Sbjct: 6   LTTTALVTALSTSAFA----VEKADVLGTYADIAAAKYGDSLTTAQTLQAAVNALIANPS 61

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
              L+ A+  W+ AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++
Sbjct: 62  ADALQAAKTAWLAARVPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPSD 121

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN     N++AN+   ++ +E+D + I+  LL + L  A+G++ N+ TGYH IEFLLWGQ
Sbjct: 122 ENEFAALNVVANASFTLSGREVDANEINSALLEETLQEADGVEANVATGYHAIEFLLWGQ 181

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           DL  +    GNRP+TD+  G+ CT  +C RR EYL   + +LVSDLE M   W   G A 
Sbjct: 182 DLNGHGAGAGNRPWTDYAAGHACTNDNCDRRGEYLTAATDLLVSDLEWMTAQWAAGGAAR 241

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
            +L ++ +AG+ +++TGM SLSY E+AGERM LG++L+DPE+E  CF+DNT+  + +D +
Sbjct: 242 TELNRNEDAGIAAVLTGMGSLSYGEVAGERMRLGVMLNDPEEEHSCFADNTHNDHYHDGL 301

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           G+ ++Y GEY+R++G  + GAS+ D+++  + +L  E+  K S TMK    +K  AE   
Sbjct: 302 GVQNAYLGEYVRIDGSVVSGASLSDMVAATDVSLDTEMRAKLSATMKALGRIKTTAEAGF 361

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           ++DQM+   N  G  ++   +N  I QT S+ ++  AL L
Sbjct: 362 AYDQMLERGNEAGEAVIMGGVNGFIDQTRSIERVVSALGL 401


>gi|89053859|ref|YP_509310.1| putative lipoprotein [Jannaschia sp. CCS1]
 gi|88863408|gb|ABD54285.1| lipoprotein putative [Jannaschia sp. CCS1]
          Length = 420

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/375 (45%), Positives = 245/375 (65%), Gaps = 2/375 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           VL  YA IA A YED+L+ A+ L+ A++ L+  P+ + L  AR  W++AR+PYQQ+EV+R
Sbjct: 27  VLNTYADIAAAGYEDSLITAQALERAVDALIAEPSAQTLTAARTAWLQARVPYQQTEVFR 86

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ +VNAWPLDEG IDYVD +YG   +EN L   N+IAN    ++  E+D S
Sbjct: 87  FGNAIVDDWEGRVNAWPLDEGLIDYVDGAYGGPTDENTLAAVNVIANPTFTLSGSEVDAS 146

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CTG 206
            I+P LL   LH A+G++ N+ TGYH +EFLLWGQDL  +    GNRPYTD+  G+ CTG
Sbjct: 147 SITPALLEDTLHEADGVEANVATGYHAVEFLLWGQDLNGHGDGAGNRPYTDYAAGDDCTG 206

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNE 266
           G+C RR EYL   +++LVSDLE M   W  DG A   LM++  AGL++++TGM SLSY E
Sbjct: 207 GNCDRRAEYLAAATELLVSDLEWMAAQWTADGDARAALMENEQAGLSAMLTGMGSLSYGE 266

Query: 267 LAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD 326
            AGERM LGL+L+DPE+E  CF+DNT+  +  + +G+ + Y G Y R++G  + G S+ D
Sbjct: 267 TAGERMRLGLMLNDPEEEHSCFADNTHNDHFFNGVGVRNVYLGSYSRIDGTLVSGPSLSD 326

Query: 327 LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLI 386
           L+   + +L  E+  + +  +     +K  AE   ++D+M+   N  G  ++   +N LI
Sbjct: 327 LVMDVDADLDAEMRSRLAEAVLALGEIKTAAEAGFAYDEMLERGNEGGELLIMGGVNGLI 386

Query: 387 TQTESLRKIRIALDL 401
            QT S+ ++  AL L
Sbjct: 387 EQTRSIERVVTALGL 401


>gi|126460976|ref|YP_001042090.1| putative iron-regulated protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102640|gb|ABN75318.1| imelysin. Metallo peptidase. MEROPS family M75 [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 441

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/394 (44%), Positives = 251/394 (63%), Gaps = 4/394 (1%)

Query: 12  TLPSHALSIVPNVSLEK--VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
           T+   AL  +P +++E+  V++ YA IA A Y D+L  AR L +A++ LV  P++  L  
Sbjct: 29  TVAPCALLPLPALAVERSEVVETYADIAEATYADSLATARELQTAVKALVDQPSEAALMA 88

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           AR  W+ AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   EEN+L  
Sbjct: 89  ARSAWLAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGGATEENDLAA 148

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
            N+IA  K  ++  EID + I+P+L+   LH A+GI+ N+ +GYH IEFLLWGQDL    
Sbjct: 149 LNVIATPKFTLSGTEIDATEITPELISGTLHEADGIEANVASGYHAIEFLLWGQDLNGTE 208

Query: 189 REPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKD 247
              G+RP+TD+  G +CTGG+C RR  YL   + +LVSDL+ M   W   G A   + +D
Sbjct: 209 AGAGDRPFTDYAKGEDCTGGNCDRRAAYLVAATDLLVSDLDYMAAQWADGGAARVAVTED 268

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSY 307
              GL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI + Y
Sbjct: 269 PGKGLRAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIRNVY 328

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI 367
            G Y R++G  + G S+ DL++  +  L + +  +   T+     L+       ++DQM+
Sbjct: 329 RGHYARVDGSTVEGPSLSDLVAEADPELDKVLTGQLDATVDRLDALRTAVAGGMAYDQML 388

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           +  N EG  ++   ++ L+TQT S+ +   AL L
Sbjct: 389 APGNAEGEALIMGAVDALVTQTASIERATTALGL 422


>gi|77462087|ref|YP_351591.1| imelysin [Rhodobacter sphaeroides 2.4.1]
 gi|77386505|gb|ABA77690.1| imelysin. Metallo peptidase. MEROPS family M75 [Rhodobacter
           sphaeroides 2.4.1]
          Length = 422

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 177/394 (44%), Positives = 251/394 (63%), Gaps = 4/394 (1%)

Query: 12  TLPSHALSIVPNVSLEK--VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
           T+   AL  +P +++E+  V++ YA IA A Y D+L  AR L +A++ LV  P++  L  
Sbjct: 10  TVAPCALLPLPALAVERSEVVETYADIAEATYADSLATARELQTAVKALVDQPSEAALMA 69

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           AR  W+ AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   EEN+L  
Sbjct: 70  ARSAWLAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGGATEENDLAA 129

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
            N+IA  K  ++  EID + I+P+L+   LH A+GI+ N+ +GYH IEFLLWGQDL    
Sbjct: 130 LNVIATPKFTLSGTEIDATEITPELISGTLHEADGIEANVASGYHAIEFLLWGQDLNGTE 189

Query: 189 REPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKD 247
              G+RP+TD+  G +CTGG+C RR  YL   + +LVSDL+ M   W   G A   + +D
Sbjct: 190 AGAGDRPFTDYAKGEDCTGGNCDRRAAYLVAATDLLVSDLDYMAAQWADGGAARVAVNED 249

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSY 307
              GL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI + Y
Sbjct: 250 PGKGLRAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIRNVY 309

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI 367
            G Y R++G  + G S+ DL++  +  L + +  +   T+     L+       ++DQM+
Sbjct: 310 RGHYARVDGSTVEGPSLSDLVAEADPELDKVLTGQLDATVDRLDALRTAVAGGMAYDQML 369

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           +  N EG  ++   ++ L+TQT S+ +   AL L
Sbjct: 370 APGNAEGEALIMGAVDALVTQTASIERATTALGL 403


>gi|254511799|ref|ZP_05123866.1| insulin-cleaving metalloproteinase outer membrane protein
           [Rhodobacteraceae bacterium KLH11]
 gi|221535510|gb|EEE38498.1| insulin-cleaving metalloproteinase outer membrane protein
           [Rhodobacteraceae bacterium KLH11]
          Length = 422

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 189/401 (47%), Positives = 258/401 (64%), Gaps = 4/401 (0%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           F    ++   + S A++  P  S   VL  YA IA AKY+D+L+ A+ L +A+ TL+  P
Sbjct: 5   FAATSALTLCIASAAIADAP--SKADVLNTYANIAEAKYDDSLIAAKRLQAAVNTLIADP 62

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +   L  AR  W+ AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  +
Sbjct: 63  SDATLNAARAAWVAARVPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPS 122

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWG 181
           +EN     N+IAN    ++ + ID S I+P+LL   LH A+GI+ N+ TGYH IEFLLWG
Sbjct: 123 DENEFAVLNVIANPSFELSGQTIDASDITPELLSGTLHEADGIEANVATGYHAIEFLLWG 182

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDL  +    GNRPYTD+  G+ CTGG+C RR +YL   + +LVSDLE M   W   G A
Sbjct: 183 QDLNGHNAGAGNRPYTDYVQGDGCTGGNCDRRAQYLSAATDLLVSDLEWMTSQWSEGGDA 242

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              L  D +AG+++I+TGM SLSY E AGERM LGL+L+DPE+E DCF+DNT+ S+  D 
Sbjct: 243 RAALTADESAGVSAILTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFADNTHNSHYYDG 302

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +GI + Y G Y R++G  + GAS+ DL+   +  L  E+  K + TMK    +K  AE  
Sbjct: 303 LGIQNVYLGNYTRIDGTPVSGASLSDLVLATDPALDTEMKAKLAATMKALGNIKSTAEAG 362

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            ++DQM+   N  G  ++   +N L+ QT+++ +I   LDL
Sbjct: 363 FAYDQMLERGNEAGEALIMGGVNGLVDQTKTIERIVTVLDL 403


>gi|221641041|ref|YP_002527303.1| Imelysin. Metallo peptidase. MEROPS family M75 [Rhodobacter
           sphaeroides KD131]
 gi|221161822|gb|ACM02802.1| Imelysin. Metallo peptidase. MEROPS family M75 precursor
           [Rhodobacter sphaeroides KD131]
          Length = 422

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 177/394 (44%), Positives = 250/394 (63%), Gaps = 4/394 (1%)

Query: 12  TLPSHALSIVPNVSLEK--VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
           T+   AL  +P +++E+  V++ YA IA A Y D+L  AR L +A++ LV  P++  L  
Sbjct: 10  TVAPCALLPLPALAVERSEVVETYADIAEATYADSLATARELQTAVKALVDQPSEAALMA 69

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           AR  W+ AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   EEN+L  
Sbjct: 70  ARSAWLAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGGVTEENDLAA 129

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
            N+IA  K  ++  EID + I+P+L+   LH A+GI+ N+ +GYH IEFLLWGQDL    
Sbjct: 130 LNVIATPKFTLSGTEIDATEITPELISGTLHEADGIEANVASGYHAIEFLLWGQDLNGTE 189

Query: 189 REPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKD 247
              G+RP+TD+  G  CTGG+C RR  YL   + +LVSDL+ M   W   G A   + +D
Sbjct: 190 AGAGDRPFTDYAKGEACTGGNCDRRAAYLLAATDLLVSDLDYMAAQWADGGAARVAVTED 249

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSY 307
              GL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI + Y
Sbjct: 250 PEKGLRAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIRNVY 309

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI 367
            G Y R++G  + G S+ DL++  +  L + +  +   T+     L+       ++DQM+
Sbjct: 310 RGHYARVDGSTVEGPSLSDLVAEADPELDKVLTGQLDATVDRLDALRTAVAGGMAYDQML 369

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           +  N EG  ++   ++ L+TQT S+ +   AL L
Sbjct: 370 APGNAEGEALIMGAVDALVTQTASIERATTALGL 403


>gi|332560014|ref|ZP_08414336.1| putative iron-regulated protein [Rhodobacter sphaeroides WS8N]
 gi|332277726|gb|EGJ23041.1| putative iron-regulated protein [Rhodobacter sphaeroides WS8N]
          Length = 422

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 177/394 (44%), Positives = 250/394 (63%), Gaps = 4/394 (1%)

Query: 12  TLPSHALSIVPNVSLEK--VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
           T+   AL  +P +++E+  V++ YA IA A Y D+L  AR L +A++ LV  P +  L  
Sbjct: 10  TVAPCALLPLPALAVERSEVVETYADIAEATYADSLATARELQTAVKALVDQPAEAALMA 69

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           AR  W+ AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   EEN+L  
Sbjct: 70  ARSAWLAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGGATEENDLAA 129

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
            N+IA  K  ++  EID + I+P+L+   LH A+GI+ N+ +GYH IEFLLWGQDL    
Sbjct: 130 LNVIATPKFTLSGTEIDATEITPELISGTLHEADGIEANVASGYHAIEFLLWGQDLNGTE 189

Query: 189 REPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKD 247
              G+RP+TD+  G +CTGG+C RR  YL   + +LVSDL+ M   W   G A   + +D
Sbjct: 190 AGAGDRPFTDYVKGEDCTGGNCDRRAAYLVAATDLLVSDLDYMAAQWADGGAARVAVTED 249

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSY 307
              GL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI + Y
Sbjct: 250 PEKGLRAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIRNVY 309

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI 367
            G Y R++G  + G S+ DL++  +  L + +  +   T+     L+       ++DQM+
Sbjct: 310 RGHYPRVDGSTVEGPSLSDLVAEADPELDKVLTGQLDATVDRLDALRTAVAGGMAYDQML 369

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           +  N EG  ++   ++ L+TQT S+ +   AL L
Sbjct: 370 APGNAEGEALIMGAVDALVTQTASIERATTALGL 403


>gi|99082039|ref|YP_614193.1| imelysin [Ruegeria sp. TM1040]
 gi|99038319|gb|ABF64931.1| imelysin. Metallo peptidase. MEROPS family M75 [Ruegeria sp.
           TM1040]
          Length = 422

 Score =  365 bits (937), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 180/376 (47%), Positives = 251/376 (66%), Gaps = 2/376 (0%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +VL NYA IA AKYED+L+ A+TL +A+  L+  P+ + L  A+  W+ AR+PYQQ+EVY
Sbjct: 28  EVLINYANIAEAKYEDSLITAKTLQAAVGALIDAPSAETLAAAKKAWLAARVPYQQTEVY 87

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   +EN     N++AN    ++ + ID 
Sbjct: 88  RFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPTDENAAAVLNVVANPDFSLSGQAIDA 147

Query: 148 SIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCT 205
           S I+P+LL + LH A+G++ N+ TGYH IEFLLWGQDL       G R +TD+  G +CT
Sbjct: 148 SEITPELLAETLHEADGVEANVATGYHAIEFLLWGQDLNGTEHGAGARAWTDYATGEDCT 207

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYN 265
            G+C RR  YLK  + +LVSDLE +   W   G A  +++ D NAG+ +I+TGM SLSY 
Sbjct: 208 NGNCDRRGAYLKAATDLLVSDLEWITAQWAEGGAARAEVLSDENAGITAILTGMGSLSYG 267

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI + Y GEY+R+NG  + GA++ 
Sbjct: 268 EQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIQNVYLGEYVRVNGALVSGAALA 327

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           DL+   +  L  E+  K + TM     +K  AE   S+DQM+++ +  G  +V   ++ L
Sbjct: 328 DLVEAADPALNSELTAKLATTMMKLGRIKTAAEAGFSYDQMLAQGSTAGEALVMGGVDAL 387

Query: 386 ITQTESLRKIRIALDL 401
           + QT S+ ++  AL+L
Sbjct: 388 VDQTRSIERVVAALEL 403


>gi|298291366|ref|YP_003693305.1| peptidase M75, Imelysin [Starkeya novella DSM 506]
 gi|296927877|gb|ADH88686.1| Peptidase M75, Imelysin [Starkeya novella DSM 506]
          Length = 431

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 181/376 (48%), Positives = 243/376 (64%), Gaps = 3/376 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           ++  YA IA A Y D+L  A+ L SA++  +  P + NL+ A+  W  AR+PYQQ+E YR
Sbjct: 38  IVTTYADIAEAMYGDSLKTAKDLQSAVDAFLADPTEANLDKAKTAWKAARVPYQQTEGYR 97

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDS-SYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           FGN IVD W+ +VNAWPLDEG IDYVD  SYG  ++EN LYTAN+IAN+KI V +K ID 
Sbjct: 98  FGNAIVDDWEGRVNAWPLDEGLIDYVDKKSYGDSSDENPLYTANVIANTKIRVGKKTIDA 157

Query: 148 SIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
           + I+P LL  L  A G+++N+  GYH IEFLLWGQDL       G RP TD+   NCT G
Sbjct: 158 TKITPKLLDSLQEAGGVESNVAIGYHAIEFLLWGQDLNGTGPGAGKRPATDYSATNCTNG 217

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDIN-AGLNSIITGMTSLSYNE 266
           +C RR  YLK  + +LV+DL +M K WG  G+A   + K  + A L +I+TG+ SLSY E
Sbjct: 218 NCDRRGAYLKAATDLLVADLTDMTKWWGAKGKARAAVAKQKDKAALGTILTGLGSLSYGE 277

Query: 267 LAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD 326
           LAGERM LGLILHDPE+E DCFSDNTY S+  D +GI S Y G+Y R++G  + GAS+  
Sbjct: 278 LAGERMKLGLILHDPEEEHDCFSDNTYNSHYYDELGIASIYRGKYTRVDGSVVEGASVAA 337

Query: 327 LISHNNRNLAQEINDKFSNTMKDFHILKDRAEN-IESFDQMISENNPEGNKIVRNLINDL 385
             +      A+E + K    +     +KD  ++  E++DQMI E N  GN +V+  ++ L
Sbjct: 338 YAAAKAPKAAEEADAKVDAALAALKAIKDEGDSGKEAYDQMIGEGNAAGNALVQKGVDSL 397

Query: 386 ITQTESLRKIRIALDL 401
           + QT ++  +  AL L
Sbjct: 398 VAQTRAIEGVVAALKL 413


>gi|152996576|ref|YP_001341411.1| putative iron-regulated protein [Marinomonas sp. MWYL1]
 gi|150837500|gb|ABR71476.1| putative iron-regulated protein [Marinomonas sp. MWYL1]
          Length = 431

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 180/381 (47%), Positives = 257/381 (67%), Gaps = 3/381 (0%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           ++ + V+ +YA IA A Y D+L  A+TL S+IET +  P + NL+ AR +WI AR+PYQQ
Sbjct: 32  ITADSVVVHYADIAEAVYGDSLTTAKTLRSSIETFLANPTEVNLKAARAEWIAARVPYQQ 91

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS-SYGKENEENNLYTANIIANSKIIVNE 142
           SEVYRFGN IVD W+ KVNAWPLDEG IDYV + SYG E++ N LY AN+IA++ +++  
Sbjct: 92  SEVYRFGNPIVDEWEGKVNAWPLDEGLIDYVAADSYGTESDLNPLYAANVIASTSLMIGG 151

Query: 143 KEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
            +ID + I+P+L+   L  A+G++ N+ +GYH IEFLLWGQDL       G RP TDFD+
Sbjct: 152 VKIDTTNITPELIADSLQEADGVEANVASGYHAIEFLLWGQDLNGTNPGAGERPATDFDL 211

Query: 202 GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM-KDINAGLNSIITGMT 260
            NCT G+C RR +YL   + +L+SDLEEM   W   G A   L+ +    GL++I+TGM 
Sbjct: 212 NNCTNGNCDRRRDYLVAATDLLISDLEEMANNWKQGGAARVALLEQSAEQGLSTILTGMG 271

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
           SL+Y EL GER  LGL+LHDPE+E DCFSDNT+ S+  D  GI ++Y GEY R++G  + 
Sbjct: 272 SLAYGELGGERTKLGLMLHDPEEEHDCFSDNTHWSHYYDAKGIKNAYLGEYKRVDGSWVK 331

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
           GAS+ DL++  N  L  E+  K + T      + D A+  ++FD +I+ NN +GN++V+N
Sbjct: 332 GASLSDLVAKQNPQLDIEMKQKLNETEAAAQAMVDAAKKGQTFDVLIAMNNTKGNQLVQN 391

Query: 381 LINDLITQTESLRKIRIALDL 401
            ++ L+ +T +  ++   L+L
Sbjct: 392 FVDSLVNETRTTEEVIHELNL 412


>gi|326794858|ref|YP_004312678.1| peptidase M75, Imelysin [Marinomonas mediterranea MMB-1]
 gi|326545622|gb|ADZ90842.1| Peptidase M75, Imelysin [Marinomonas mediterranea MMB-1]
          Length = 453

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 176/384 (45%), Positives = 251/384 (65%), Gaps = 9/384 (2%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
           +VS E V+  YA IA A Y D+LM A+TL S +   +  P + NL+  +  WI +R PYQ
Sbjct: 53  SVSAEAVVTQYADIAEAIYGDSLMTAKTLQSGVNAFLLDPTEANLQKVKDAWIASRAPYQ 112

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS-SYGKENEENNLYTANIIANSKIIVN 141
           QSEVYRFGN IVD W+ KVNAWPLDEG IDYVDS SYG E++ N+LYTAN+IAN+ +++ 
Sbjct: 113 QSEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDSESYGSESDVNDLYTANVIANTSLMIG 172

Query: 142 EKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            +++D + I+P L+   L  A+G++ N+ +GYH IEFLLWGQDL       G R  TDFD
Sbjct: 173 GEKVDTTYITPALISDVLQEADGVEANVASGYHAIEFLLWGQDLHGTNPGAGERKATDFD 232

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM-KDINAGLNSIITGM 259
           + NCT G+C RR +YLK  + +LVSDLEEM   W   G A  +L  K  + GL +++TGM
Sbjct: 233 LANCTNGNCDRRRDYLKAATDLLVSDLEEMAANWKVGGAARAELAEKGTDGGLATMLTGM 292

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            SL+Y EL GER  LGL+LHDPE+E DCFSDNT+ S+  D  GI + Y G+Y R++G  +
Sbjct: 293 GSLAYGELGGERTKLGLMLHDPEEEHDCFSDNTHWSHYYDAKGIENVYLGKYQRVDGSWV 352

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVR 379
            G S+ +L+++ +  L  ++  + + T      + + A   ++FD +I+ NN  GN +V+
Sbjct: 353 EGPSLSNLVANKDAALDVKMKAQLTKTDAAGKAMTEAAAQGQTFDVLIAMNNEAGNAMVQ 412

Query: 380 NLINDLITQTESLRKIRIALDLIE 403
           N ++ L+ +T      R+  D+I+
Sbjct: 413 NFVDQLVAET------RVTEDVIQ 430


>gi|158424368|ref|YP_001525660.1| uncharacterized iron-regulated protein [Azorhizobium caulinodans
           ORS 571]
 gi|158331257|dbj|BAF88742.1| uncharacterized iron-regulated protein [Azorhizobium caulinodans
           ORS 571]
          Length = 436

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 174/376 (46%), Positives = 246/376 (65%), Gaps = 3/376 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+ +YA +A A Y D+   A  +  AI+  +  P+ +  + A+  W +ARI Y ++E +R
Sbjct: 42  VITSYADLAQAMYTDSYTAAAEMQKAIDAFIAAPSAETQKAAQEAWRKARISYMKTEGFR 101

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDS-SYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           FGNKIVD W+  VNAWPLDEG IDYVD+ SYG +++EN LYTANIIAN  I + +K ID 
Sbjct: 102 FGNKIVDEWEGNVNAWPLDEGLIDYVDTKSYGTKSDENPLYTANIIANKSIRIGKKTIDT 161

Query: 148 SIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
           + ++P+LL KL+ A G++ N+ +G+H IEFLLWGQDL       G RPYTD+D   CT G
Sbjct: 162 TNLTPELLHKLNSAGGVEANVASGWHAIEFLLWGQDLHGTGPGAGERPYTDYDKNACTHG 221

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM-KDINAGLNSIITGMTSLSYNE 266
           +C RR +YLKV +  LV+DL+EM + WGP G+A   L+ K+  AGL +I TG+ SLSY E
Sbjct: 222 NCERRAQYLKVATDTLVADLKEMAEDWGPKGKARAALLKKNDKAGLATIFTGIGSLSYGE 281

Query: 267 LAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD 326
           LAGERM LGLILHDPE+E DCFSDNT+ S+  D +GI   Y G   R +G    G S+ D
Sbjct: 282 LAGERMKLGLILHDPEEEHDCFSDNTHNSHYYDEVGIADIYYGRTKRYDGSTFTGPSVAD 341

Query: 327 LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES-FDQMISENNPEGNKIVRNLINDL 385
           L+   +  +A EI+ K         ++KD A++    +D M++E N EGNK++++ ++ L
Sbjct: 342 LVRAKDAKIADEIDAKIKGADAALKVIKDTADSGRMYYDMMLAEGNAEGNKMIQDGVDAL 401

Query: 386 ITQTESLRKIRIALDL 401
           + Q  ++ +   AL +
Sbjct: 402 VAQAHAIERGVAALKI 417


>gi|146279058|ref|YP_001169217.1| hypothetical protein Rsph17025_3028 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557299|gb|ABP71912.1| Uncharacterized iron-regulated protein-like protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 422

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 180/400 (45%), Positives = 256/400 (64%), Gaps = 5/400 (1%)

Query: 6   IISIVFTLPSHALSIVPNVSLEK--VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           ++++  T P  AL  +P +++E+  V++ YA IA A Y D+L  AR L  A++ LV  P+
Sbjct: 5   LLALAATAPC-ALLPLPALAVERAEVVETYADIAEATYGDSLATARDLQMAVKALVAQPS 63

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           ++ L  AR  WI AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD ++G   E
Sbjct: 64  EQTLAAARTAWIAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDPTHGGATE 123

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQ 182
           EN+L T N+IA     ++  E+D + I+P L+   LH A+GI+ N+ +GYH IEFLLWGQ
Sbjct: 124 ENDLATLNVIATPTFTLSGTEVDATEITPALISGTLHEADGIEANVASGYHAIEFLLWGQ 183

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           DL       GNRPYTD+  G  CTGG+C RR  YL   + +LVSDLE M+  W   G A 
Sbjct: 184 DLNGTEAGAGNRPYTDYASGGACTGGNCDRRGAYLLAATDLLVSDLEYMVAQWSEGGAAR 243

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
             +  D  AGL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +
Sbjct: 244 NAVSADPAAGLQAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYYDGL 303

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y G Y R++G ++ G S+ DL++  +  L + +  +   T++    L+  A    
Sbjct: 304 GIRNVYLGRYERVDGSRVEGPSLSDLVAEADTGLDEVLRGQLDTTLERLDALRTAAAEGM 363

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           ++DQM++  N  G +++   ++ L+TQT S+ +   AL L
Sbjct: 364 AYDQMLAPGNKRGEELIMGAVDALVTQTASIERATTALGL 403


>gi|83944208|ref|ZP_00956664.1| lipoprotein, putative [Sulfitobacter sp. EE-36]
 gi|83845075|gb|EAP82956.1| lipoprotein, putative [Sulfitobacter sp. EE-36]
          Length = 419

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 172/393 (43%), Positives = 247/393 (62%), Gaps = 6/393 (1%)

Query: 9   IVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLE 68
           +  TL S AL+    V   +V+  YA IA A Y D+L+ A+ L  A++ L+  P+   ++
Sbjct: 10  LALTLASPALA----VEKSEVIDTYADIAEAAYGDSLITAQALVDAVDALIAEPSADTMQ 65

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
            AR  W+ AR+PYQQ+E YRFGN IVD W+ K+NAWPLDEG IDYVD+SYG   +EN   
Sbjct: 66  AARTAWLAARVPYQQTEAYRFGNPIVDDWEGKLNAWPLDEGLIDYVDASYGGATDENAAA 125

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
             N+IAN    ++  E+D S I+PD L + LH A+G + N+ +GYH +EFLLWGQDL   
Sbjct: 126 ALNVIANPTFTLSGTEVDASTITPDFLAETLHEADGNEANVASGYHAVEFLLWGQDLNGT 185

Query: 188 VREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
               G R +TD+  G +CT  +C RR +YLK  + ++V+DLE M+  W   G A  +L  
Sbjct: 186 EHGAGGRDWTDYATGEDCTNDNCDRRGQYLKAAADLIVTDLEYMVAQWAEGGAARTNLTD 245

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
           + +  +++++TGM SLSY ELAGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI + 
Sbjct: 246 NEDGAISAMLTGMGSLSYGELAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIQNV 305

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
           Y G Y R +G  + G S+ DL++  N +L  E+    S TM+    +K  AE   S+DQM
Sbjct: 306 YLGAYARTDGTLVTGPSLSDLVAAENADLDAEMQLNLSTTMRKLGQIKTAAEAGMSYDQM 365

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
           ++  N  G  +V   +N LI QT+++ ++   L
Sbjct: 366 MARGNKGGEALVMGGVNALIAQTKTIERVVATL 398


>gi|83955090|ref|ZP_00963746.1| lipoprotein, putative [Sulfitobacter sp. NAS-14.1]
 gi|83840419|gb|EAP79592.1| lipoprotein, putative [Sulfitobacter sp. NAS-14.1]
          Length = 419

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 171/393 (43%), Positives = 247/393 (62%), Gaps = 6/393 (1%)

Query: 9   IVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLE 68
           +  TL S AL+    V   +V+  YA IA A Y D+L+ A+ L  A++ L+  P+   ++
Sbjct: 10  LALTLASPALA----VEKSEVIDTYADIAEAAYGDSLITAQALVDAVDALIAEPSADTMQ 65

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
            AR  W+ AR+PYQQ+E YRFGN IVD W+ K+NAWPLDEG IDYVD+SYG   +EN   
Sbjct: 66  AARTAWLAARVPYQQTEAYRFGNPIVDDWEGKLNAWPLDEGLIDYVDASYGGATDENAAA 125

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
             N+IAN    ++  E+D S I+PD L + LH A+G + N+ +GYH +EF+LWGQDL   
Sbjct: 126 ALNVIANPTFTLSGTEVDASTITPDFLAETLHEADGNEANVASGYHAVEFMLWGQDLNGT 185

Query: 188 VREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
               G R +TD+  G+ CT  +C RR +YLK  + ++V+DLE M+  W   G A  +L  
Sbjct: 186 KHGAGARDWTDYATGDDCTNDNCDRRGQYLKAAADLIVTDLEYMVAQWAEGGAARTNLTD 245

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
           + +  +++++TGM SLSY ELAGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI + 
Sbjct: 246 NEDGAISAMLTGMGSLSYGELAGERMRLGLMLNDPEEEQDCFSDNTHNSHYYDGLGIQNV 305

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
           Y G Y R +G  + G S+ DL++  N +L  E+    S TM+    +K  AE   S+DQM
Sbjct: 306 YLGAYARTDGTLVTGPSLSDLVAAENADLDAEMQLNLSTTMRKLGQIKTAAEAGMSYDQM 365

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
           ++  N  G  +V   +N LI QT+++ ++   L
Sbjct: 366 MARGNKGGEALVMGGVNALIAQTKTIERVVATL 398


>gi|85706973|ref|ZP_01038063.1| lipoprotein, putative [Roseovarius sp. 217]
 gi|85668584|gb|EAQ23455.1| lipoprotein, putative [Roseovarius sp. 217]
          Length = 420

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 173/401 (43%), Positives = 251/401 (62%), Gaps = 6/401 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +T  +I   L   A +   N    +VL  YA IA A Y D+L   R L+ A+  L+ +P
Sbjct: 5   LLTSTAIATALLGSAQAQTAN----EVLDTYADIAEANYGDSLEAVRALEKAVTALIKSP 60

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + +++  AR  W++AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD  YG   
Sbjct: 61  SAESMSAARDAWLQARVPYQQTEVFRFGNPIVDDWEGKVNAWPLDEGLIDYVDGLYGGPT 120

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           + N     N+IAN    ++ KEID + I+PDLL   LH A+GI+ N+ TGYH IEFLLWG
Sbjct: 121 DANQFAALNVIANPSFSLSGKEIDATEITPDLLENILHEADGIEANVATGYHAIEFLLWG 180

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDL  +    G+RP+TD+    +CT G+C RR +YL   + +L SDLE +   W  DG+A
Sbjct: 181 QDLNGHGDGAGSRPWTDYAQNEDCTNGNCERRADYLMAATDLLSSDLEWITAQWAKDGEA 240

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              +  D  AGL +I+TGM SLSY E AGERM LGL+L+DPE+E  CF+DNT+  +  + 
Sbjct: 241 RATITADEQAGLTAILTGMGSLSYGETAGERMRLGLMLNDPEEEHSCFADNTHNDHYYNG 300

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +GI S Y G Y+R +G  + GAS+ DL+++ +  L +E+  + +  +     +K  AE+ 
Sbjct: 301 VGIRSVYLGNYVRTDGTTVSGASLSDLVANIDPELDREMRTRLAEAVLALGRIKTAAESG 360

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            ++D+M++  +  G  ++   ++ LI QT S+ ++  ALDL
Sbjct: 361 FAYDEMLARGDEGGEALIMGGVDGLINQTRSIERVVTALDL 401


>gi|159043116|ref|YP_001531910.1| iron-regulated protein [Dinoroseobacter shibae DFL 12]
 gi|157910876|gb|ABV92309.1| iron-regulated protein [Dinoroseobacter shibae DFL 12]
          Length = 420

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 176/396 (44%), Positives = 257/396 (64%), Gaps = 8/396 (2%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           +  T +++V   P+ A          +VL +YA +A AKYED+L+ A+ L +A++ LV+T
Sbjct: 6   HLSTALALVLATPAFATEPA------EVLDHYADMAVAKYEDSLITAQRLQAAVDALVST 59

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ + L  AR  W+ AR+PYQQSEVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  
Sbjct: 60  PSAEALTAARAAWLAARVPYQQSEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGP 119

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
            +EN   + N+IA+    ++  E+D + I+P LL + LH A+G++ N+ TGYH IEFLLW
Sbjct: 120 TDENAFASLNVIASPTFTLSGAEVDATEITPALLEETLHEADGVEANVATGYHAIEFLLW 179

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GQDL  +   PG+RP+TD+  G+ CT G+C RR  +LK  + +LVSDLE M+  W  DG 
Sbjct: 180 GQDLNGHGAGPGDRPWTDYAPGDDCTNGNCDRRGAFLKAATDLLVSDLEWMVAQWADDGA 239

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
           A  +L  D  AG+ +I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  +
Sbjct: 240 ARAELTADAEAGIAAILTGMGSLSYGETAGERMRLGVMLNDPEEEHSCFADNTHNDHFYN 299

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
            IGI + Y GEY+R++G  + G ++ DL+   +  L  E+  K +  +     +K  AE 
Sbjct: 300 GIGIQNVYLGEYVRVDGTLVSGPALSDLVVAADPALDAEMQGKLAMAVMQLGRIKTAAEA 359

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKI 395
             ++DQM+ + N  G  ++   +N L+ QT S+ ++
Sbjct: 360 GFAYDQMLEQGNAAGEALIMGGVNGLVDQTRSIERV 395


>gi|126727963|ref|ZP_01743787.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2150]
 gi|126702766|gb|EBA01875.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2150]
          Length = 419

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 178/400 (44%), Positives = 256/400 (64%), Gaps = 6/400 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           +++   +I   L + AL+    V    VL  YA IA A Y D+L+ A+ L +A+  LV  
Sbjct: 3   HYLLTTAIAVGLATPALA----VETTDVLDTYADIAAANYGDSLITAQRLQTAVNALVAD 58

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ +NL  AR  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  
Sbjct: 59  PSAENLTAARAAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGP 118

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLW 180
           ++EN     N+IAN    ++ ++ID + I+P LL   L  A+G++ N+ TGYH IEFLLW
Sbjct: 119 SDENAFAALNVIANPTFTLSGQDIDATSITPALLEDTLQEADGVEANVATGYHAIEFLLW 178

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GQDL  +    G+RP+TD+ +G+ CT G+C RR EYL   + +L+SDLE M  AW   G+
Sbjct: 179 GQDLNGHGTGAGDRPWTDYAMGDDCTNGNCDRRGEYLTAATDLLISDLEYMAGAWADGGE 238

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
           A  +LM D + G+++I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  +
Sbjct: 239 ARTELMSDADVGISAILTGMGSLSYGETAGERMRLGVMLNDPEEEHSCFADNTHNDHYYN 298

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
            +GI + Y GEYIR++G  I G S+ DL++  +  L  E+  K  + +     +K  AE 
Sbjct: 299 GVGIQNVYLGEYIRVDGSLITGPSLSDLVAETDAALDAEMQGKLGDAVMALGRIKIAAEA 358

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
             ++DQM+   N  G  ++   +N LI QT S+ ++  AL
Sbjct: 359 GFAYDQMLERGNEAGEALIMGGVNGLIDQTRSIERVITAL 398


>gi|255264811|ref|ZP_05344153.1| hypothetical protein TR2A62_0089 [Thalassiobium sp. R2A62]
 gi|255107146|gb|EET49820.1| hypothetical protein TR2A62_0089 [Thalassiobium sp. R2A62]
          Length = 419

 Score =  352 bits (902), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 178/399 (44%), Positives = 256/399 (64%), Gaps = 6/399 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           ++   +I   L + AL+    V    VL  YA IA A Y D+L+ A+ L +A+  LV  P
Sbjct: 4   YLLTTAIAVGLATPALA----VETTDVLDTYADIAAANYGDSLITAQRLQAAVNALVADP 59

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + +NL  AR  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  +
Sbjct: 60  SAENLTAARAAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPS 119

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWG 181
           +EN     N+IAN    ++ ++ID + I+P LL   L  A+G++ N+ TGYH IEFLLWG
Sbjct: 120 DENAFAALNVIANPTFTLSGQDIDATSITPALLEDTLQEADGVEANVATGYHAIEFLLWG 179

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDL  +    G+RP+TD+ +G+ CT G+C RR EYL   + +L+SDLE M  AW   G+A
Sbjct: 180 QDLNGHGTGAGDRPWTDYAMGDECTNGNCDRRGEYLTAATDLLISDLEYMAGAWAIGGEA 239

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
             +LM D +AG+++I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  + 
Sbjct: 240 RSELMSDADAGISAILTGMGSLSYGETAGERMRLGVMLNDPEEEHSCFADNTHNDHYYNG 299

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +GI + Y GEYIR++G  + G S+ DL++  +  L  E+  K  + +     +K  AE  
Sbjct: 300 VGIQNVYLGEYIRVDGSLVTGPSLSDLMAETDAALDAEMQGKLGDAVMALGRIKIAAEAG 359

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            ++DQM+   N EG  ++   +N LI QT  + ++  AL
Sbjct: 360 FAYDQMLERGNVEGEALIMGGVNGLIDQTRFIERVIAAL 398


>gi|254438835|ref|ZP_05052329.1| hypothetical protein OA307_3705 [Octadecabacter antarcticus 307]
 gi|198254281|gb|EDY78595.1| hypothetical protein OA307_3705 [Octadecabacter antarcticus 307]
          Length = 419

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 172/394 (43%), Positives = 253/394 (64%), Gaps = 7/394 (1%)

Query: 13  LPSHALSIVPNVSL-----EKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           L S AL+ V  ++      + VL  Y+ IA A Y+D+L  A+TL +A+  L+  P + NL
Sbjct: 5   LLSTALTFVAPIAFAAGHAQDVLTTYSNIAEANYQDSLTTAQTLQTAVNALIVDPTEINL 64

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           + A+  W  AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN  
Sbjct: 65  QAAKAAWSAARVPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDENEF 124

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
              N+IAN    ++   ID S I+PD L  +LH A+G+++N+ TGYH +EFLLWGQDL  
Sbjct: 125 AALNVIANPTFTLSGANIDASAITPDFLEGQLHEADGVESNVATGYHAVEFLLWGQDLNG 184

Query: 187 NVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM 245
           +    G RP TD+ +G+ CT G+C RR +YL+  + +LV+DLE M + W   G A   +M
Sbjct: 185 HGTGAGMRPATDYAMGDDCTNGNCDRRGDYLQAATDLLVADLEWMAEQWTEGGDARASVM 244

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
            D +AG+ +I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  + +G+ +
Sbjct: 245 ADEDAGIATILTGMGSLSYGEAAGERMRLGVMLNDPEEEHSCFADNTHNDHYYNGVGVQN 304

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQ 365
            Y G Y R++G  + GAS+ DL++ ++ +L  E+  K S T+++   +K  AE   ++D 
Sbjct: 305 VYLGSYTRIDGTVVSGASLADLVAGSDGDLDTEMRTKLSATIRELGDIKHAAEAGFAYDM 364

Query: 366 MISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
           M+   N  G  ++   +N  I QT S+ ++   L
Sbjct: 365 MLEAGNAAGEDLIMGGVNAFIDQTRSIERVVAVL 398


>gi|288961780|ref|YP_003452090.1| hypothetical protein AZL_c02530 [Azospirillum sp. B510]
 gi|288914060|dbj|BAI75546.1| hypothetical protein AZL_c02530 [Azospirillum sp. B510]
          Length = 424

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 177/377 (46%), Positives = 240/377 (63%), Gaps = 5/377 (1%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V +NYA IAHA YEDA   A+ L  A++ L+  P ++NL  AR  W  AR+PY Q+E +R
Sbjct: 31  VAKNYADIAHAAYEDATNGAKALKKAVDALIANPTEENLTKARDVWKAARVPYMQTEAFR 90

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD SY    E N    AN+IAN KI    K ID +
Sbjct: 91  FGNPIVDEWEGKVNAWPLDEGLIDYVDESYAG-GESNPYAKANVIANPKITAGGKTIDAT 149

Query: 149 IISPDLL-RKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CTG 206
            I+ +LL  KLH A  ++ N+ TGYH IEFLLWGQDL       G R  TD+  G  CT 
Sbjct: 150 KITKELLAEKLHEAGKVEANVATGYHAIEFLLWGQDLHGTGPGAGERKATDYAKGKACTN 209

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA-GLNSIITGMTSLSYN 265
            HC RR +YLKV +++LV DL EM   W   G+A   + K   + G+  ++TG+ SLSY 
Sbjct: 210 DHCDRRAQYLKVATQMLVDDLAEMTADWSAKGKARVSIAKAPESEGVARMLTGLGSLSYG 269

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D +G+++ Y G Y R +G+ + GAS+ 
Sbjct: 270 ELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYDEVGMVNVYNGSYKRTDGKTVSGASLS 329

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE-SFDQMISENNPEGNKIVRNLIND 384
            L++  + +    +    ++TMK    +KD A++ + ++DQMI  +NPEGNK+V + I+ 
Sbjct: 330 QLVAAKSADADAAVKAAMADTMKAMQAIKDTADSGKMAYDQMIGADNPEGNKLVSDGIDR 389

Query: 385 LITQTESLRKIRIALDL 401
           L+ Q ++L     AL +
Sbjct: 390 LVAQKKALEGAVAALGV 406


>gi|254440885|ref|ZP_05054378.1| hypothetical protein OA307_300 [Octadecabacter antarcticus 307]
 gi|198250963|gb|EDY75278.1| hypothetical protein OA307_300 [Octadecabacter antarcticus 307]
          Length = 419

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 172/394 (43%), Positives = 253/394 (64%), Gaps = 7/394 (1%)

Query: 13  LPSHALSIVPNVSL-----EKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           L S AL+ V  ++      + VL  Y+ IA A Y+D+L  A+TL +A+  L+  P + NL
Sbjct: 5   LLSTALTFVAPIAFAAGHAQDVLTTYSNIAEANYQDSLTTAQTLQTAVNALIVDPTEINL 64

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           + A+  W  AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN  
Sbjct: 65  QAAKAAWFAARVPYQQTEVYRFGNSIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDENKF 124

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
              N+IAN    ++   ID S I+PD L  +LH A+G+++N+ TGYH +EFLLWGQDL  
Sbjct: 125 AALNVIANPTFTLSGANIDASAITPDFLEGQLHEADGVESNVATGYHAVEFLLWGQDLNG 184

Query: 187 NVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM 245
           +    G RP TD+ +G+ CT G+C RR +YL+  + +LV+DLE M + W   G A   +M
Sbjct: 185 HGTGAGMRPATDYAMGDDCTNGNCDRRGDYLQAATDLLVADLEWMAEQWTEGGDARASVM 244

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
            D +AG+ +I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  + +G+ +
Sbjct: 245 ADEDAGIATILTGMGSLSYGETAGERMRLGVMLNDPEEEHSCFADNTHNDHYYNGVGVQN 304

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQ 365
            Y G Y R++G  + GAS+ DL++ ++ +L  E+  K S T+++   +K  AE   ++D 
Sbjct: 305 VYLGSYTRIDGTVVSGASLADLVAGSDGDLDTEMRTKLSATIRELGDIKHAAEAGFAYDM 364

Query: 366 MISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
           M+   N  G  ++   +N  I QT S+ ++   L
Sbjct: 365 MLEAGNAAGEDLIMGGVNAFIDQTRSIERVVAVL 398


>gi|126729383|ref|ZP_01745197.1| lipoprotein, putative [Sagittula stellata E-37]
 gi|126710373|gb|EBA09425.1| lipoprotein, putative [Sagittula stellata E-37]
          Length = 419

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 175/396 (44%), Positives = 256/396 (64%), Gaps = 4/396 (1%)

Query: 8   SIVFTLPSHALSIVPNVSLE--KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           ++  T  + +L   P  + +  +VL  YA IA A YED+L  A+ L  A++ L+  P++ 
Sbjct: 3   TLTTTAAAMSLCAAPLFAADSAEVLDTYADIAQAGYEDSLTTAKALQKAVDALIANPSED 62

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
            L  AR  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN
Sbjct: 63  TLAAARDAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDEN 122

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDL 184
                N+IA     ++ +EID S I+P+L+ + LH A+G++ N+ +GYH IEFLLWGQDL
Sbjct: 123 QFAGLNVIATPSFTLSGEEIDASEITPELIAETLHEADGVEANVASGYHAIEFLLWGQDL 182

Query: 185 KTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                  G+R + D+  G+ CT G+C RR EYL+  +++LVSDLE M   W   G A   
Sbjct: 183 NGTDAGAGDRSFADYASGDACTNGNCDRRAEYLQAATELLVSDLEWMAAQWQEGGAARDA 242

Query: 244 LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           LM+D +AG+ +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D  G+
Sbjct: 243 LMEDEDAGIVAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHFYDGKGV 302

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESF 363
            + Y G Y R++G ++ GAS+ DL++  +  L +E+  K   TM++   +   AE+  S+
Sbjct: 303 QNVYLGSYTRVDGTEVTGASLSDLVAEADPALDEEMKAKLHTTMENLGAIVAAAEDGFSY 362

Query: 364 DQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
           D M+   N EG  ++   ++ L+ QT S+ ++  AL
Sbjct: 363 DMMLERGNAEGEALIMGGVDALVDQTRSIERVVSAL 398


>gi|149203191|ref|ZP_01880161.1| lipoprotein, putative [Roseovarius sp. TM1035]
 gi|149143024|gb|EDM31063.1| lipoprotein, putative [Roseovarius sp. TM1035]
          Length = 420

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 175/401 (43%), Positives = 249/401 (62%), Gaps = 6/401 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +T  +++  L   AL+  P      VL  YA IA A Y D+L  A+ L +A+  L+ +P
Sbjct: 5   LLTTTAVIAALGGTALAQTPG----DVLDTYADIAAANYTDSLTAAQALQTAVAALIQSP 60

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +   L+ AR  W+ AR+PYQQSEV+RFGN IVD W+ +VNAWPLDEG IDYVD +YG   
Sbjct: 61  SAATLQAARAAWLAARVPYQQSEVFRFGNAIVDDWEGRVNAWPLDEGLIDYVDGAYGGAT 120

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           ++N L   N+IAN    ++ +EID + I+P LL++ LH A+G++ N+ TGYH IEFLLWG
Sbjct: 121 DQNQLAALNVIANPVFTLSGQEIDATEITPALLQETLHEADGVEANVATGYHAIEFLLWG 180

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDL  +    G+RP+TD+  G +CTGG+C RR EYL   +K+LV DL+ M   W   G A
Sbjct: 181 QDLNGHGDGAGDRPWTDYAQGADCTGGNCDRRAEYLAAATKLLVGDLDWMTTQWADGGAA 240

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              LM D  AGL +I+TGM SLSY E AGERM LGL+L+DPE+E  CF+DNT+  +  + 
Sbjct: 241 RAALMADERAGLAAILTGMGSLSYGETAGERMRLGLMLNDPEEEHSCFADNTHNDHFYNG 300

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +GI + Y G Y R +G  + G S+  L++     L  E+  + ++ +     +K  AE  
Sbjct: 301 VGIRNVYLGSYTRTDGTSVSGPSLSGLVAEIAPTLDVEMRARLADAVLALGRIKTSAEAG 360

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            ++D+M+   N  G  ++   +  LI QT S+ ++  ALDL
Sbjct: 361 FAYDEMLERGNAGGEALIMGGVEGLIAQTRSIERVIAALDL 401


>gi|260432801|ref|ZP_05786772.1| hypothetical protein SL1157_1935 [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416629|gb|EEX09888.1| hypothetical protein SL1157_1935 [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 423

 Score =  346 bits (887), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 181/376 (48%), Positives = 252/376 (67%), Gaps = 2/376 (0%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +VL  YA IA A YED+L  A+ L +AI+ L+ TP+ + L  AR  WI AR+PYQQ+EVY
Sbjct: 29  QVLNTYADIAQAAYEDSLAAAKRLRAAIDMLIETPSAEALHAARAAWIAARVPYQQTEVY 88

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ KVNAWPLDEG IDYVD++YG   +EN L   N+IAN    ++ + ID 
Sbjct: 89  RFGNPIVDDWEGKVNAWPLDEGLIDYVDAAYGGVTDENALAALNVIANPTFQLSGETIDA 148

Query: 148 SIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CT 205
           + I+P LL + LH A+G++ N+ TGYH IEFLLWGQD+  +    G+RP+TD+  G+ CT
Sbjct: 149 TDITPALLAETLHEADGVEANVATGYHAIEFLLWGQDMNGHGPGSGDRPWTDYAQGDACT 208

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYN 265
           GG+C RR +YL+  + +LVSDLE M   W   G A   L ++ +AGL +++TGM SLSY 
Sbjct: 209 GGNCDRRAQYLQAATDLLVSDLEWMATQWQDGGAARAALFENESAGLTAMLTGMGSLSYG 268

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI + Y G Y+R++G  + G S+ 
Sbjct: 269 EQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIQNVYLGSYVRIDGTLVSGPSLS 328

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           DL+  +   L  E+  K ++TM+    +K  AE   ++DQM+   N  G  ++   +N L
Sbjct: 329 DLVMASAPELDDEMKTKLADTMQALGRIKTTAEAGLAYDQMLERGNAGGEALIMGGVNAL 388

Query: 386 ITQTESLRKIRIALDL 401
           I QT+++ +I  ALDL
Sbjct: 389 IDQTKTIERIVTALDL 404


>gi|56695014|ref|YP_165360.1| putative lipoprotein [Ruegeria pomeroyi DSS-3]
 gi|56676751|gb|AAV93417.1| lipoprotein, putative [Ruegeria pomeroyi DSS-3]
          Length = 420

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 176/385 (45%), Positives = 247/385 (64%), Gaps = 4/385 (1%)

Query: 21  VPNVSLEK--VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           VP  + ++  VL  YA IA AKY+D+L+ AR L  A++ L+  P+ + L  A+  W+ AR
Sbjct: 17  VPAWAADRAAVLTTYADIAEAKYQDSLITARALQVAVDALIADPSAQTLAAAKQAWLAAR 76

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
            PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SY   ++EN     N+IA    
Sbjct: 77  DPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYPGASDENGYAALNVIATPVF 136

Query: 139 IVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYT 197
            ++   +D S I+P+LL   LH A+G++ N+ TGYH IEFLLWGQDL       GNRP+T
Sbjct: 137 DLSGTTVDASQITPELLSGTLHEADGVEANVATGYHAIEFLLWGQDLNGTGPGAGNRPWT 196

Query: 198 DFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSII 256
           D+  G +CTGG+C RR  YL+  + +L+SDLE M   W P G A   +  D  AGL +++
Sbjct: 197 DYAPGADCTGGNCDRRGAYLQAATDLLISDLEWMAAQWAPGGDARTSVTADETAGLVAML 256

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
           TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI + Y G Y R++G
Sbjct: 257 TGMGSLSYGEQAGERMRLGLLLNDPEEEHDCFSDNTHNSHYFDGLGIRNVYLGSYTRVDG 316

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
             I GAS+ DL++  +  L  E+ D+ + TM     ++  A+   ++DQM++  N EG  
Sbjct: 317 TVISGASLSDLVADADAALDAEVKDRLNITMDALGAIRSAAKGGFAYDQMLARGNAEGEA 376

Query: 377 IVRNLINDLITQTESLRKIRIALDL 401
           ++   ++ L+ Q  S +++   L L
Sbjct: 377 LIMAGVDGLVEQARSFQRLFPVLGL 401


>gi|307545021|ref|YP_003897500.1| iron-regulated protein [Halomonas elongata DSM 2581]
 gi|307217045|emb|CBV42315.1| K07231 putative iron-regulated protein [Halomonas elongata DSM
           2581]
          Length = 427

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 173/395 (43%), Positives = 239/395 (60%), Gaps = 7/395 (1%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           +++   LP  A++    V+ E+V+ +YA +AHA Y+DAL+ ARTLD  I+ L+  PN + 
Sbjct: 14  VALAALLPVTAMAADSEVTAEQVVDHYADLAHANYQDALVAARTLDERIDALLADPNDET 73

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  W+ AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV S   +    N 
Sbjct: 74  LAAARQAWLEARVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGMIDYVASDDYQHELGNA 133

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
             TANIIAN  I V  + +D+S ++P+LL +L+   G + N+ TGYH IEFLLWGQDL  
Sbjct: 134 GATANIIANQSIQVGGEIVDVSELTPELLAELNEIGGSEANVATGYHAIEFLLWGQDLHG 193

Query: 187 NVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD-- 243
                G RP +D+  G  CT GHC RR  YL   S +LVSDLE M+  W PD        
Sbjct: 194 FEAGNGERPASDYMSGEACTHGHCDRRSAYLDATSDLLVSDLEWMVAQWAPDEDDNYRRA 253

Query: 244 -LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
            L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  G
Sbjct: 254 LLAESPKEGLRRMLFGMGSLSLGELAGERMKVALEANSVEDEHDCFSDNTHNSHYYNGQG 313

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE- 361
           I + YTG Y R++G  + G S+ DL++  +  L   +  + +++M     LK  AE  + 
Sbjct: 314 IQNVYTGSYQRLDGSTLEGPSLSDLVATRDNTLDDTLKAQLTSSMDALEALKQAAEAEQD 373

Query: 362 --SFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
             +FD MI+  N +G ++V N I  L+TQT S+ K
Sbjct: 374 PMAFDMMIAPGNEQGAELVNNAILALVTQTGSIEK 408


>gi|37680303|ref|NP_934912.1| uncharacterized iron-regulated protein [Vibrio vulnificus YJ016]
 gi|37199050|dbj|BAC94883.1| uncharacterized iron-regulated protein [Vibrio vulnificus YJ016]
          Length = 423

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 165/403 (40%), Positives = 248/403 (61%), Gaps = 8/403 (1%)

Query: 10  VFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
           V TL +    +  NV+ ++V+++YA +AHA + D+L  A+ L+  +E  ++ P+   LE 
Sbjct: 16  VTTLFASGHLLAANVTNQQVVEHYADVAHAVFADSLTTAQQLEKKVEQFLSAPSAAKLEE 75

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
            +  W+ AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E   N    
Sbjct: 76  VKQAWLAARVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSTDYQYE-LGNEGAK 134

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
           ANI+AN+ + +   ++D+S+I+P+L+ +L+   G + N+ +GYH IEFLLWGQDL     
Sbjct: 135 ANIVANTTLKIGASQLDVSVITPELIAELNEVGGSEANVASGYHAIEFLLWGQDLNGTNA 194

Query: 190 EPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLM- 245
             G R YTDF +G+ CT GHC RR  YLK  +++LV+DLE M K W     G   ++L+ 
Sbjct: 195 GAGQRAYTDFVVGSQCTNGHCDRRGAYLKAAAQLLVTDLEWMEKQWSAQEKGNYRQELLA 254

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
           +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI +
Sbjct: 255 QSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYN 314

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI-ESFD 364
            YTG Y R++G  + G S+HDL++  ++N A+EI  +F  T      L   AE   + FD
Sbjct: 315 VYTGIYKRVDGSLLTGPSLHDLVAQQDKNTAKEIQAQFDTTRAQVGKLVTSAEKQNQHFD 374

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           Q+I+  N +GN +V   I  L+ QT ++ +    + +D + P+
Sbjct: 375 QLIAAGNAQGNALVNETIMSLVAQTSAIERAAKIVGIDSLNPD 417


>gi|27366244|ref|NP_761772.1| Iron-regulated protein A [Vibrio vulnificus CMCP6]
 gi|27362445|gb|AAO11299.1| Iron-regulated protein A precursor [Vibrio vulnificus CMCP6]
          Length = 427

 Score =  330 bits (846), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 168/409 (41%), Positives = 251/409 (61%), Gaps = 11/409 (2%)

Query: 7   ISIVF---TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           IS VF   TL +    +  NV+ ++V+++YA +AHA + D+L  A+ L+  +E  ++ P+
Sbjct: 14  ISPVFSSTTLFASGHLLAANVTNQQVVEHYADVAHAVFADSLTTAQQLEKKVEQFLSAPS 73

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
              LE  +  W+ AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E  
Sbjct: 74  AAKLEEVKQAWLDARVPYQQSEVFRFGNTVVDDWEGQLNAWPLDEGLIDYVSTDYQYE-L 132

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
            N    ANI+AN+ + +   ++D+S+I+P+L+ +L+   G + N+ +GYH IEFLLWGQD
Sbjct: 133 GNEGAKANIVANTTLKIGASQLDVSVITPELIAELNEVGGSEANVASGYHAIEFLLWGQD 192

Query: 184 LKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQA 240
           L       G R YTDF +G+ CT GHC RR  YLK  +++LV+DLE M K W     G  
Sbjct: 193 LNGTNAGAGQRAYTDFVVGSQCTNGHCDRRGAYLKAAAQLLVTDLEWMEKQWSAQEKGNY 252

Query: 241 TKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
            ++L+ +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +
Sbjct: 253 RQELLAQSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYN 312

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
             GI + YTG Y R++G  + G S+HDL++  ++N A+EI  +F  T      L   AE 
Sbjct: 313 EQGIYNVYTGIYKRVDGSLLTGPSLHDLVAQQDKNAAKEIQAQFDTTRAQVGKLVTSAEK 372

Query: 360 I-ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
             + FDQ+I+  N +GN +V   I  L+ QT ++ +    + +D + P+
Sbjct: 373 QNQHFDQLIAAGNAQGNALVNETIMSLVAQTSAIERAAKIVGIDSLNPD 421


>gi|156974993|ref|YP_001445900.1| hypothetical protein VIBHAR_02715 [Vibrio harveyi ATCC BAA-1116]
 gi|156526587|gb|ABU71673.1| hypothetical protein VIBHAR_02715 [Vibrio harveyi ATCC BAA-1116]
          Length = 423

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 167/400 (41%), Positives = 248/400 (62%), Gaps = 8/400 (2%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           L +   ++   V+ ++V+++YA +AHA + D+L  A+TLD  I+  + +P+ K LE  + 
Sbjct: 19  LIASGSTVAATVTKQQVVEHYADVAHAVFADSLTTAQTLDVKIDEFLKSPSAKKLEEVKQ 78

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N    ANI
Sbjct: 79  AWLDSRVPYQQSEVFRFGNAIVDDWEGELNAWPLDEGLIDYVAADYQYE-LGNEGAAANI 137

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           +AN+ + +   ++D+S I+P+L+  L+   G + N+ +GYH IEFLLWGQDL       G
Sbjct: 138 VANTSLQIGASKLDVSKITPELIADLNEVGGSEANVASGYHAIEFLLWGQDLNGTNAGAG 197

Query: 193 NRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKD-I 248
            R YTDF +G+ CT GHC RR EYLK  + +LV DLE M K W  D  G   ++L+ D  
Sbjct: 198 QRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADVKGNYREELLNDSA 257

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
           + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YT
Sbjct: 258 DNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYT 317

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMI 367
           G Y  ++G+++ G SI DL++  ++  A+EI  +F  T      L   AE N + FDQ+I
Sbjct: 318 GTYKGVSGKELSGPSIADLVAQKDKKAAEEIQKQFDTTRSQVGELVTSAEKNNQHFDQLI 377

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           +  N +GN +V + I  L+ QT ++ +    + +D + P+
Sbjct: 378 AAGNAQGNALVNDTIMSLVAQTGAIERAANIVGIDSLSPD 417


>gi|154247126|ref|YP_001418084.1| putative iron-regulated protein [Xanthobacter autotrophicus Py2]
 gi|154161211|gb|ABS68427.1| putative iron-regulated protein [Xanthobacter autotrophicus Py2]
          Length = 428

 Score =  329 bits (843), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 168/377 (44%), Positives = 237/377 (62%), Gaps = 5/377 (1%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+ +YA +A A Y  +   A+ +   I + +  P+   L  AR  W  AR+ Y Q+E +R
Sbjct: 34  VIVHYADLAQAMYGSSAATAKDMQKVILSFLDAPSADTLAKARDAWKAARVFYMQTEGFR 93

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDS-SYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           FGNK VD  +  VNAWPLDEG IDYVD  SYG++++EN LYTAN+I++  I + +K ID 
Sbjct: 94  FGNKAVDKIEGDVNAWPLDEGLIDYVDKKSYGEKSDENPLYTANVISSKSIRIGKKTIDT 153

Query: 148 SIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
           + I+P+LL  L+ A G++ N+ +G+H IEFLLWGQ+L       G+RPYTDFD+ NCT  
Sbjct: 154 TKITPELLHSLNTAGGVEANVGSGWHAIEFLLWGQNLHDPKINAGSRPYTDFDLKNCTNA 213

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL--MKDINAGLNSIITGMTSLSYN 265
           +C RR EYLKV +  LV+DLE+M   WGP G     L  MKD  A L  I TG+ SLSY 
Sbjct: 214 NCDRRAEYLKVATATLVADLEDMAALWGPQGAGRTTLLKMKDKPA-LAVIFTGLGSLSYG 272

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           ELAGERM LGLILHD E+  DCFS+NT+ S+  D +GI   Y G Y + +G    G S+ 
Sbjct: 273 ELAGERMKLGLILHDTEEAQDCFSNNTHNSHYYDEVGIRDIYYGRYTKPDGTVFSGPSVA 332

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE-SFDQMISENNPEGNKIVRNLIND 384
           DLI   +  +A EI+ K    +     +KD A++ E  +DQM++E N +G +++++ ++ 
Sbjct: 333 DLIRAADPKIADEIDQKSDAALAALKKIKDTADSGEIYYDQMLAEGNVKGGQLIQDGVDA 392

Query: 385 LITQTESLRKIRIALDL 401
           L+ Q  ++ +   AL L
Sbjct: 393 LVAQAHAIERGVSALKL 409


>gi|320156753|ref|YP_004189132.1| iron-regulated protein A [Vibrio vulnificus MO6-24/O]
 gi|319932065|gb|ADV86929.1| iron-regulated protein A precursor [Vibrio vulnificus MO6-24/O]
          Length = 420

 Score =  328 bits (841), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 164/403 (40%), Positives = 248/403 (61%), Gaps = 8/403 (1%)

Query: 10  VFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
           V TL +    +  NV+ ++V+++YA +AHA + D+L  A+ L+  +E  ++ P+   LE 
Sbjct: 13  VTTLFASGHLLAANVTNQQVVEHYADVAHAVFADSLTTAQQLEKKVEQFLSAPSAAKLEE 72

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
            +  W+ AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E   N    
Sbjct: 73  VKQAWLDARVPYQQSEVFRFGNVVVDDWEGQLNAWPLDEGLIDYVSTDYQYE-LGNEGAK 131

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
           ANI+AN+ + +   ++D+S+I+P+L+ +L+   G + N+ +GYH IEFLLWGQDL     
Sbjct: 132 ANIVANTTLKIGASQLDVSVITPELIAELNEVGGSEANVASGYHAIEFLLWGQDLNGTNA 191

Query: 190 EPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLM- 245
             G R YTDF +G+ CT GHC RR  YLK  +++LV+DLE M K W     G   ++L+ 
Sbjct: 192 GAGQRAYTDFVVGSQCTNGHCDRRGAYLKAAAQLLVTDLEWMEKQWSAQEKGNYRQELLA 251

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
           +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI +
Sbjct: 252 QSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYN 311

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI-ESFD 364
            YTG Y R++G  + G S+HDL++  ++N A+EI  +F  T      +   AE   + FD
Sbjct: 312 VYTGIYKRVDGSLLTGPSLHDLVAQQDKNAAKEIQAQFDTTRAQVGKIVTSAEKQNQHFD 371

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           Q+I+  N +GN +V   I  L+ QT ++ +    + +D + P+
Sbjct: 372 QLIAAGNAQGNALVNETIMSLVAQTSAIERAAKIVGIDSLNPD 414


>gi|153835282|ref|ZP_01987949.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           harveyi HY01]
 gi|148868218|gb|EDL67364.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           harveyi HY01]
          Length = 420

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 167/400 (41%), Positives = 248/400 (62%), Gaps = 8/400 (2%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           L +   ++   V+ ++V+++YA +AHA + D+L  A+TLD  I+  + +P+ K LE  + 
Sbjct: 16  LIASGSTVAAIVTKQQVVEHYADVAHAVFADSLTTAQTLDVKIDEFLKSPSAKKLEEVKQ 75

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N    ANI
Sbjct: 76  AWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAADYQYE-LGNEGAAANI 134

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           +AN+ + +   ++D+S I+P+L+  L+   G + N+ +GYH IEFLLWGQDL       G
Sbjct: 135 VANTSLQIGASKLDVSKITPELIADLNEVGGSEANVASGYHAIEFLLWGQDLNGTNAGAG 194

Query: 193 NRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKD-I 248
            R YTDF +G+ CT GHC RR EYLK  + +LV DLE M K W  D  G   ++L+ D  
Sbjct: 195 QRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADVKGNYREELLNDSA 254

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
           + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YT
Sbjct: 255 DNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYT 314

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMI 367
           G Y  ++G+++ G SI DL++  ++  A+EI  +F  T      L   AE N + FDQ+I
Sbjct: 315 GTYKGVSGKELSGPSIADLVAQKDKKAAEEIQKQFDTTRSQVGELVTSAEKNNQHFDQLI 374

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           +  N +GN +V + I  L+ QT ++ +    + +D + P+
Sbjct: 375 AAGNAQGNALVNDTIMSLVAQTGAIERAANIVGIDSLSPD 414


>gi|91227199|ref|ZP_01261658.1| putative iron-regulated protein A [Vibrio alginolyticus 12G01]
 gi|91188727|gb|EAS75015.1| putative iron-regulated protein A [Vibrio alginolyticus 12G01]
          Length = 420

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 167/400 (41%), Positives = 246/400 (61%), Gaps = 8/400 (2%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           L +   ++   V+ ++V+++YA +AHA + D++  A+ LD  I+  + +P+ K LE  + 
Sbjct: 16  LIASGSTVAATVTKQQVVEHYADVAHAVFADSVTTAKALDVKIDEFLQSPSAKKLEEVKQ 75

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N    ANI
Sbjct: 76  AWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAADYQYE-LGNEGAAANI 134

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           IAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G
Sbjct: 135 IANTSLQIGASKLDVSKITPELLADLNEVGGSEANVASGYHAIEFLLWGQDLNGTNAGAG 194

Query: 193 NRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKD-I 248
            R YTDF +G+ CT GHC RR EYLK  + +LV DLE M K W  +  G   ++L+ D  
Sbjct: 195 QRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKGNYREELLNDSA 254

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
           + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YT
Sbjct: 255 DNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYT 314

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMI 367
           G Y  +NG+++ G SI DL++  ++  A EI  +F  T      L   AE N + FDQ+I
Sbjct: 315 GTYKGVNGKELSGPSIADLVAQKDKKAATEIQKQFDTTRSQVGELVTSAEKNNQHFDQLI 374

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           +  N +GN +V + I  L+ QT ++ +    + +D + P+
Sbjct: 375 AAGNAQGNALVNDTIMSLVAQTGAIERAASIVGIDSLSPD 414


>gi|254507004|ref|ZP_05119142.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus 16]
 gi|219549999|gb|EED26986.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus 16]
          Length = 420

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 170/395 (43%), Positives = 242/395 (61%), Gaps = 11/395 (2%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           ++    L S ++     V+ E+V+++YA IAHA +ED+L  A+ LD +IE+ + TP+   
Sbjct: 11  VAASLVLASSSV-FAAKVTKEQVVEHYADIAHAVFEDSLTTAKKLDKSIESFLATPSAAK 69

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--NEE 124
           LE  +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E  NE 
Sbjct: 70  LEEVKQAWLDSRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSTDYQHELGNEG 129

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
            N   ANI+AN ++ +    +D+S ++P  +  L+   G + N+ +GYH IEFLLWGQDL
Sbjct: 130 AN---ANIVANKQLKIGATTMDVSQLTPKAIADLNEIGGSEANVASGYHAIEFLLWGQDL 186

Query: 185 KTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQAT 241
                  G RPYTDF +G  CT G+C RR EYLK  +++L+ DLE M K W  D  G   
Sbjct: 187 NGTNAGAGQRPYTDFVVGEGCTNGNCERRGEYLKATAQLLIQDLEWMEKQWSADEKGNYR 246

Query: 242 KDLMKDINA-GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
            +L+ D +  GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  + 
Sbjct: 247 AELLSDSSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNE 306

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-N 359
            GI + YTG Y R +G  + G SI+DL++  ++  A+EI  +F  T      L   AE N
Sbjct: 307 QGIYNVYTGLYKRQDGTLLSGPSINDLVAQKDQQAAKEIQKQFDVTRSQVGQLVTSAENN 366

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
            E FDQ+I+  N +GN +V   I  L+ QT S+ +
Sbjct: 367 GEFFDQLIASGNVKGNALVNETIMSLVAQTASIER 401


>gi|269961719|ref|ZP_06176080.1| iron-regulated protein A, putative [Vibrio harveyi 1DA3]
 gi|269833584|gb|EEZ87682.1| iron-regulated protein A, putative [Vibrio harveyi 1DA3]
          Length = 420

 Score =  325 bits (834), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 166/400 (41%), Positives = 246/400 (61%), Gaps = 8/400 (2%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           L +   ++   V+ ++V+++YA +AHA + D++  A+ LD  I+  + +P+ K LE  + 
Sbjct: 16  LIASGSTVAATVTKQQVVEHYADVAHAVFADSVTTAKALDVKIDEFLKSPSAKKLEEVKQ 75

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N    ANI
Sbjct: 76  AWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAADYQYE-LGNEGAAANI 134

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           IAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G
Sbjct: 135 IANTSLQIGASKLDVSKITPELLADLNEVGGSEANVASGYHAIEFLLWGQDLNGTNAGAG 194

Query: 193 NRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKD-I 248
            R YTDF +G+ CT GHC RR EYLK  + +LV DLE M K W  +  G   ++L+ +  
Sbjct: 195 QRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKGNYREELLNESA 254

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
           + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YT
Sbjct: 255 DNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYT 314

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMI 367
           G Y  +NG+++ G SI DL++  ++  A EI  +F  T      L   AE N + FDQ+I
Sbjct: 315 GTYKGVNGKELSGPSIADLVAQKDKKAATEIQKQFDTTRNQVGELVTSAEKNNQHFDQLI 374

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           +  N +GN +V + I  L+ QT ++ +    + +D + P+
Sbjct: 375 AAGNAQGNALVNDTIMSLVAQTGAIERAANIVGIDSLSPD 414


>gi|269967081|ref|ZP_06181149.1| iron-regulated protein A, putative [Vibrio alginolyticus 40B]
 gi|269828340|gb|EEZ82606.1| iron-regulated protein A, putative [Vibrio alginolyticus 40B]
          Length = 419

 Score =  325 bits (833), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 166/400 (41%), Positives = 244/400 (61%), Gaps = 8/400 (2%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           L +   ++   V+ ++V+++YA +AHA + D++  A+ LD  I+  + +P+ K LE  + 
Sbjct: 15  LIASGSTVAATVTKQQVVEHYADVAHAVFADSVTTAKALDVKIDEFLQSPSAKKLEEVKQ 74

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N    ANI
Sbjct: 75  AWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAADYQYE-LGNEGAAANI 133

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           IAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G
Sbjct: 134 IANTSLQIGASKLDVSKITPELLADLNEVGGSEANVASGYHAIEFLLWGQDLNGTNAGAG 193

Query: 193 NRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKD-I 248
            R YTDF +G+ CT GHC RR EYLK  + +LV DLE M K W  +  G   ++L+ +  
Sbjct: 194 QRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKGNYREELLNESA 253

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
             GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YT
Sbjct: 254 ENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYT 313

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMI 367
           G Y  +NG+ + G SI DL++  ++  A EI  +F  T      L   AE N + FDQ+I
Sbjct: 314 GTYKGVNGKALSGPSIADLVAQKDKKAATEIQKQFDTTRSQVGELVTSAEKNNQHFDQLI 373

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           +  N +GN +V + I  L+ QT ++ +    + +D + P+
Sbjct: 374 AAGNAQGNALVNDTIMSLVAQTGAIERAASIVGIDSLSPD 413


>gi|311695455|gb|ADP98328.1| lipoprotein [marine bacterium HP15]
          Length = 428

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 166/387 (42%), Positives = 238/387 (61%), Gaps = 9/387 (2%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
            V+ +YA +AHA YEDAL+ AR LD A + L+  P + NL  A+  W+ AR+PYQQ+EV+
Sbjct: 36  SVVDHYADLAHANYEDALITARALDEATDRLIANPTEANLATAKEAWLAARVPYQQTEVF 95

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ ++NAWPLDEG IDYV +   +    N   TANIIA+++I V  + +++
Sbjct: 96  RFGNAIVDDWEGQLNAWPLDEGLIDYVKADGYQHELGNAGATANIIASNRINVGGETLNV 155

Query: 148 SIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTG 206
           + +SP LL  L+   G + N+ TGYH +EFLLWGQDL       G RP TD+  G +CT 
Sbjct: 156 ASLSPALLADLNEVGGSEANVATGYHAVEFLLWGQDLHGFESGAGERPVTDYAKGADCTN 215

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLS 263
           G+C RR EYL  V+ +LVSDLE M+  W P   D    +    D N G+  ++ GM SLS
Sbjct: 216 GNCERRGEYLDAVTDLLVSDLEWMVAQWAPGASDNYRAQLTAADANQGVQKMLFGMGSLS 275

Query: 264 YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
             ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG Y R++G  + G S
Sbjct: 276 LGELAGERMKVALEANSYEDEHDCFSDNTHNSHYYNGQGIQNVYTGTYRRVDGSLVTGPS 335

Query: 324 IHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE---SFDQMISENNPEGNKIVRN 380
           + DL+  ++  L   +N++   +M+   ++K RAE+ E   +FD MI+  N EG +IV  
Sbjct: 336 LSDLVQQSDPELDARLNNQLDASMEALALMKARAESSENPMAFDTMIAPGNAEGTRIVNG 395

Query: 381 LINDLITQTESLRKIR--IALDLIEPN 405
            I  L+ QT S+ +    + ++ + P+
Sbjct: 396 AIMALVAQTGSIEQAARDLGIEALSPD 422


>gi|261253184|ref|ZP_05945757.1| iron-regulated protein A precursor [Vibrio orientalis CIP 102891]
 gi|260936575|gb|EEX92564.1| iron-regulated protein A precursor [Vibrio orientalis CIP 102891]
          Length = 420

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 164/382 (42%), Positives = 235/382 (61%), Gaps = 10/382 (2%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
              NV+ ++V+++YA +AHA + D++  A+ LD +IE  +  P     E  +  W+ +R+
Sbjct: 23  FAANVTKDQVVEHYADVAHAVFADSVTTAKALDVSIENFLANPTAAKFEQVKQVWLASRV 82

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--NEENNLYTANIIANSK 137
           PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E  NE  N   ANI+AN++
Sbjct: 83  PYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSADYQYELGNEGAN---ANIVANTE 139

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYT 197
           + +   ++D++ I+P L+  L+   G + N+ +GYH IEFLLWGQDL       G R YT
Sbjct: 140 LTIGASKLDVAKITPQLIADLNEVGGSEANVASGYHAIEFLLWGQDLNGTNAGAGQRAYT 199

Query: 198 DFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKD-INAGLN 253
           DF +G  CT GHC RR ++LK  +++LV DLE M   W  D  G   ++L+ D  + GL 
Sbjct: 200 DFVVGAECTNGHCDRRGDFLKAAAELLVQDLEWMENQWSADVKGNYREELLNDSADNGLR 259

Query: 254 SIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR 313
            ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG Y R
Sbjct: 260 KMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYTGLYKR 319

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNP 372
            +G  + G SIHDL+S N++  AQEI  +F  T      L   AE N + FDQ+I+  N 
Sbjct: 320 EDGTLLSGPSIHDLVSQNDKQAAQEIQKQFDMTRSQVGQLVTSAEKNNQYFDQLIAAGNT 379

Query: 373 EGNKIVRNLINDLITQTESLRK 394
           +GN +V + I  L+ QT  + +
Sbjct: 380 QGNALVNDTIMSLVAQTVQIER 401


>gi|28898694|ref|NP_798299.1| putative iron-regulated protein A [Vibrio parahaemolyticus RIMD
           2210633]
 gi|28806912|dbj|BAC60183.1| putative iron-regulated protein A [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 429

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 244/400 (61%), Gaps = 8/400 (2%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           L +   ++   V+ ++V+++YA +AHA + D+L  A+TL+  I+  +  P++  LE+ + 
Sbjct: 25  LIASGTTVAAQVTKQQVVEHYADVAHAVFADSLTTAKTLEVKIDEFLKAPSEAKLEDVKQ 84

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E   N    ANI
Sbjct: 85  AWLESRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVAADYQYE-LGNEGAAANI 143

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           IAN+ + +   ++D++ I+P+LL  L+   G + N+ TGYH IEFLLWGQDL       G
Sbjct: 144 IANTSLTIGPSKLDVAKITPELLASLNEVGGSEANVATGYHAIEFLLWGQDLNGTNAGAG 203

Query: 193 NRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMK-DI 248
            R YTDF +G+ CT GHC RR EYLK  + +LV DLE M K W  D  G   ++L+    
Sbjct: 204 KRAYTDFVVGSGCTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADEKGNYRQELLTGSA 263

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
             GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YT
Sbjct: 264 ENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYT 323

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMI 367
           G Y R +G  + G SI +L++  ++  A+EI  +F  T      L   AE + + FDQ+I
Sbjct: 324 GTYSRQDGTVLTGPSIANLVAQEDKKAAEEIQKQFDATRSQVGELVTSAEKHNQHFDQLI 383

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           +  N +GN +V + I  L+ QT ++ +    + +D + P+
Sbjct: 384 AAGNAQGNALVNDTIMALVAQTGAIERAAGIVGIDSLSPD 423


>gi|153839462|ref|ZP_01992129.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AQ3810]
 gi|260363707|ref|ZP_05776491.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus K5030]
 gi|260879726|ref|ZP_05892081.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AN-5034]
 gi|260898800|ref|ZP_05907241.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus Peru-466]
 gi|260901613|ref|ZP_05910008.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AQ4037]
 gi|149747019|gb|EDM58007.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AQ3810]
 gi|308086683|gb|EFO36378.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus Peru-466]
 gi|308093281|gb|EFO42976.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AN-5034]
 gi|308108687|gb|EFO46227.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AQ4037]
 gi|308113404|gb|EFO50944.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus K5030]
          Length = 420

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 244/400 (61%), Gaps = 8/400 (2%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           L +   ++   V+ ++V+++YA +AHA + D+L  A+TL+  I+  +  P++  LE+ + 
Sbjct: 16  LIASGTTVAAQVTKQQVVEHYADVAHAVFADSLTTAKTLEVKIDEFLKAPSEAKLEDVKQ 75

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E   N    ANI
Sbjct: 76  AWLESRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVAADYQYE-LGNEGAAANI 134

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           IAN+ + +   ++D++ I+P+LL  L+   G + N+ TGYH IEFLLWGQDL       G
Sbjct: 135 IANTSLTIGPSKLDVAKITPELLASLNEVGGSEANVATGYHAIEFLLWGQDLNGTNAGAG 194

Query: 193 NRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMK-DI 248
            R YTDF +G+ CT GHC RR EYLK  + +LV DLE M K W  D  G   ++L+    
Sbjct: 195 KRAYTDFVVGSGCTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADEKGNYRQELLTGSA 254

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
             GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YT
Sbjct: 255 ENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYT 314

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMI 367
           G Y R +G  + G SI +L++  ++  A+EI  +F  T      L   AE + + FDQ+I
Sbjct: 315 GTYSRQDGTVLTGPSIANLVAQEDKKAAEEIQKQFDATRSQVGELVTSAEKHNQHFDQLI 374

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           +  N +GN +V + I  L+ QT ++ +    + +D + P+
Sbjct: 375 AAGNAQGNALVNDTIMALVAQTGAIERAAGIVGIDSLSPD 414


>gi|260776049|ref|ZP_05884944.1| iron-regulated protein A precursor [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607272|gb|EEX33537.1| iron-regulated protein A precursor [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 420

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 164/393 (41%), Positives = 241/393 (61%), Gaps = 7/393 (1%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           ++    L S ++    NV+ E+V+++YA +AHA + DAL  A+TLD +IE+ +  P++  
Sbjct: 11  VATSLVLASSSV-FAANVTKEQVVEHYADVAHAVFADALTTAKTLDQSIESFLAAPSEAK 69

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L   +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E   N 
Sbjct: 70  LAEVKQAWLDSRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSTDYQYE-LGNE 128

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
             +ANI+AN ++ +   ++D++ ++P+ +  L+   G + N+ +GYH IEFLLWGQDL  
Sbjct: 129 GASANIVANKQLTIGATKLDVAQLTPEAIADLNEVGGSEANVASGYHAIEFLLWGQDLNG 188

Query: 187 NVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKD 243
                G R YTDF +G  CT G+C RR EYLK  + +LV DL+ M K W  D  G   ++
Sbjct: 189 TNAGAGERAYTDFVVGKGCTNGNCDRRGEYLKAAADLLVQDLQWMEKQWSSDVKGNYREE 248

Query: 244 LMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
           L+ D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  G
Sbjct: 249 LLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQG 308

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIE 361
           I + YTG Y R +G  + G SI DL++  ++  A+EI  +F  T      L   AE N +
Sbjct: 309 IYNVYTGLYKREDGTLLSGPSIADLVAQKDKAAAKEIQKQFDVTRSQVGQLVTSAEKNGQ 368

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
            FDQ+I+  N +GN +V   I  L+ QT S+ +
Sbjct: 369 YFDQLIAAGNAQGNALVNETIMSLVAQTSSIER 401


>gi|328474741|gb|EGF45546.1| putative iron-regulated protein A [Vibrio parahaemolyticus 10329]
          Length = 420

 Score =  322 bits (826), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 244/400 (61%), Gaps = 8/400 (2%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           L +   ++   V+ ++V+++YA +AHA + D+L  A+TL+  I+  +  P++  LE+ + 
Sbjct: 16  LIASGTTVAAQVTKQQVVEHYADVAHAVFADSLTTAKTLEVKIDEFLKAPSEAKLEDVKQ 75

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E   N    ANI
Sbjct: 76  AWLESRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVAADYQYE-LGNEGAAANI 134

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           IAN+ + +   ++D++ I+P+LL  L+   G + N+ TGYH IEFLLWGQDL       G
Sbjct: 135 IANTSLTIGPSKLDVAKITPELLASLNEVGGSEANVATGYHAIEFLLWGQDLNGTNAGAG 194

Query: 193 NRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMK-DI 248
            R YTDF +G+ CT GHC RR EYLK  + +LV DLE M K W  D  G   ++L+    
Sbjct: 195 QRAYTDFVVGSGCTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADEKGNYRQELLTGSA 254

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
             GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YT
Sbjct: 255 ENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYT 314

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMI 367
           G Y R +G  + G SI +L++  ++  A+EI  +F  T      L   AE + + FDQ+I
Sbjct: 315 GTYSRQDGTVLTGPSIANLVAQEDKKAAEEIQKQFDVTRSQVGELVTSAEKHNQHFDQLI 374

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           +  N +GN +V + I  L+ QT ++ +    + +D + P+
Sbjct: 375 AAGNAQGNALVNDTIMALVAQTGAIERAAGIVGIDSLSPD 414


>gi|262393894|ref|YP_003285748.1| iron-regulated protein A [Vibrio sp. Ex25]
 gi|262337488|gb|ACY51283.1| iron-regulated protein A precursor [Vibrio sp. Ex25]
          Length = 420

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 168/400 (42%), Positives = 243/400 (60%), Gaps = 8/400 (2%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           L +   ++   V+ ++V+++YA +AHA + D++  A+TLD  I+  + +P+   LE  + 
Sbjct: 16  LIASGSTVAAQVTKQQVVEHYADVAHAVFADSVTTAKTLDVKIDEFLKSPSADKLEEVKQ 75

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N    ANI
Sbjct: 76  AWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVATDYQYE-LGNEGAAANI 134

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           IAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G
Sbjct: 135 IANTSLQIGASKLDVSNITPELLADLNEVGGSEANVASGYHAIEFLLWGQDLNGTNAGAG 194

Query: 193 NRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKD-I 248
            R YTDF +G+ CT GHC RR EYLK  + +LV DLE M K W  +  G   +  + D  
Sbjct: 195 QRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKGNYRETFLNDSA 254

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
           + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YT
Sbjct: 255 DNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYT 314

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMI 367
           G Y R +G  + G SI DL++  ++  A+EI  +F  T      L   AE N + FDQ+I
Sbjct: 315 GLYKREDGTLLSGPSIADLVAQKDKQAAKEIQKQFDVTRNQVGKLVTSAEKNNQHFDQLI 374

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           +  N +GN +V + I  L+ QT S+ +    I +D + P+
Sbjct: 375 AAGNAQGNTLVNDTIMSLVAQTGSIERAAGIIGIDSLSPD 414


>gi|89073973|ref|ZP_01160479.1| hypothetical protein SKA34_15425 [Photobacterium sp. SKA34]
 gi|89050301|gb|EAR55805.1| hypothetical protein SKA34_15425 [Photobacterium sp. SKA34]
          Length = 417

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 170/394 (43%), Positives = 240/394 (60%), Gaps = 10/394 (2%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           I + +FTLP+    +    + ++V+ +YA +AH  Y DAL  A+ LD AI  LV  P++K
Sbjct: 10  IAAAIFTLPT----VTQAATKQEVVTHYADLAHNVYSDALTTAKDLDKAIAALVANPSEK 65

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
            L  AR+ W  +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N
Sbjct: 66  TLSAARIAWKASRVPYQQSEVFRFGNGIVDDWEGQLNAWPLDEGLIDYVANDYQHE-LGN 124

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
               ANI+A++ + V  KEID++ I+P+L+  L+   G + N+ +GYH IEFLLWGQDL 
Sbjct: 125 EGAKANIVASNTLNVGNKEIDVTKITPELIAGLNELGGSEANVASGYHAIEFLLWGQDLN 184

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA---T 241
                 G+R +TDF  G  CT G+C RR EYL   S++L++DL+ M K W         +
Sbjct: 185 GTKSGAGDRKFTDFVKGEACTNGNCDRRAEYLTASSQLLINDLQWMEKQWSATEAKNYRS 244

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
           + L +  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  
Sbjct: 245 ELLAESADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQ 304

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NI 360
           GI + YTG Y R NGE + G SI+DL++  ++  A EI  +F  T      L D AE + 
Sbjct: 305 GIYNVYTGTYTRTNGEVLTGPSINDLVAAQDKKAAAEIKAEFDKTRAQLQTLVDSAEKDN 364

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
           + FDQ+I+ +N  G+ +V   I  L+ QT  + K
Sbjct: 365 QHFDQLIATDNKAGHALVNKSIMALVQQTAEIEK 398


>gi|323492413|ref|ZP_08097561.1| iron-regulated protein A precursor [Vibrio brasiliensis LMG 20546]
 gi|323313200|gb|EGA66316.1| iron-regulated protein A precursor [Vibrio brasiliensis LMG 20546]
          Length = 420

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 164/382 (42%), Positives = 236/382 (61%), Gaps = 10/382 (2%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
              NV+ E+V+++YA +AHA + D+L  A+ LD +IE+ +  P     +  +  W+ +R+
Sbjct: 23  FAANVTKEQVVEHYADVAHAVFADSLTTAKALDQSIESFLANPTADKFQQVKQVWLASRV 82

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--NEENNLYTANIIANSK 137
           PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV S Y  E  NE  N   ANI+AN+K
Sbjct: 83  PYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVSSDYQYELGNEGAN---ANIVANTK 139

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYT 197
           + +    +D++ I+P+L+  L+   G + N+ +GYH IEFLLWGQDL       G R YT
Sbjct: 140 LTIGASTLDVAKITPELIADLNEVGGSEANVASGYHAIEFLLWGQDLNGTNAGAGARAYT 199

Query: 198 DFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKD-INAGLN 253
           DF +G  CT G+C RR ++LK  +++LV DLE M K W  D  G   ++L+ D  + GL 
Sbjct: 200 DFVVGEACTNGNCDRRGDFLKAAAELLVQDLEWMEKQWSADVKGNYREELLNDSADNGLR 259

Query: 254 SIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR 313
            ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG Y R
Sbjct: 260 KMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYTGLYKR 319

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNP 372
            +G  + G SI+DL++  ++  A+EI  +F  T      L   AE N + FDQ+I+  N 
Sbjct: 320 EDGSLLSGPSINDLVAQKDKQAAKEIQKQFDVTRSQVGQLVTSAEKNNQFFDQLIAAGNT 379

Query: 373 EGNKIVRNLINDLITQTESLRK 394
           +GN +V + I  L+ QT  + +
Sbjct: 380 QGNALVNDTIMSLVAQTAQIER 401


>gi|254230285|ref|ZP_04923674.1| hypothetical protein VEx25_B0317 [Vibrio sp. Ex25]
 gi|151937182|gb|EDN56051.1| hypothetical protein VEx25_B0317 [Vibrio sp. Ex25]
          Length = 419

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 168/400 (42%), Positives = 243/400 (60%), Gaps = 8/400 (2%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           L +   ++   V+ ++V+++YA +AHA + D++  A+TLD  I+  + +P+   LE  + 
Sbjct: 15  LIASGSTVAAQVTKQQVVEHYADVAHAVFADSVTTAKTLDVKIDEFLKSPSADKLEEVKQ 74

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N    ANI
Sbjct: 75  AWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVATDYQYE-LGNEGAAANI 133

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           IAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G
Sbjct: 134 IANTSLQIGASKLDVSNITPELLADLNEVGGSEANVASGYHAIEFLLWGQDLNGTNAGAG 193

Query: 193 NRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKD-I 248
            R YTDF +G+ CT GHC RR EYLK  + +LV DLE M K W  +  G   +  + D  
Sbjct: 194 QRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKGNYRETFLNDSA 253

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
           + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YT
Sbjct: 254 DNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYT 313

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMI 367
           G Y R +G  + G SI DL++  ++  A+EI  +F  T      L   AE N + FDQ+I
Sbjct: 314 GLYKREDGTLLSGPSIADLVAQKDKQAAKEIQKQFDVTRNQVGKLVTSAEKNNQHFDQLI 373

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           +  N +GN +V + I  L+ QT S+ +    I +D + P+
Sbjct: 374 AAGNAQGNTLVNDTIMSLVAQTGSIERAAGIIGIDSLSPD 413


>gi|229592249|ref|YP_002874368.1| hypothetical protein PFLU4859 [Pseudomonas fluorescens SBW25]
 gi|229364115|emb|CAY51736.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 447

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 232/378 (61%), Gaps = 7/378 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+ +YA +  A Y DA   A+TL +AI+  +  PN + L+ AR  WI AR+P
Sbjct: 52  VDEAAAKAVVAHYADMVFAVYSDAESTAKTLQTAIDAFLAKPNDETLKAARTAWIAARVP 111

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSEV+RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   TANIIAN++I V
Sbjct: 112 YLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGATANIIANTEIQV 170

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+ 
Sbjct: 171 GEDKVDVKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYL 230

Query: 201 IGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ----ATKDLMKDINAGLNSI 255
            G+  TGGH  RR  YL+ V+++LVSDLEEM+  W P+ +    AT +     + GL  +
Sbjct: 231 TGDGATGGHNERRRTYLRAVTQLLVSDLEEMVGNWKPNVEDNYRATLEAEPATD-GLRKM 289

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           + GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R++
Sbjct: 290 LFGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGIRNVYLGEYTRVD 349

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGN 375
           G K+ GAS+  L++  +      +    + T     ++ D A   E +DQ+I+  N  GN
Sbjct: 350 GTKLTGASLSSLVAKADPAADTALKADLAATEAKIQVMVDHANKGEHYDQLIAAGNDAGN 409

Query: 376 KIVRNLINDLITQTESLR 393
           +IVR+ I  L+ QT S+ 
Sbjct: 410 QIVRDAIAALVKQTGSIE 427


>gi|302608206|emb|CBW44452.1| putative iron-regulated protein A precursor [Marinobacter
           hydrocarbonoclasticus]
          Length = 431

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 236/387 (60%), Gaps = 9/387 (2%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
            V+ +YA +AHA YEDAL+ AR LD A + L+  P + NL+ A+  W+ +R+PYQQSEV+
Sbjct: 39  SVVTHYADLAHATYEDALITARALDEATDRLIANPTEANLKAAKEAWLASRVPYQQSEVF 98

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ ++NAWPLDEG IDYV +   +    N   TANI+A++ I V  + +D+
Sbjct: 99  RFGNAIVDDWEGQLNAWPLDEGLIDYVKADDYQHELGNAGATANIVASNSINVGGETLDV 158

Query: 148 SIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CTG 206
           + ++P+LL  L+   G + N+ TGYH +EFLLWGQDL       G RP TD+  GN CT 
Sbjct: 159 ATLTPELLADLNEVGGSEANVATGYHAVEFLLWGQDLHGFEGGAGERPVTDYAKGNDCTN 218

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLS 263
           G+C RR +YL  V+ +LV DLE M+  W P   D   ++    + + G+  ++ GM SLS
Sbjct: 219 GNCERRAQYLDAVTDLLVDDLEWMVAQWAPGTSDNYRSQLTSANADEGIQKMLFGMGSLS 278

Query: 264 YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
             ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG Y R++G  + G S
Sbjct: 279 LGELAGERMKVALEANSYEDEHDCFSDNTHNSHYYNGQGIQNVYTGTYRRVDGSVVSGPS 338

Query: 324 IHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE---NIESFDQMISENNPEGNKIVRN 380
           + DL+   N  L   +N +   +M+   ++K RAE   N  +FD MI+  N EG +IV  
Sbjct: 339 LSDLVEQTNPELDARLNRQLDASMEALALMKARAESSQNPMAFDTMIAPGNAEGTRIVNG 398

Query: 381 LINDLITQTESLRKI--RIALDLIEPN 405
            I  L+ QT S+ +   ++ +  + P+
Sbjct: 399 AIMALVEQTGSIEQAARQLGIQALSPD 425


>gi|330807971|ref|YP_004352433.1| hypothetical protein PSEBR_a1249 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376079|gb|AEA67429.1| Conserved hypothetical protein; putative outer membrane protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 447

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 165/389 (42%), Positives = 235/389 (60%), Gaps = 5/389 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           +   + + V+ +YA I +A Y DA   A+TL +A++  +  PN + L+ AR  W+ AR+P
Sbjct: 52  IDEAAAKAVVAHYADIVYAVYSDAESTAKTLQTAVDAFLAKPNAETLKAARTAWVAARVP 111

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSEV+RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   TANIIAN+++ V
Sbjct: 112 YLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGATANIIANTEVQV 170

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+ 
Sbjct: 171 GEDKVDVKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYL 230

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+++LV+DLEEM+  W P   D        +   +GL  ++
Sbjct: 231 QGAGATGGHNDRRRAYLKSVTQLLVNDLEEMVGNWKPNVSDNYRATLEAEPAESGLRKML 290

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  G+ + Y GEY R++G
Sbjct: 291 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGVRNVYLGEYTRVDG 350

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ GAS+  L++  +      +    ++T     ++ D A   E +DQ+I+  N  GN+
Sbjct: 351 TKMTGASLSSLVAKADPAADTALKADLADTEAKIQVMVDHANKGEHYDQLIAAGNTAGNQ 410

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPN 405
           IVR+ I  L+ QT S+ +    L + + N
Sbjct: 411 IVRDAIAALVKQTGSIEQAAGKLGISDLN 439


>gi|149191668|ref|ZP_01869911.1| putative iron-regulated protein A [Vibrio shilonii AK1]
 gi|148834509|gb|EDL51503.1| putative iron-regulated protein A [Vibrio shilonii AK1]
          Length = 419

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 167/405 (41%), Positives = 248/405 (61%), Gaps = 12/405 (2%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           S+V T  S A S V     ++V+++YA +AHA + DAL+ A+ LD++I T +  P++K L
Sbjct: 14  SLVMT-SSAAFSAVTK---DQVVEHYADLAHAVFADALITAKDLDTSINTFLANPSEKGL 69

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
            + +  W+ +R+PYQQ+EV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N  
Sbjct: 70  ADVQQAWLASRVPYQQTEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVSADYQYE-LGNEG 128

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
             ANI+AN  + +    +D+  I+P+++  L+   G + N+ +GYH IEFLLWGQDL   
Sbjct: 129 AQANIVANKSLKIGATTLDVKEITPEVIANLNEVGGSEANVASGYHAIEFLLWGQDLNGT 188

Query: 188 VREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDL 244
               G RPYTD+ +G  CT G+C RR +YL+  SK+L+ DL+ M K W     G    +L
Sbjct: 189 NAGAGERPYTDYVVGEGCTNGNCERRAQYLQAASKLLIQDLQWMEKQWSASEKGNYRSEL 248

Query: 245 MKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           + D  + G+  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI
Sbjct: 249 LADKADNGIRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGI 308

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIES 362
            + YTG Y+R++G  + G SI +L+   ++  A+EI  +F         L   AE + + 
Sbjct: 309 YNVYTGTYVRVDGTLVDGPSIANLVEAKDKTAAKEIQKQFDLARAQVGKLVTSAEKDNQH 368

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           FDQ+I+ NNP+GNK+V   I  L+ QT S+ +    I +D + P+
Sbjct: 369 FDQLIASNNPQGNKLVNETIVALVAQTGSIERAAGIIGIDSLNPD 413


>gi|260768288|ref|ZP_05877222.1| iron-regulated protein A precursor [Vibrio furnissii CIP 102972]
 gi|260616318|gb|EEX41503.1| iron-regulated protein A precursor [Vibrio furnissii CIP 102972]
 gi|315179995|gb|ADT86909.1| Uncharacterized iron-regulated protein [Vibrio furnissii NCTC
           11218]
          Length = 419

 Score =  320 bits (820), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 166/389 (42%), Positives = 237/389 (60%), Gaps = 8/389 (2%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V+ ++V+ +YA IAHA + D+L  A+ L+ +I++ +  P++  L+  +  WI AR+PYQQ
Sbjct: 26  VTQDQVVAHYADIAHAVFSDSLTTAKNLEKSIDSFLAAPSEAKLQQVKQAWITARVPYQQ 85

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           SEV+RFGN +VD W+ ++NAWPLDEG IDYV   Y  E   N   +ANI+ N+ I +   
Sbjct: 86  SEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSDDYQYE-LGNEGASANIVGNASITIGAT 144

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
            ID S I+P+L+  L+   G + N+ +GYH IEFLLWGQDL       G RPYTD+  G+
Sbjct: 145 TIDASKITPELIASLNEVGGSEANVASGYHAIEFLLWGQDLHGTQAGAGERPYTDYAQGD 204

Query: 204 -CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG--PDGQATKDLMKDINA-GLNSIITGM 259
            CT G+C RR +YLK  +++LV DLE M K W     G   + L+ D +  GL  ++ GM
Sbjct: 205 ACTHGNCDRRAQYLKASAQLLVQDLEWMEKQWSEKEKGNYREALLTDSSTNGLRKMLFGM 264

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            SLS  ELAGERM + L  +  E E DCFSDNT+ S+  D  GI + YTG Y R +G  +
Sbjct: 265 GSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYDEQGIYNIYTGTYTRADGSTL 324

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIV 378
            GASI+DL++  +   A+EI  +F         L + AE N + FDQ+I+ +N  GN +V
Sbjct: 325 TGASIYDLVAQKDDVAAKEIMKQFDAARAQVGELVNSAEKNNQHFDQLIAADNKAGNALV 384

Query: 379 RNLINDLITQTESLRKIR--IALDLIEPN 405
              I  L+ QT S+ +    I +D + P+
Sbjct: 385 NKAIMALVAQTASIERAANVIGIDNLNPD 413


>gi|120555744|ref|YP_960095.1| putative iron-regulated protein A [Marinobacter aquaeolei VT8]
 gi|120325593|gb|ABM19908.1| imelysin, Metallo peptidase, MEROPS family M75 [Marinobacter
           aquaeolei VT8]
          Length = 431

 Score =  320 bits (820), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 162/387 (41%), Positives = 236/387 (60%), Gaps = 9/387 (2%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
            V+ +YA +AHA YEDAL+ AR LD A + L+  P + NL+ A+  W+ +R+PYQQSEV+
Sbjct: 39  SVVTHYADLAHATYEDALITARALDEATDRLIANPTEANLKAAKEAWLASRVPYQQSEVF 98

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ ++NAWPLDEG IDYV +   +    N   TANI+A++ I V  + +D+
Sbjct: 99  RFGNAIVDDWEGQLNAWPLDEGLIDYVKADDYQHELGNAGATANIVASNSINVGGETLDV 158

Query: 148 SIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CTG 206
           + ++P+LL  L+   G + N+ TGYH +EFLLWGQDL       G RP TD+  GN CT 
Sbjct: 159 ATLTPELLADLNEVGGSEANVATGYHAVEFLLWGQDLHGFEGGAGERPVTDYAKGNDCTN 218

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLS 263
           G+C RR +YL  V+ +LV DLE M+  W P   D   ++    + + G+  ++ GM SLS
Sbjct: 219 GNCERRAQYLDAVTDLLVDDLEWMVAQWAPGTSDNYRSQLTSANADEGIQKMLFGMGSLS 278

Query: 264 YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
             ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG Y R++G  + G S
Sbjct: 279 LGELAGERMKVALEANSYEDEHDCFSDNTHNSHYYNGQGIQNVYTGTYRRVDGSVVSGPS 338

Query: 324 IHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE---NIESFDQMISENNPEGNKIVRN 380
           + DL+   N  L   +N +   +M+   ++K RAE   N  +FD MI+  N EG +I+  
Sbjct: 339 LSDLVEQTNPELDARLNRQLDASMEALALMKARAESSQNPMAFDTMIAPGNAEGTRIING 398

Query: 381 LINDLITQTESLRKI--RIALDLIEPN 405
            I  L+ QT S+ +   ++ +  + P+
Sbjct: 399 AIMALVEQTGSIEQAARQLGIQALSPD 425


>gi|163803517|ref|ZP_02197387.1| putative iron-regulated protein A [Vibrio sp. AND4]
 gi|159172693|gb|EDP57544.1| putative iron-regulated protein A [Vibrio sp. AND4]
          Length = 420

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 160/400 (40%), Positives = 249/400 (62%), Gaps = 8/400 (2%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           L +   ++   V+ ++V+++YA +AHA + D+L+ A+ LD+ I+  + +P+++ LE  + 
Sbjct: 16  LIASGSTVAATVTKQQVVEHYADVAHAVFADSLVTAKALDAKIDEFLKSPSEEKLEEVKQ 75

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N    ANI
Sbjct: 76  AWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVATDYQYE-LGNEGAAANI 134

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           +AN+ + +   ++D+S I+P+L+  L+   G + N+ +GYH IEFLLWGQDL       G
Sbjct: 135 VANTSLQIGASKLDVSKITPELIADLNEVGGSEANVASGYHAIEFLLWGQDLNGTNAGAG 194

Query: 193 NRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMK-DI 248
            R YTDF +G+ CT GHC RR EYLK  + +LV DL+ M   W  +  G   ++L+    
Sbjct: 195 QRAYTDFVVGSECTNGHCDRRGEYLKAAAVLLVQDLKWMENQWSIETKGNYREELLNGSA 254

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
           ++GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YT
Sbjct: 255 DSGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYT 314

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMI 367
           G Y  ++G+++ G S+ DL++  ++  A+EI  +F  T      L   AE N + FDQ+I
Sbjct: 315 GTYKGVSGKELSGPSLADLVAQKDKKAAEEIQKQFDTTRSQVGELVTSAEKNNQHFDQLI 374

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           +  N +GN +V + I  L+ QT ++ +    + +D + P+
Sbjct: 375 AAGNAQGNALVNDTIMSLVAQTGAIERAAKIVGIDSLSPD 414


>gi|197334683|ref|YP_002155989.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           fischeri MJ11]
 gi|197316173|gb|ACH65620.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           fischeri MJ11]
          Length = 417

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 172/393 (43%), Positives = 234/393 (59%), Gaps = 9/393 (2%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           I + +F +PS    I    +  +V+++YA IAHA Y D+L  A+ LD AI T +  P+K 
Sbjct: 11  ITASLFVIPS----ISQAATQSEVVEHYADIAHAVYSDSLSAAQKLDKAITTFLNNPSKD 66

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
            LE  +L W  AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  E   N
Sbjct: 67  GLETVKLAWKEARVPYQQSEVFRFGNAIVDEWEGQLNAWPLDEGLIDYVADDYQYE-LGN 125

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
           +   ANI+A+  I +  + ID++ I  + L  L+   G + N+ TGYH IEFLLWGQDL 
Sbjct: 126 DGAKANIVASKSIKIGAETIDVTSIKAEQLADLNELGGSEANVATGYHAIEFLLWGQDLN 185

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATK 242
                 G RPYTD+ IG+ CT G+C RR EYLK  S++L+ DL  M K W  G      +
Sbjct: 186 GTNSGAGERPYTDYVIGSACTNGNCERRAEYLKAASELLIKDLSWMEKQWKEGEKNYRAE 245

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
            L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  G
Sbjct: 246 LLSESSEQGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQG 305

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIE 361
           I + YTG Y R +G ++ G SIHDL++  +   A+EI  +F  T      L   AE + +
Sbjct: 306 IYNVYTGTYTRADGSQLSGPSIHDLVAKKDAKAAKEIKQQFDATRTQVGTLVSAAEKDNQ 365

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
            FDQ+I+ +N  GN +V   I  L+ QT S+ +
Sbjct: 366 HFDQLIAADNAAGNALVNKSIMSLVLQTASIER 398


>gi|323497652|ref|ZP_08102669.1| uncharacterized iron-regulated protein [Vibrio sinaloensis DSM
           21326]
 gi|323317401|gb|EGA70395.1| uncharacterized iron-regulated protein [Vibrio sinaloensis DSM
           21326]
          Length = 420

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 161/376 (42%), Positives = 229/376 (60%), Gaps = 6/376 (1%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V+ E+V+++YA +AHA +ED+L+ A+ L+  IE+ +  P+    E  +  W+ +R+PYQQ
Sbjct: 27  VTQEQVVEHYADVAHAVFEDSLVTAKQLEKTIESFLAAPSAAKFEEVKQAWLESRVPYQQ 86

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           SEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N   +ANI+AN ++ +   
Sbjct: 87  SEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVSADYQYE-LGNEGASANIVANKQLKIGAT 145

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG- 202
            +D++ ++P  +  L+   G + N+ +GYH IEFLLWGQDL       G R YTDF +G 
Sbjct: 146 TLDVAELTPAAIADLNEVGGSEANVASGYHAIEFLLWGQDLNGTSAGAGQRAYTDFVVGA 205

Query: 203 NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKD-INAGLNSIITGM 259
            CT G+C RR EYLK  +++LV DLE M K W  D  G    +L+ D    GL  ++ GM
Sbjct: 206 ECTNGNCDRRGEYLKATAELLVQDLEWMEKQWSADEKGNYRAELLADSAENGLRKMLFGM 265

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG Y R +G  +
Sbjct: 266 GSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYTGLYKRQDGTLV 325

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN-IESFDQMISENNPEGNKIV 378
            G SI+DL++  ++  AQEI  +F  T      L   AE   E FDQ+I+  N +GN +V
Sbjct: 326 SGPSINDLVAQKDKQAAQEIQKQFDTTRAQVGQLVTSAEKEGEFFDQLIASGNAKGNALV 385

Query: 379 RNLINDLITQTESLRK 394
              I  L+ QT  + +
Sbjct: 386 NETIMSLVAQTTQIER 401


>gi|300021838|ref|YP_003754449.1| peptidase M75, Imelysin [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523659|gb|ADJ22128.1| Peptidase M75, Imelysin [Hyphomicrobium denitrificans ATCC 51888]
          Length = 427

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 163/384 (42%), Positives = 238/384 (61%), Gaps = 7/384 (1%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           T +++   +   A +  P V  + + + Y  +A A Y D+L  A+ LD AI+  +  P+ 
Sbjct: 12  TGLALAGAVARPAFADAPAV--KDITKTYGDLAEAMYSDSLAKAKDLDKAIDAFLAAPDA 69

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVD-SSYGKENE 123
              + A+  W  ARIPY Q+E +RFGNKIVD W+  VN+WPLDEG IDYVD +SYG   E
Sbjct: 70  TTQKAAQDAWKAARIPYMQTEGFRFGNKIVDDWEGNVNSWPLDEGLIDYVDKASYGDAKE 129

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
           EN LYTANIIAN  + +  K +D S I   ++ +L+ A  +++N+ TGYH IEFLLWGQ+
Sbjct: 130 ENPLYTANIIANKSVRLGPKVLDASKIDKTVIAQLNSALEVESNVGTGYHAIEFLLWGQN 189

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
           L       G RP +DFD+ NCT  +C RR +YLK  S +L+ DL EM   W   G A + 
Sbjct: 190 LHGTSAGAGERPASDFDLKNCTHDNCDRRRDYLKAASSLLIDDLSEMAGNWKAGGAAREA 249

Query: 244 LMK-DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
           L K D NA L++I+TG+ SLSY ELAGERM LG++LHDPE+  DCFS+NT+ S+  D +G
Sbjct: 250 LSKQDANAQLSTILTGIGSLSYGELAGERMKLGVLLHDPEEAHDCFSNNTHNSHYYDQVG 309

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE- 361
           +I  + G+Y       + GASI +L      + A+ +++   NT    + +K +A++ E 
Sbjct: 310 MIEIWNGKYD--GATAVSGASIAELARAKAPDAAKRVDEAMENTKAKLNAIKVKADSGEM 367

Query: 362 SFDQMISENNPEGNKIVRNLINDL 385
            ++QM++  N  GNK++ + ++ L
Sbjct: 368 GYNQMLAAGNDAGNKLILDGVDAL 391


>gi|325277944|ref|ZP_08143481.1| hypothetical protein G1E_29817 [Pseudomonas sp. TJI-51]
 gi|324096918|gb|EGB95227.1| hypothetical protein G1E_29817 [Pseudomonas sp. TJI-51]
          Length = 444

 Score =  318 bits (816), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 161/378 (42%), Positives = 232/378 (61%), Gaps = 5/378 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+++YA + +A Y D+L  A+TL +A++  +  P+ + L+ A+  W+ AR+P
Sbjct: 49  VDEAAGKAVVKHYAEMVYAVYSDSLSTAKTLQTAVDAFLAKPDDETLKAAKQAWVAARVP 108

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN++I V
Sbjct: 109 YLQSEAFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPAASANIIANTEIQV 167

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E++ID+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+ 
Sbjct: 168 GEEKIDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYL 227

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+++LV+DLEEM+  W P   D    K   + +N GL  ++
Sbjct: 228 EGQGATGGHNERRRAYLKAVTQLLVTDLEEMVGNWAPNVADNYRAKLEAEPVNDGLRKML 287

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +G
Sbjct: 288 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRPDG 347

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ G S+  L++  +      +      T     ++ D A+  E +DQ+I+ +N  GN+
Sbjct: 348 TKVSGPSLSSLVAKVDPAADATLKADLEATEAKIQVMVDHAQKGEHYDQLIAPDNAAGNQ 407

Query: 377 IVRNLINDLITQTESLRK 394
           IVR+ I  L+ QT ++ +
Sbjct: 408 IVRDAIAALVKQTGAIEQ 425


>gi|59711797|ref|YP_204573.1| hypothetical protein VF_1190 [Vibrio fischeri ES114]
 gi|59479898|gb|AAW85685.1| Uncharacterized iron-regulated protein [Vibrio fischeri ES114]
          Length = 417

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 172/393 (43%), Positives = 234/393 (59%), Gaps = 9/393 (2%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           I + +F +PS    I    +  +V+++YA IAHA Y D+L  A+ LD AI T +  P+K 
Sbjct: 11  ITASLFVIPS----ISQATTQSEVVEHYADIAHAVYSDSLSTAQKLDKAITTFLNNPSKD 66

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
            LE  +L W  AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  E   N
Sbjct: 67  GLETVKLAWKEARVPYQQSEVFRFGNAIVDEWEGQLNAWPLDEGLIDYVADDYQYE-LGN 125

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
           +   ANI+A+  I +  + ID++ I  + L  L+   G + N+ TGYH IEFLLWGQDL 
Sbjct: 126 DGAKANIVASKSIKIGAETIDVTSIKAEQLADLNELGGSEANVATGYHAIEFLLWGQDLN 185

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATK 242
                 G RPYTD+ IG+ CT G+C RR EYLK  S++L+ DL  M K W  G      +
Sbjct: 186 GTNSGAGERPYTDYVIGSACTNGNCERRAEYLKAASELLIKDLSWMEKQWKEGEKNYRAE 245

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
            L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  G
Sbjct: 246 LLSESSEQGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQG 305

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIE 361
           I + YTG Y R +G ++ G SIHDL++  +   A+EI  +F  T      L   AE + +
Sbjct: 306 IYNVYTGTYTRADGSQLSGPSIHDLVAKKDAKAAKEIKQQFDATRTQVGTLVSAAEKDNQ 365

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
            FDQ+I+ +N  GN +V   I  L+ QT S+ +
Sbjct: 366 HFDQLIAADNAVGNALVNKSIMSLVLQTASIER 398


>gi|330445729|ref|ZP_08309381.1| imelysin family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489920|dbj|GAA03878.1| imelysin family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 418

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 174/392 (44%), Positives = 237/392 (60%), Gaps = 13/392 (3%)

Query: 10  VFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
           +F+LP+ A +       + V+ +YA +AH+ Y DAL  A+TLD AI  LV  P+++ L  
Sbjct: 14  LFSLPAVAQAATTK---QDVVTHYADLAHSVYSDALTTAQTLDKAIAALVANPSEQTLSA 70

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--NEENNL 127
           AR  W  +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  E  NE  N 
Sbjct: 71  AREAWKASRVPYQQSEVFRFGNGIVDDWEGQLNAWPLDEGLIDYVAKDYQHELGNEGAN- 129

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
             ANII+N KI V  KEID++ I+P+L+  L+   G + N+ +GYH IEFLLWGQDL   
Sbjct: 130 --ANIISNKKINVGNKEIDVAKITPELIADLNELGGSEANVASGYHAIEFLLWGQDLNGT 187

Query: 188 VREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA---TKD 243
               G+R +TDF  G  CT G+C RR +YL   S++L++DL+ M K W         ++ 
Sbjct: 188 GSGAGDRKFTDFVKGEACTNGNCDRRSDYLTASSQLLINDLQWMEKQWSATEAKNYRSEL 247

Query: 244 LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           L +  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI
Sbjct: 248 LAESADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGI 307

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIES 362
            + YTG Y R+NGE + G SIHDL++  +   A EI  +F         L D AE + + 
Sbjct: 308 FNVYTGSYTRVNGEVLTGPSIHDLVAAKDEKAAAEIKAEFVQARAQLQTLVDSAEKDNQH 367

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRK 394
           FDQ+I+  N  GN +V   I  L+ QT  + K
Sbjct: 368 FDQLIAAGNKAGNALVNKSIMALVKQTAEIEK 399


>gi|312883632|ref|ZP_07743357.1| uncharacterized iron-regulated protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368855|gb|EFP96382.1| uncharacterized iron-regulated protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 420

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 164/387 (42%), Positives = 235/387 (60%), Gaps = 6/387 (1%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           L +   +   +V+ ++V+++YA IAHA + D+L  A+ L+ +IE  +  P    L   + 
Sbjct: 16  LIASGTAFSADVTNKQVVEHYADIAHAVFADSLATAKNLNKSIEAFLAAPTDAKLMEVKQ 75

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV S Y  E   N    ANI
Sbjct: 76  AWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGMIDYVTSDYQYE-LGNAGAKANI 134

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           +AN+++ +    +D+S I+P L+  L+   G + N+ +GYH IEFLLWGQDL       G
Sbjct: 135 VANTQLTIGASTLDVSKITPALIADLNEVGGSEANVASGYHAIEFLLWGQDLNGTESGAG 194

Query: 193 NRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMK-DI 248
           NRPYTDF +G  CT G+C RR  +L+   ++LV DLE M K W  +  G   ++L+    
Sbjct: 195 NRPYTDFVLGEACTHGNCDRRGAFLRAAGQLLVQDLEWMEKQWSKEAKGNYRQELVNGSA 254

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
           + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YT
Sbjct: 255 DNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNIYT 314

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMI 367
           G Y R +G  + G S+HDL++  ++  AQEI  +F  T      L   AE N + FDQ+I
Sbjct: 315 GIYKRQDGSLLSGPSLHDLVNQKDKVAAQEIQKQFDQTRSQVGKLVTSAEKNNQHFDQLI 374

Query: 368 SENNPEGNKIVRNLINDLITQTESLRK 394
           +  N +GNK+V   I  L+ QTE + +
Sbjct: 375 AAGNAKGNKLVNETIMSLVAQTEQIER 401


>gi|167035468|ref|YP_001670699.1| hypothetical protein PputGB1_4475 [Pseudomonas putida GB-1]
 gi|166861956|gb|ABZ00364.1| conserved hypothetical protein [Pseudomonas putida GB-1]
          Length = 445

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 228/378 (60%), Gaps = 5/378 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+++Y  + +A Y D+L  A+TL +AI+  +  PN + L+ A+  W  AR+P
Sbjct: 50  VDEAAGKAVVKHYTEMVYAVYSDSLSTAKTLQTAIDAFLAKPNDETLKAAKEAWFAARVP 109

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N    ANIIAN++I V
Sbjct: 110 YLQSEAFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPAAGANIIANTEIQV 168

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E+++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+ 
Sbjct: 169 GEEKVDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYL 228

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+ +LVSDLEEM+  W P   D    K   + +N GL  ++
Sbjct: 229 EGQGATGGHNDRRRAYLKAVTDLLVSDLEEMVGNWAPNVADNYRAKLEAEPVNDGLRKML 288

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +G
Sbjct: 289 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRPDG 348

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN+
Sbjct: 349 TKVSGPSLSSLVAKVDPATDAALKADLEATEAKIQVIVDHALKGEHYDQLIAADNAAGNQ 408

Query: 377 IVRNLINDLITQTESLRK 394
           IVR+ I  L+ QT S+ +
Sbjct: 409 IVRDAIAALVKQTGSIEQ 426


>gi|149377143|ref|ZP_01894892.1| iron-regulated protein A, putative [Marinobacter algicola DG893]
 gi|149358561|gb|EDM47034.1| iron-regulated protein A, putative [Marinobacter algicola DG893]
          Length = 442

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 240/387 (62%), Gaps = 11/387 (2%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHA +EDAL  A++LDS ++T + +P ++NL+ A+  W+ +R+PYQQ+EV+R
Sbjct: 51  VVEHYADLAHANFEDALTAAQSLDSTVDTFLESPTEENLQKAKQAWLASRVPYQQTEVFR 110

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN +VD W+ ++NAWPLDEG IDYV     +    N   TANIIA+ +I +    +D S
Sbjct: 111 FGNAVVDDWEGQLNAWPLDEGLIDYVKEDGYQYELGNEGATANIIASPEINIGGTTVDAS 170

Query: 149 IISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGG 207
            ++P+LL +L+   G + N+ TGYH IEFLLWGQDL    R  G RP TD+  G  CT G
Sbjct: 171 SLTPELLAELNEIGGSEANVATGYHAIEFLLWGQDLHGFDRGAGQRPATDYAQGEECTHG 230

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSY 264
           +C RR  YL   + +L++DLE M+  W P   D   ++ L +  +A +  +  GM SLS 
Sbjct: 231 NCDRRAAYLDAATDLLITDLEWMVAQWAPGQEDNYRSQLLAEAPDAAIQKMFFGMGSLSL 290

Query: 265 NELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASI 324
            ELAGERM + L  +  E E DCFSDNT+ S+  +  G+ + Y+G Y R++G ++ G S+
Sbjct: 291 GELAGERMKVALEANSYEDEHDCFSDNTHNSHYYNGQGVANIYSGSYTRIDGSELTGPSL 350

Query: 325 HDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES----FDQMISENNPEGNKIVRN 380
            D+++  N  L + ++ +F ++M     +K  AE  ES    FD MI+  N +G KIV  
Sbjct: 351 SDMVAELNPELDETLSQQFEDSMDALQTMKSSAE-AESEPMKFDMMIAPGNEKGAKIVNG 409

Query: 381 LINDLITQTESLRKI--RIALDLIEPN 405
            I  L+ QT S+ +    + +D ++P+
Sbjct: 410 AIMALVAQTGSIEQAARELGIDSLKPD 436


>gi|146283464|ref|YP_001173617.1| iron-regulated protein A, putative [Pseudomonas stutzeri A1501]
 gi|145571669|gb|ABP80775.1| iron-regulated protein A, putative [Pseudomonas stutzeri A1501]
 gi|327481861|gb|AEA85171.1| iron-regulated protein A, putative [Pseudomonas stutzeri DSM 4166]
          Length = 444

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 165/401 (41%), Positives = 240/401 (59%), Gaps = 4/401 (0%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           S   ++P+         + + V+ +YA +A A + DA   A  L  AI+ L+  P+++ L
Sbjct: 37  STTESVPAEQAQKPDEKAAKAVVSHYADLALAVFSDAHATAVQLQQAIDALLANPSEETL 96

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           + AR  W+ AR+PY Q+EV+RFGN +VD W+ ++NAWPLDEG IDYV+  Y +    N  
Sbjct: 97  QAARQAWLAARVPYMQTEVFRFGNPVVDEWEGQLNAWPLDEGLIDYVEGDY-QHALGNPG 155

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
             ANIIAN+++ V E +ID S I+ +LL  L+   G + N+ TGYH IEFLLWGQDL   
Sbjct: 156 ANANIIANTELQVGEDKIDTSEITAELLTSLNELAGSEANVATGYHAIEFLLWGQDLNGT 215

Query: 188 VREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
               G RPYTD+  G  CTGG+C RR  YLKV + +LVSDL+EM++ W P  +  +  ++
Sbjct: 216 GPGAGERPYTDYVEGEGCTGGNCDRRRTYLKVATDLLVSDLQEMVEQWQPGAENYRASLE 275

Query: 247 DINA--GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
             +A  GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI 
Sbjct: 276 AESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYNARGIR 335

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y GEY R++G  + G S+  L+   +  +   +     +T     +L + A N E+FD
Sbjct: 336 NVYLGEYKRVDGSTLTGPSLASLVQGVSPEVDSTLKTDLESTEAKLQVLVESANNGEAFD 395

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           Q+I+ +N EG + VRN I  L+ QT S+ +   AL + + N
Sbjct: 396 QLIAADNAEGQEKVRNAIAALVKQTASIEQAAAALGISDLN 436


>gi|90579545|ref|ZP_01235354.1| hypothetical protein VAS14_01246 [Vibrio angustum S14]
 gi|90439119|gb|EAS64301.1| hypothetical protein VAS14_01246 [Vibrio angustum S14]
          Length = 417

 Score =  315 bits (807), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 172/394 (43%), Positives = 239/394 (60%), Gaps = 10/394 (2%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           I + +FTLP+    +    + E+V+ +YA +AH+ Y DAL  A+ LD AI  LV  P++K
Sbjct: 10  IAAAIFTLPT----VAQAATKEEVVTHYADLAHSVYSDALTTAQDLDKAIAALVANPSEK 65

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
            L  AR  W  +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  E   N
Sbjct: 66  TLSAARTAWKASRVPYQQSEVFRFGNGIVDDWEGQLNAWPLDEGLIDYVAKDYQHE-LGN 124

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
               ANI+A+  + V  KEID++ I+P+L+  L+   G + N+ +GYH IEFLLWGQDL 
Sbjct: 125 EGAKANIVASKTLNVGNKEIDVTKITPELIADLNELGGSEANVASGYHAIEFLLWGQDLN 184

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA---T 241
                 G+R +TDF  G  CT G+C RR EYL   S++L++DL+ M K W         +
Sbjct: 185 GTKSGAGDRKFTDFVKGEACTNGNCDRRAEYLTASSQLLINDLQWMEKQWSATEAKNYRS 244

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
           + L +  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  
Sbjct: 245 ELLAESADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQ 304

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NI 360
           GI + YTG Y R NGE + G SI+DL++  ++  A EI  +F  T     IL D AE + 
Sbjct: 305 GIYNVYTGTYTRTNGEVLTGPSINDLVAAKDKKAAAEIKAEFDKTRAQLQILVDSAEKDN 364

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
           + FDQ+I+ +N  G+ +V   I  L+ QT  + K
Sbjct: 365 QHFDQLIATDNKAGHALVNKSIMALVQQTAEIEK 398


>gi|313497282|gb|ADR58648.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 444

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 162/382 (42%), Positives = 230/382 (60%), Gaps = 5/382 (1%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           A   V   + + V+++Y  + +A Y D+L  A+TL +A++  +  PN + L+ A+  W  
Sbjct: 45  ASGAVDEAAGKAVVKHYTDMVYAVYSDSLSTAKTLQTAVDAFLAKPNDETLKAAKEAWFA 104

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR+PY QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN+
Sbjct: 105 ARVPYLQSETFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGASANIIANT 163

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
           +I V E+++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP 
Sbjct: 164 EIQVGEEKVDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPA 223

Query: 197 TDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGL 252
           +D+  G   TGGH  RR  YLK V+ +LV+DLEEM+  W P   D    K   + +N GL
Sbjct: 224 SDYLEGQGATGGHNDRRRAYLKAVTDLLVTDLEEMVGNWAPNVADNYRAKLEAEPVNDGL 283

Query: 253 NSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYI 312
             ++ GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY 
Sbjct: 284 RKMLFGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYT 343

Query: 313 RMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNP 372
           R +G K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N 
Sbjct: 344 RPDGTKLTGPSLSSLVAKVDPAADATLKADLEATEAKLQVIVDHALKGEHYDQLIAADNA 403

Query: 373 EGNKIVRNLINDLITQTESLRK 394
            GN++VR+ I  L+ QT S+ +
Sbjct: 404 AGNQVVRDAIAALVKQTGSIEQ 425


>gi|262402384|ref|ZP_06078945.1| iron-regulated protein A precursor [Vibrio sp. RC586]
 gi|262351166|gb|EEZ00299.1| iron-regulated protein A precursor [Vibrio sp. RC586]
          Length = 420

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 167/410 (40%), Positives = 246/410 (60%), Gaps = 14/410 (3%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I++ +    S + +  P  +  +V+++YA IAHA Y D+ + A+ L  +I+  + TP  
Sbjct: 10  AILASLTLTASASFAAAPTQA--QVVEHYANIAHAVYADSRLTAQQLQKSIDRFLQTPTA 67

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--N 122
           K LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  N
Sbjct: 68  KGLEEVKQAWLAARVPYQQSEVFRFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHELGN 127

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           E  N   ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 128 EGAN---ANIIANTSLTIGANKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQ 239
           DL       G R YTD+  G  CT G+C RR +YLK  +++LV+DLE M K W  G  G 
Sbjct: 185 DLNGTKAGAGARSYTDYLQGKECTNGNCDRRAQYLKAAAQLLVTDLEWMEKQWANGEKGN 244

Query: 240 ATKDLMKDINA-GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
             + L+ + +  GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YRQQLLTESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + +TG Y R +G ++ G S+++L++  + + A+EI  +F         L   AE
Sbjct: 305 NEQGIYNIFTGTYTRADGSELKGPSLYELVAEKDASAAKEILQQFETARTQVGELVTSAE 364

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
            N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    I +D + P+
Sbjct: 365 KNNQHFDQLIAADNTAGHAIINQAIMALVVQTGSIERAAGIIGIDNLNPD 414


>gi|148978889|ref|ZP_01815209.1| Uncharacterized iron-regulated protein [Vibrionales bacterium
           SWAT-3]
 gi|145962087|gb|EDK27373.1| Uncharacterized iron-regulated protein [Vibrionales bacterium
           SWAT-3]
          Length = 419

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 166/414 (40%), Positives = 250/414 (60%), Gaps = 13/414 (3%)

Query: 4   ITIISIVFTLPSHAL-----SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETL 58
           +TI S+V    + +L     S    V+ ++V+++YA IAHA + D+++ A+ L+S+I+T 
Sbjct: 1   MTIKSLVTKAVTSSLIFASASSFAAVTQDQVVEHYADIAHAVFADSVITAKALNSSIDTF 60

Query: 59  VTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSY 118
           + +P+  N E  +L W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV S Y
Sbjct: 61  LASPSAGNFEKVKLAWLESRVPYQQSEVFRFGNVVVDDWEGQLNAWPLDEGLIDYVSSDY 120

Query: 119 GKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFL 178
             E   N   +ANI+AN    + +  +D + I+P+L+ +L+   G + N+ +GYH IEFL
Sbjct: 121 QYE-LGNEGASANIVANKTFQIGQTTVDATNITPELIAELNEIGGSEANVASGYHAIEFL 179

Query: 179 LWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--G 235
           LWGQD+       G R YTDF +G  CT G+C RR  YLK  +++L+ DLE M K W  G
Sbjct: 180 LWGQDMNGTNSGAGERAYTDFVVGAECTNGNCDRRGAYLKASAELLIQDLEWMEKQWAEG 239

Query: 236 PDGQATKDLMKDINA-GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYA 294
             G   ++L+ + +  GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ 
Sbjct: 240 EKGNYRQELLSESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHN 299

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
           S+  +  GI + YTG Y R +G  + G S+ DL+   +   A+EI  +F         L 
Sbjct: 300 SHYYNEQGIYNVYTGLYKREDGTLLSGPSLFDLVEQKDEQAAKEIQKQFDLARAQVGQLV 359

Query: 355 DRAE-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
             AE N + FDQ+I+ +N  GN +V   I  L++QT ++ +    I +D + P+
Sbjct: 360 TSAEKNNQHFDQLIAADNAAGNALVNKTIVALVSQTAAIERAAGVIGIDSLNPD 413


>gi|297578856|ref|ZP_06940784.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297536450|gb|EFH75283.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 435

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 167/410 (40%), Positives = 240/410 (58%), Gaps = 14/410 (3%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I++ +    S + +  P  +  +V+++YA IAHA Y D+ + A+ L   I+  +  P  
Sbjct: 25  AILASLTLTTSASFAAAPTQA--QVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQAPTA 82

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--N 122
           + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  N
Sbjct: 83  QGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHELGN 142

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           E  N   ANIIAN+ + +   ++D+  ISP+LL  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 143 EGAN---ANIIANTALTIGATKVDVKEISPELLASLNEIGGSEANVASGYHAIEFLLWGQ 199

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DG 238
           DL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D 
Sbjct: 200 DLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKDN 259

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L + +  GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 260 YRQQLLSESVENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 319

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   AE
Sbjct: 320 NEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAE 379

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
            N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    I +D + P+
Sbjct: 380 KNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPD 429


>gi|148546195|ref|YP_001266297.1| hypothetical protein Pput_0952 [Pseudomonas putida F1]
 gi|148510253|gb|ABQ77113.1| Uncharacterized iron-regulated protein [Pseudomonas putida F1]
          Length = 444

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 162/378 (42%), Positives = 229/378 (60%), Gaps = 5/378 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+++Y  + +A Y D+L  A+TL +A++  +  PN + L+ A+  W  AR+P
Sbjct: 49  VDEAAGKAVVKHYTDMVYAVYSDSLSTAKTLQTAVDAFLAKPNDETLKAAKEAWFAARVP 108

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN++I V
Sbjct: 109 YLQSETFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGASANIIANTEIQV 167

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E+++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+ 
Sbjct: 168 GEEKVDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYL 227

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+ +LV+DLEEM+  W P   D    K   + +N GL  ++
Sbjct: 228 EGQGATGGHNDRRRAYLKAVTDLLVTDLEEMVGNWAPNVADNYRAKLEAEPVNDGLRKML 287

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +G
Sbjct: 288 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRPDG 347

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN+
Sbjct: 348 TKLTGPSLSSLVAKVDPAADAALKADLEATEAKLQVIVDHALKGEHYDQLIAADNAAGNQ 407

Query: 377 IVRNLINDLITQTESLRK 394
           IVR+ I  L+ QT S+ +
Sbjct: 408 IVRDAIAALVKQTGSIEQ 425


>gi|209695263|ref|YP_002263192.1| putative iron-regulated protein [Aliivibrio salmonicida LFI1238]
 gi|208009215|emb|CAQ79471.1| putative iron-regulated protein [Aliivibrio salmonicida LFI1238]
          Length = 417

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 169/393 (43%), Positives = 239/393 (60%), Gaps = 9/393 (2%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           + + +F LP+ + +   +    +V+++YA IAHA Y DAL  A++LD+ +   +  P++K
Sbjct: 11  LTASLFVLPTFSYAATQS----EVVEHYADIAHAVYSDALTTAQSLDTTLNAFLANPSEK 66

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
            LE A++ W  AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV   Y  E   N
Sbjct: 67  TLEQAKIAWKAARVPYQQSEVFRFGNPVVDDWEGQLNAWPLDEGLIDYVADDYQYE-LGN 125

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
           +   ANI+++  I +  + ID++ I  D L  L+   G + N+ TGYH IEFLLWGQDL 
Sbjct: 126 DGAKANIVSSKSIKIGAETIDVTNIKADHLAALNELGGSEANVATGYHAIEFLLWGQDLN 185

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATK 242
                 G RPYTD+ IG+ CT G+C RR EYLK  S++L+SDL  M K W  G      +
Sbjct: 186 GTNAGAGERPYTDYAIGSACTNGNCERRAEYLKAASELLISDLSWMEKQWKEGETNYRAE 245

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
            L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  G
Sbjct: 246 LLEESSKQGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQG 305

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA-ENIE 361
           I + YTG Y R +G  + G SIH+L++  ++  A+EI  +F    +    L   A EN +
Sbjct: 306 IYNVYTGTYKRTDGTILAGPSIHELVAQKDKQAAKEIQQQFDQAREQVKTLVISAEENNQ 365

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
            FDQ+I+ NN  GN +V   I  L+TQT S+ +
Sbjct: 366 HFDQLIAANNAAGNALVNQSIMALVTQTASIER 398


>gi|26987649|ref|NP_743074.1| hypothetical protein PP_0913 [Pseudomonas putida KT2440]
 gi|24982331|gb|AAN66538.1|AE016282_6 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 443

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 161/378 (42%), Positives = 229/378 (60%), Gaps = 5/378 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+++Y  + +A Y D+L  A+TL +A++  +  PN + L+ A+  W  AR+P
Sbjct: 48  VDEAAGKAVVKHYTDMVYAVYSDSLSTAKTLQTAVDAFLAKPNDETLKAAKEAWFAARVP 107

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN++I V
Sbjct: 108 YLQSETFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGASANIIANTEIQV 166

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E+++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+ 
Sbjct: 167 GEEKVDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYL 226

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+ +LV+DLEEM+  W P   D    K   + +N GL  ++
Sbjct: 227 EGQGATGGHNDRRRAYLKAVTDLLVTDLEEMVGNWAPNVADNYRAKLEAEPVNDGLRKML 286

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +G
Sbjct: 287 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRPDG 346

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN+
Sbjct: 347 TKLTGPSLSSLVAKVDPAADAALKADLEATEAKLQVIVDHALKGEHYDQLIAADNAAGNQ 406

Query: 377 IVRNLINDLITQTESLRK 394
           +VR+ I  L+ QT S+ +
Sbjct: 407 VVRDAIAALVKQTGSIEQ 424


>gi|258624446|ref|ZP_05719393.1| iron-regulated protein A, putative [Vibrio mimicus VM603]
 gi|258583293|gb|EEW08095.1| iron-regulated protein A, putative [Vibrio mimicus VM603]
          Length = 420

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 237/387 (61%), Gaps = 12/387 (3%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +V+++YA IAHA Y D+ + A+ L  +I+  + TP  K LE  +  W+ AR+PYQQSEV+
Sbjct: 31  QVVEHYANIAHAVYSDSRLTAQQLQKSIDRFLQTPTAKGLEEVKQAWLAARVPYQQSEVF 90

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--NEENNLYTANIIANSKIIVNEKEI 145
           RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  NE  N   ANI+AN+ + +   ++
Sbjct: 91  RFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHELGNEGAN---ANIVANTSLTIGANKL 147

Query: 146 DLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-C 204
           D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G R YTD+  G  C
Sbjct: 148 DVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQDLNGTKAGAGARSYTDYLQGKEC 207

Query: 205 TGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATKDLMKDINA-GLNSIITGMTS 261
           T G+C RR +YLK  +++LV+DLE M K W  G  G   + L+ + +  GL  ++ GM S
Sbjct: 208 TNGNCDRRAQYLKAAAQLLVTDLEWMEKQWANGEKGNYRQQLLNESSENGLRKMLFGMGS 267

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + +TG Y R +G ++ G
Sbjct: 268 LSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNIFTGTYTRADGSELKG 327

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIVRN 380
            S+++L++  + + A+EI  +F         L   AE N + FDQ+I+ +N  G+ I+  
Sbjct: 328 PSLYELVAEKDASAAKEILQQFETARTQVGELVTSAEKNNQHFDQLIAADNTAGHAIINQ 387

Query: 381 LINDLITQTESLRKIR--IALDLIEPN 405
            I  L+ QT S+ +    I +D + P+
Sbjct: 388 AIMALVVQTGSIERAAGIIGIDNLNPD 414


>gi|262165520|ref|ZP_06033257.1| iron-regulated protein A precursor [Vibrio mimicus VM223]
 gi|262025236|gb|EEY43904.1| iron-regulated protein A precursor [Vibrio mimicus VM223]
          Length = 420

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 237/387 (61%), Gaps = 12/387 (3%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +V+++YA IAHA Y D+ + A+ L  +I+  + TP  K LE  +  W+ AR+PYQQSEV+
Sbjct: 31  QVVEHYANIAHAVYADSRLTAQQLQKSIDRFLQTPTAKGLEEVKQAWLAARVPYQQSEVF 90

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--NEENNLYTANIIANSKIIVNEKEI 145
           RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  NE  N   ANI+AN+ + +   ++
Sbjct: 91  RFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHELGNEGAN---ANIVANTSLTIGANKL 147

Query: 146 DLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-C 204
           D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G R YTD+  G  C
Sbjct: 148 DVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQDLNGTKAGAGARSYTDYLKGKEC 207

Query: 205 TGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATKDLMKDINA-GLNSIITGMTS 261
           T G+C RR +YLK  +++LV+DLE M K W  G  G   + L+ + +  GL  ++ GM S
Sbjct: 208 TNGNCDRRAQYLKAAAQLLVADLEWMEKQWANGEKGNYRQQLLNESSENGLRKMLFGMGS 267

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + +TG Y R +G ++ G
Sbjct: 268 LSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNIFTGTYTRADGSELKG 327

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIVRN 380
            S+++L++  + + A+EI  +F         L   AE N + FDQ+I+ +N  G+ I+  
Sbjct: 328 PSLYELVAEKDASAAKEILQQFETARTQVGELVTSAEKNNQHFDQLIAADNTAGHAIINQ 387

Query: 381 LINDLITQTESLRKIR--IALDLIEPN 405
            I  L+ QT S+ +    I +D + P+
Sbjct: 388 AIMALVVQTGSIERAAGIIGIDNLNPD 414


>gi|258620194|ref|ZP_05715233.1| iron-regulated protein A, putative [Vibrio mimicus VM573]
 gi|258587552|gb|EEW12262.1| iron-regulated protein A, putative [Vibrio mimicus VM573]
          Length = 420

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 237/387 (61%), Gaps = 12/387 (3%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +V+++YA IAHA Y D+ + A+ L  +I+  + TP  K LE  +  W+ AR+PYQQSEV+
Sbjct: 31  QVVEHYANIAHAVYADSRLTAQQLQKSIDRFLQTPTAKGLEEVKQAWLAARVPYQQSEVF 90

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--NEENNLYTANIIANSKIIVNEKEI 145
           RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  NE  N   ANI+AN+ + +   ++
Sbjct: 91  RFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHELGNEGAN---ANIVANTSLTIGANKL 147

Query: 146 DLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-C 204
           D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G R YTD+  G  C
Sbjct: 148 DVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQDLNGTKAGAGARSYTDYLQGKEC 207

Query: 205 TGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATKDLMKDINA-GLNSIITGMTS 261
           T G+C RR +YLK  +++LV+DLE M K W  G  G   + L+ + +  GL  ++ GM S
Sbjct: 208 TNGNCDRRAQYLKAAAQLLVTDLEWMEKQWANGEKGNYRQQLLNESSENGLRKMLFGMGS 267

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + +TG Y R +G ++ G
Sbjct: 268 LSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNIFTGTYTRADGSELKG 327

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIVRN 380
            S+++L++  + + A+EI  +F         L   AE N + FDQ+I+ +N  G+ I+  
Sbjct: 328 PSLYELVAEKDASAAKEILQQFETARTQVGELVTSAEKNNQHFDQLIAADNTAGHAIINQ 387

Query: 381 LINDLITQTESLRKIR--IALDLIEPN 405
            I  L+ QT S+ +    I +D + P+
Sbjct: 388 AIMALVVQTGSIERAAGIIGIDNLNPD 414


>gi|262171702|ref|ZP_06039380.1| iron-regulated protein A precursor [Vibrio mimicus MB-451]
 gi|261892778|gb|EEY38764.1| iron-regulated protein A precursor [Vibrio mimicus MB-451]
          Length = 420

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 237/387 (61%), Gaps = 12/387 (3%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +V+++YA IAHA Y D+ + A+ L  +I+  + TP  K LE  +  W+ AR+PYQQSEV+
Sbjct: 31  QVVEHYANIAHAVYADSRLTAQQLQKSIDRFLQTPTAKGLEEVKQAWLAARVPYQQSEVF 90

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--NEENNLYTANIIANSKIIVNEKEI 145
           RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  NE  N   ANI+AN+ + +   ++
Sbjct: 91  RFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHELGNEGAN---ANIVANTSLTIGANKL 147

Query: 146 DLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-C 204
           D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G R YTD+  G  C
Sbjct: 148 DVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQDLNGTKAGAGARSYTDYLQGKEC 207

Query: 205 TGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATKDLMKDINA-GLNSIITGMTS 261
           T G+C RR +YLK  +++LV+DLE M K W  G  G   + L+ + +  GL  ++ GM S
Sbjct: 208 TNGNCDRRAQYLKAAAQLLVTDLEWMEKQWANGEKGNYRQQLLNESSENGLRKMLFGMGS 267

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + +TG Y R +G ++ G
Sbjct: 268 LSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNIFTGTYTRADGSELKG 327

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIVRN 380
            S+++L++  + + A+EI  +F         L   AE N + FDQ+I+ +N  G+ I+  
Sbjct: 328 PSLYELVAEKDASAAKEILQQFEAARTQVGELVTSAEKNNQHFDQLIAADNTAGHAIINQ 387

Query: 381 LINDLITQTESLRKIR--IALDLIEPN 405
            I  L+ QT S+ +    I +D + P+
Sbjct: 388 AIMALVVQTGSIERAAGIIGIDNLNPD 414


>gi|262189894|ref|ZP_06048216.1| iron-regulated protein A precursor [Vibrio cholerae CT 5369-93]
 gi|262034223|gb|EEY52641.1| iron-regulated protein A precursor [Vibrio cholerae CT 5369-93]
          Length = 420

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/398 (41%), Positives = 233/398 (58%), Gaps = 12/398 (3%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           A S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  P  + LE  +  W+ 
Sbjct: 20  AASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQAPTAQGLEEVKQAWLA 79

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--NEENNLYTANIIA 134
           AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  NE  N   ANIIA
Sbjct: 80  ARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHELGNEGAN---ANIIA 136

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNR 194
           N+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G R
Sbjct: 137 NTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQDLNGTKAGAGAR 196

Query: 195 PYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINA 250
            YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D    + L +    
Sbjct: 197 SYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKDNYRQQLLSESAEN 256

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
           GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG 
Sbjct: 257 GLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNIYTGS 316

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISE 369
           Y R +G ++ G S++ L++  + N A+EI  +F         L   AE N + FDQ+I+ 
Sbjct: 317 YTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAEKNNQHFDQLIAA 376

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           +N  G+ I+   I  L+ QT S+ +    I +D + P+
Sbjct: 377 DNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPD 414


>gi|153212296|ref|ZP_01948084.1| iron-regulated protein A, putative [Vibrio cholerae 1587]
 gi|153801301|ref|ZP_01955887.1| iron-regulated protein A, putative [Vibrio cholerae MZO-3]
 gi|153829589|ref|ZP_01982256.1| putative iron-regulated protein A [Vibrio cholerae 623-39]
 gi|254291715|ref|ZP_04962502.1| iron-regulated protein A, putative [Vibrio cholerae AM-19226]
 gi|124116674|gb|EAY35494.1| iron-regulated protein A, putative [Vibrio cholerae 1587]
 gi|124123126|gb|EAY41869.1| iron-regulated protein A, putative [Vibrio cholerae MZO-3]
 gi|148874923|gb|EDL73058.1| putative iron-regulated protein A [Vibrio cholerae 623-39]
 gi|150422399|gb|EDN14359.1| iron-regulated protein A, putative [Vibrio cholerae AM-19226]
          Length = 435

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 166/410 (40%), Positives = 239/410 (58%), Gaps = 14/410 (3%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I++ +    S + +  P  +  +V+++YA IAHA Y D+ + A+ L   I+  +  P  
Sbjct: 25  AILASLTLTTSASFAAAPTQA--QVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQAPTA 82

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--N 122
           + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  N
Sbjct: 83  QGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHELGN 142

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           E  N   ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 143 EGAN---ANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQ 199

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DG 238
           DL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D 
Sbjct: 200 DLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKDN 259

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 260 YRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 319

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   AE
Sbjct: 320 NEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAE 379

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
            N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    I +D + P+
Sbjct: 380 KNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPD 429


>gi|229525863|ref|ZP_04415268.1| iron-regulated protein A precursor [Vibrio cholerae bv. albensis
           VL426]
 gi|229529656|ref|ZP_04419046.1| iron-regulated protein A precursor [Vibrio cholerae 12129(1)]
 gi|229333430|gb|EEN98916.1| iron-regulated protein A precursor [Vibrio cholerae 12129(1)]
 gi|229339444|gb|EEO04461.1| iron-regulated protein A precursor [Vibrio cholerae bv. albensis
           VL426]
          Length = 420

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 166/410 (40%), Positives = 239/410 (58%), Gaps = 14/410 (3%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I++ +    S + +  P  +  +V+++YA IAHA Y D+ + A+ L   I+  +  P  
Sbjct: 10  AILASLTLTTSASFAAAPTQA--QVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQAPTA 67

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--N 122
           + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  N
Sbjct: 68  QGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHELGN 127

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           E  N   ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 128 EGAN---ANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DG 238
           DL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D 
Sbjct: 185 DLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKDN 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   AE
Sbjct: 305 NEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAE 364

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
            N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    I +D + P+
Sbjct: 365 KNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPD 414


>gi|229505149|ref|ZP_04394659.1| iron-regulated protein A precursor [Vibrio cholerae BX 330286]
 gi|229511179|ref|ZP_04400658.1| iron-regulated protein A precursor [Vibrio cholerae B33]
 gi|229518298|ref|ZP_04407742.1| iron-regulated protein A precursor [Vibrio cholerae RC9]
 gi|229608169|ref|YP_002878817.1| iron-regulated protein A precursor [Vibrio cholerae MJ-1236]
 gi|255745660|ref|ZP_05419608.1| iron-regulated protein A precursor [Vibrio cholera CIRS 101]
 gi|262159063|ref|ZP_06030175.1| iron-regulated protein A precursor [Vibrio cholerae INDRE 91/1]
 gi|262169421|ref|ZP_06037113.1| iron-regulated protein A precursor [Vibrio cholerae RC27]
 gi|229345013|gb|EEO09987.1| iron-regulated protein A precursor [Vibrio cholerae RC9]
 gi|229351144|gb|EEO16085.1| iron-regulated protein A precursor [Vibrio cholerae B33]
 gi|229357372|gb|EEO22289.1| iron-regulated protein A precursor [Vibrio cholerae BX 330286]
 gi|229370824|gb|ACQ61247.1| iron-regulated protein A precursor [Vibrio cholerae MJ-1236]
 gi|255736735|gb|EET92132.1| iron-regulated protein A precursor [Vibrio cholera CIRS 101]
 gi|262022234|gb|EEY40943.1| iron-regulated protein A precursor [Vibrio cholerae RC27]
 gi|262029248|gb|EEY47900.1| iron-regulated protein A precursor [Vibrio cholerae INDRE 91/1]
          Length = 420

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 166/410 (40%), Positives = 240/410 (58%), Gaps = 14/410 (3%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           TI++ +    S + +  P  +  +V+++YA IA+A Y D+ + A+ L   I+  +  P  
Sbjct: 10  TILASLTLTTSASFAAAPTQA--QVVEHYADIAYAVYADSRVTAQQLQKTIDRFLQAPTA 67

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--N 122
           + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  N
Sbjct: 68  QGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHELGN 127

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           E  N   ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 128 EGAN---ANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DG 238
           DL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D 
Sbjct: 185 DLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKDN 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   AE
Sbjct: 305 NEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAE 364

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
            N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    I +D + P+
Sbjct: 365 KNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPD 414


>gi|15641277|ref|NP_230909.1| iron-regulated protein A, putative [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121590729|ref|ZP_01678060.1| iron-regulated protein A, putative [Vibrio cholerae 2740-80]
 gi|147673863|ref|YP_001216829.1| putative iron-regulated protein A [Vibrio cholerae O395]
 gi|153819649|ref|ZP_01972316.1| iron-regulated protein A, putative [Vibrio cholerae NCTC 8457]
 gi|227081436|ref|YP_002809987.1| putative iron-regulated protein A [Vibrio cholerae M66-2]
 gi|254848388|ref|ZP_05237738.1| iron-regulated protein A [Vibrio cholerae MO10]
 gi|298498644|ref|ZP_07008451.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9655748|gb|AAF94423.1| iron-regulated protein A, putative [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121547410|gb|EAX57521.1| iron-regulated protein A, putative [Vibrio cholerae 2740-80]
 gi|126509808|gb|EAZ72402.1| iron-regulated protein A, putative [Vibrio cholerae NCTC 8457]
 gi|146315746|gb|ABQ20285.1| putative iron-regulated protein A [Vibrio cholerae O395]
 gi|227009324|gb|ACP05536.1| putative iron-regulated protein A [Vibrio cholerae M66-2]
 gi|227013181|gb|ACP09391.1| putative iron-regulated protein A [Vibrio cholerae O395]
 gi|254844093|gb|EET22507.1| iron-regulated protein A [Vibrio cholerae MO10]
 gi|297542977|gb|EFH79027.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 435

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 166/410 (40%), Positives = 240/410 (58%), Gaps = 14/410 (3%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           TI++ +    S + +  P  +  +V+++YA IA+A Y D+ + A+ L   I+  +  P  
Sbjct: 25  TILASLTLTTSASFAAAPTQA--QVVEHYADIAYAVYADSRVTAQQLQKTIDRFLQAPTA 82

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--N 122
           + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  N
Sbjct: 83  QGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHELGN 142

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           E  N   ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 143 EGAN---ANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQ 199

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DG 238
           DL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D 
Sbjct: 200 DLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKDN 259

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 260 YRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 319

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   AE
Sbjct: 320 NEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAE 379

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
            N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    I +D + P+
Sbjct: 380 KNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPD 429


>gi|262275616|ref|ZP_06053425.1| iron-regulated protein A precursor [Grimontia hollisae CIP 101886]
 gi|262219424|gb|EEY70740.1| iron-regulated protein A precursor [Grimontia hollisae CIP 101886]
          Length = 417

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 160/371 (43%), Positives = 228/371 (61%), Gaps = 8/371 (2%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+ +YA +AHA + DA   A+ LD+AI+ L+ +P+  +L +A+  W+ AR+PYQQSEV+R
Sbjct: 29  VVSHYADLAHAVFVDAHTSAKQLDAAIDELIKSPSNASLASAKKAWLAARVPYQQSEVFR 88

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ ++NAWPLDEG IDYV   Y  E   N    ANI+AN  + V  + +D+S
Sbjct: 89  FGNAIVDDWEGQLNAWPLDEGLIDYVAEGYQYE-LGNPGAVANIVANMSLTVGSETLDVS 147

Query: 149 IISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CTGG 207
            I+P+L+  L+   G + N+ +GYH IEFLLWGQDL       GNR YTDF  G  CT G
Sbjct: 148 TITPELIASLNEIGGSEANVASGYHAIEFLLWGQDLNGTNAGAGNRAYTDFSYGEACTNG 207

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ---ATKDLMKDINAGLNSIITGMTSLSY 264
           +C RR +YLK  S++LV DL  M   W  D +     + +  D   GL  ++ GM SLS 
Sbjct: 208 NCERRRDYLKAASELLVEDLAWMESQWAADKKDNYRAELIANDARHGLRKMLFGMGSLSL 267

Query: 265 NELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASI 324
            ELAGERM + L  +  E E DCFSDNT+ S+  + +GI +  TG Y R++G ++ G S+
Sbjct: 268 GELAGERMKVALEANSTEDEHDCFSDNTHNSHFYNELGIYNVLTGSYQRIDGSELSGPSL 327

Query: 325 HDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE--NIESFDQMISENNPEGNKIVRNLI 382
            D++   N   A +I   F +     + L + AE  N+  FDQ+I+ +N  G+K+V N I
Sbjct: 328 LDMVRAKNDKAATDIKANFDSARSAVYALVESAEKDNV-YFDQLIASDNAVGHKLVNNAI 386

Query: 383 NDLITQTESLR 393
           + L+ QT+S+ 
Sbjct: 387 SALVAQTQSIE 397


>gi|327483952|gb|AEA78359.1| Iron-regulated protein A precursor [Vibrio cholerae LMA3894-4]
          Length = 420

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 166/410 (40%), Positives = 239/410 (58%), Gaps = 14/410 (3%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I++ +    S + +  P  +  +V+++YA IAHA Y D+ + A+ L   I+  +  P  
Sbjct: 10  AILASLTLTTSASFAAAPTQA--QVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQAPTA 67

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--N 122
           + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  N
Sbjct: 68  QGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHELGN 127

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           E  N   ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 128 EGAN---ANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPDG 238
           DL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D 
Sbjct: 185 DLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWVSGEKDN 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   AE
Sbjct: 305 NEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAE 364

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
            N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    I +D + P+
Sbjct: 365 KNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPD 414


>gi|229521377|ref|ZP_04410796.1| iron-regulated protein A precursor [Vibrio cholerae TM 11079-80]
 gi|229341475|gb|EEO06478.1| iron-regulated protein A precursor [Vibrio cholerae TM 11079-80]
          Length = 420

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 165/400 (41%), Positives = 235/400 (58%), Gaps = 14/400 (3%)

Query: 15  SHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
           S + +  P  +  +V+++YA IAHA Y D+ + A+ L   I+  +  P  + LE  +  W
Sbjct: 20  SASFAAAPTQA--QVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQAPTAQGLEEVKQAW 77

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--NEENNLYTANI 132
           + AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  NE  N   ANI
Sbjct: 78  LAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHELGNEGAN---ANI 134

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           IAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G
Sbjct: 135 IANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQDLNGTKAGAG 194

Query: 193 NRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDI 248
            R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D    + L +  
Sbjct: 195 ARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKDNYRQQLLSESA 254

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
             GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YT
Sbjct: 255 ENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNIYT 314

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMI 367
           G Y R +G ++ G S++ L++  + N A+EI  +F         L   AE N + FDQ+I
Sbjct: 315 GSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAEKNNQHFDQLI 374

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           + +N  G+ I+   I  L+ QT S+ +    I +D + P+
Sbjct: 375 AADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPD 414


>gi|86148451|ref|ZP_01066741.1| Uncharacterized iron-regulated protein [Vibrio sp. MED222]
 gi|218709910|ref|YP_002417531.1| putative iron-regulated protein A [Vibrio splendidus LGP32]
 gi|85833748|gb|EAQ51916.1| Uncharacterized iron-regulated protein [Vibrio sp. MED222]
 gi|218322929|emb|CAV19106.1| putative iron-regulated protein A [Vibrio splendidus LGP32]
          Length = 419

 Score =  309 bits (791), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 165/414 (39%), Positives = 248/414 (59%), Gaps = 13/414 (3%)

Query: 4   ITIISIVFTLPSHAL-----SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETL 58
           +TI S+V    + +L     S    V+ ++V+++YA IAHA + D+++ A+ L+S+I+T 
Sbjct: 1   MTIKSLVTKAVTSSLIFASASSFAAVTQDQVVEHYADIAHAVFADSVITAKALNSSIDTF 60

Query: 59  VTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSY 118
           + +P+  N E  +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y
Sbjct: 61  LASPSAGNFEQVKQAWLDSRVPYQQSEVFRFGNVVVDDWEGQLNAWPLDEGLIDYVSTDY 120

Query: 119 GKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFL 178
             E   N   +ANI+AN    + +  +D + I+P+L+  L+   G + N+ +GYH IEFL
Sbjct: 121 QYE-LGNEGASANIVANKTFQIGQTTVDATNITPELIADLNEIGGSEANVASGYHAIEFL 179

Query: 179 LWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--G 235
           LWGQDL       G R YTDF +G  CT G+C RR  YLK  +++L+ DLE M K W  G
Sbjct: 180 LWGQDLNGTNSGAGERAYTDFVVGAECTNGNCDRRGAYLKASAELLIQDLEWMEKQWAEG 239

Query: 236 PDGQATKDLMKDINA-GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYA 294
             G   ++L+ + +  GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ 
Sbjct: 240 EKGNYRQELLSESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHN 299

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
           S+  +  GI + YTG Y R +G  + G S+ DL+   +   A+EI  +F         L 
Sbjct: 300 SHYYNEQGIYNVYTGLYKREDGSLLSGPSLFDLVEQKDEQAAKEIQKQFDLARAQVGQLV 359

Query: 355 DRAE-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
             AE N + FDQ+I+ +N  GN +V   I  L++QT ++ +    I +D + P+
Sbjct: 360 VSAEKNNQHFDQLIAADNAAGNALVNKTIVALVSQTAAIERAAGVIGIDSLNPD 413


>gi|229515638|ref|ZP_04405097.1| iron-regulated protein A precursor [Vibrio cholerae TMA 21]
 gi|229347407|gb|EEO12367.1| iron-regulated protein A precursor [Vibrio cholerae TMA 21]
          Length = 420

 Score =  308 bits (790), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 165/410 (40%), Positives = 238/410 (58%), Gaps = 14/410 (3%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I++ +    S + +  P  +  +V+++YA IAHA Y D+ + A+ L   I+  +  P  
Sbjct: 10  AILASLTLTTSASFAAAPTQA--QVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQAPTA 67

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--N 122
           + LE  +  W+  R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  N
Sbjct: 68  QGLEEVKQAWLATRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHELGN 127

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           E  N   ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 128 EGAN---ANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DG 238
           DL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D 
Sbjct: 185 DLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKDN 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   AE
Sbjct: 305 NEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAE 364

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
            N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    I +D + P+
Sbjct: 365 KNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPD 414


>gi|84393101|ref|ZP_00991866.1| Uncharacterized iron-regulated protein [Vibrio splendidus 12B01]
 gi|84376258|gb|EAP93141.1| Uncharacterized iron-regulated protein [Vibrio splendidus 12B01]
          Length = 419

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 159/389 (40%), Positives = 238/389 (61%), Gaps = 8/389 (2%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V+ ++V+++YA IAHA + D+++ A+ L+S+I+T + +P+  N E  +  W+ +R+PYQQ
Sbjct: 26  VTQDQVVEHYADIAHAVFADSVITAKALNSSIDTFLASPSAGNFEQVKQAWLESRVPYQQ 85

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           SEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E   N   +ANI+AN    + + 
Sbjct: 86  SEVFRFGNVVVDDWEGQLNAWPLDEGLIDYVSTDYQYE-LGNEGASANIVANKTFQIGQT 144

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG- 202
            +D + I+P+L+  L+   G + N+ +GYH IEFLLWGQDL       G R YTDF +G 
Sbjct: 145 TVDATNITPELIADLNEIGGSEANVASGYHAIEFLLWGQDLNGTNSGAGERVYTDFVVGA 204

Query: 203 NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATKDLMKD-INAGLNSIITGM 259
            CT G+C RR  YLK  +++L+ DLE M K W  G  G   ++L+ +  + GL  ++ GM
Sbjct: 205 ECTNGNCDRRGAYLKASAELLIQDLEWMEKQWAEGEKGNYRQELLSESSDNGLRKMLFGM 264

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG Y R +G  +
Sbjct: 265 GSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYTGLYKREDGTLL 324

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIV 378
            G S+ DL+   +   A+EI  +F         L   AE N + FDQ+I+ +N  GN +V
Sbjct: 325 SGPSLFDLVEQKDEQAAKEIQKQFDLARAQVGQLVTSAEKNNQHFDQLIAADNAAGNALV 384

Query: 379 RNLINDLITQTESLRKIR--IALDLIEPN 405
              I  L++QT ++ +    I +D + P+
Sbjct: 385 NKTIVALVSQTAAIERAAGVIGIDSLNPD 413


>gi|104780332|ref|YP_606830.1| hypothetical protein PSEEN1119 [Pseudomonas entomophila L48]
 gi|95109319|emb|CAK14019.1| conserved hypothetical protein; putative signal peptide
           [Pseudomonas entomophila L48]
          Length = 442

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 164/391 (41%), Positives = 235/391 (60%), Gaps = 7/391 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+++YA + HA Y D+L  A+ L +A++  + TPN + L+ A+  W  AR+P
Sbjct: 47  VDETAGKAVVKHYAEMVHAVYSDSLSTAKQLQTAVDAFLATPNDQTLKAAKEAWAAARVP 106

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN++I V
Sbjct: 107 YLQSEAFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPAASANIIANTQIQV 165

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+ 
Sbjct: 166 GEDKVDVKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYL 225

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+++LV DLEEM+  W P   D          +N GL  ++
Sbjct: 226 EGKGATGGHNDRRRAYLKAVTELLVKDLEEMVGNWAPNVADNYRATLENGPVNDGLRKML 285

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R++G
Sbjct: 286 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRVDG 345

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN+
Sbjct: 346 SKLTGPSLSSLVAKVDPATDATLKADLEATEAKIQVMVDHALKGEHYDQLIAADNAAGNQ 405

Query: 377 IVRNLINDLITQTESLRKI--RIALDLIEPN 405
           IVR+ I  L+ QT ++ +   ++ +D + P+
Sbjct: 406 IVRDAIASLVKQTGAIEQAAGKLGIDNLNPD 436


>gi|77460709|ref|YP_350216.1| hypothetical protein Pfl01_4488 [Pseudomonas fluorescens Pf0-1]
 gi|77384712|gb|ABA76225.1| imelysin. Metallo peptidase. MEROPS family M75 [Pseudomonas
           fluorescens Pf0-1]
          Length = 448

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 228/377 (60%), Gaps = 5/377 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+ +YA +  A Y DA   A+TL +AI+  +  P+   L+ A+  W+ AR+P
Sbjct: 53  VDEAAGKAVVAHYADMVFAVYSDAESTAKTLQTAIDAFLAKPDADTLKAAKAAWVAARVP 112

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSEV+RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   TANIIAN+++ V
Sbjct: 113 YLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGATANIIANTEVQV 171

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL +     GNRP +D+ 
Sbjct: 172 GEDKVDVKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNSTGPGAGNRPASDYL 231

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+++LVSDLEEM+  W P   D        +   +GL  ++
Sbjct: 232 EGKGATGGHNDRRRAYLKAVTQLLVSDLEEMVANWKPNVADNYRATLEAEPAESGLRKML 291

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R++G
Sbjct: 292 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGIRNVYLGEYTRVDG 351

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ GAS+  L++  +      +    + T     ++ D A   E +DQ+I+  N  GN+
Sbjct: 352 TKLTGASLSSLVAKVDPAADTALKADLAATEAKIQVMVDHANKGEHYDQLIAAGNTAGNQ 411

Query: 377 IVRNLINDLITQTESLR 393
           IVR+ I  L+ QT S+ 
Sbjct: 412 IVRDAIASLVKQTGSIE 428


>gi|126666893|ref|ZP_01737869.1| putative iron-regulated protein A [Marinobacter sp. ELB17]
 gi|126628609|gb|EAZ99230.1| putative iron-regulated protein A [Marinobacter sp. ELB17]
          Length = 438

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 158/378 (41%), Positives = 229/378 (60%), Gaps = 7/378 (1%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V+   V+ +YA +AHA +ED+L+ AR L++A + L+ +P+  NL+ A+  W  AR+PYQQ
Sbjct: 42  VNQNTVVAHYADVAHATFEDSLITARALNAATDRLIASPSDANLKAAKEAWYAARVPYQQ 101

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           SE +RFGN ++D W+ +VNAWPLDEG IDYV S   +    N   TANIIA++ I V  +
Sbjct: 102 SEAFRFGNTLIDDWEGQVNAWPLDEGLIDYVTSDDYQYELGNAGATANIIASTSINVGGE 161

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG- 202
           ++D+S ++ +LL  L+   G + N+ +GYH IEFLLWGQDL       G RP +D+  G 
Sbjct: 162 QLDVSTLTAELLANLNEIGGSEANVASGYHAIEFLLWGQDLNGFDAGNGERPVSDYQQGE 221

Query: 203 NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGM 259
           +CT G+C RR +YL  V+ +LV DLE M   W     D    +    D   G+  ++ GM
Sbjct: 222 DCTNGNCDRRGQYLDAVTDLLVDDLEWMTVQWARGSSDNYRAQLTSADAGEGVQKMLFGM 281

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG Y R++   +
Sbjct: 282 GSLSLGELAGERMKVALEANSYEDEHDCFSDNTHNSHYYNGQGIQNVYTGTYRRVDNSVV 341

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE---SFDQMISENNPEGNK 376
            G S+ DL+   N  L  E+N +   TM+    +K +AE+ +   +FD MI+  N +G K
Sbjct: 342 TGPSLADLVEQTNPQLNAELNKQLDKTMQALAFMKAKAESSQTPMAFDMMIAPGNGDGAK 401

Query: 377 IVRNLINDLITQTESLRK 394
           IV + I  L+ QT S+ +
Sbjct: 402 IVNDAIMALVVQTGSIEQ 419


>gi|218515129|ref|ZP_03511969.1| hypothetical protein Retl8_16281 [Rhizobium etli 8C-3]
          Length = 293

 Score =  301 bits (772), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 141/273 (51%), Positives = 191/273 (69%), Gaps = 1/273 (0%)

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
           AN+IAN  I ++ K++D S ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL    
Sbjct: 2   ANVIANKTIKIDGKDVDASKLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTG 61

Query: 189 REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDI 248
              GNR  TD+D+ NCT G+C RR EYLK  S +LVSDL+EM   W PDG A K++  D 
Sbjct: 62  PGAGNRLATDYDLKNCTHGNCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAAAKNVEADP 121

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
            AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YT
Sbjct: 122 KAGLVAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYT 181

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
           G Y R++G K+ G S+HDL++  ++ L  E+  K + T+   + +  R E +E +DQMI+
Sbjct: 182 GNYTRVDGTKLSGPSLHDLVAAKDKALDAELEGKLNKTLDAMNAMAKRGETVEKYDQMIA 241

Query: 369 ENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           E N +GN +V+  ++ LI QT+S++++  ALDL
Sbjct: 242 EGNKDGNAVVQAAVDGLIDQTKSIQRVIAALDL 274


>gi|70732153|ref|YP_261909.1| putative lipoprotein [Pseudomonas fluorescens Pf-5]
 gi|68346452|gb|AAY94058.1| lipoprotein, putative [Pseudomonas fluorescens Pf-5]
          Length = 446

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 169/399 (42%), Positives = 236/399 (59%), Gaps = 7/399 (1%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           T  + A   V   + + V+ +YA +  A Y D+   A+TL +AI+  +  PN   L+ A+
Sbjct: 42  TPAADAAGKVDEAAAKAVVAHYADMVFAVYSDSESTAKTLQTAIDAFLAKPNDDTLKAAK 101

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W+ AR+PY QSEV+RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   TAN
Sbjct: 102 AAWVAARVPYLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGATAN 160

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
           IIAN++I V E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       
Sbjct: 161 IIANTEIQVGEDKVDVKDITPEKLASLNELGGAEANVATGYHAIEFLLWGQDLNGTGPGA 220

Query: 192 GNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD----GQATKDLMK 246
           G RP +D+  G   TGGH  RR  YLK V+++LV+DLEEM+  W PD     +AT +  +
Sbjct: 221 GARPASDYLEGAGATGGHNDRRRAYLKAVTQLLVNDLEEMVGNWKPDVADNYRATLE-AE 279

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
               GL  ++ GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + 
Sbjct: 280 PAETGLRKMLFGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGIRNV 339

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
           Y GEY R +G K+ GAS+  L++  +      +    + T     ++ D A   E +DQ+
Sbjct: 340 YLGEYTRTDGTKMSGASLSSLVAKADPAADAALKADLAATEAKIQVMVDHANKGEHYDQL 399

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           I+  N  GN+IVR+ I  L+ QT S+ +    L + + N
Sbjct: 400 IAAGNESGNQIVRDAIAALVKQTGSIEQAAGKLGISDLN 438


>gi|312962702|ref|ZP_07777191.1| iron-regulated protein [Pseudomonas fluorescens WH6]
 gi|311283077|gb|EFQ61669.1| iron-regulated protein [Pseudomonas fluorescens WH6]
          Length = 447

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 165/378 (43%), Positives = 230/378 (60%), Gaps = 7/378 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+ +YA +  A Y DA   A+TL +AI+  +  PN + L+ AR  W+ AR+P
Sbjct: 52  VDETAAKAVVAHYADMVFAVYSDAESTAKTLQTAIDAFLAKPNDETLKAARAAWVAARVP 111

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSEV+RFGN I+D W+ +VNAWPLDEG IDY D SY +    N   TANIIAN++I +
Sbjct: 112 YLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYTDKSY-EHALGNPGATANIIANTQIQI 170

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+ +I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+ 
Sbjct: 171 GEDKIDVKVITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGKRPASDYL 230

Query: 201 IGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ----ATKDLMKDINAGLNSI 255
            G+  TGGH  RR  YL  V+++LVSDLEEM+  W P+ +    AT +     + GL  +
Sbjct: 231 TGSGATGGHNERRRAYLSAVTQLLVSDLEEMVGNWKPNVEDNYRATLEAEPATD-GLRKM 289

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           + GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R++
Sbjct: 290 LFGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGIRNVYLGEYTRVD 349

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGN 375
           G K+ GAS+  L++  +      +    + T     ++ D A   E +DQ+I+  N  GN
Sbjct: 350 GTKMTGASLSSLVAKADPAADTALKADLAATEAKIQVMVDHANKGEHYDQLIAAGNEAGN 409

Query: 376 KIVRNLINDLITQTESLR 393
           +IVR+ I  L+ QT S+ 
Sbjct: 410 QIVRDAIAALVKQTGSIE 427


>gi|226945830|ref|YP_002800903.1| hypothetical protein Avin_37840 [Azotobacter vinelandii DJ]
 gi|171854884|dbj|BAG16626.1| iron-regulated protein-like protein homolog [Azotobacter
           vinelandii]
 gi|226720757|gb|ACO79928.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 441

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 158/388 (40%), Positives = 228/388 (58%), Gaps = 7/388 (1%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
            +   V+ +YA +A A + D+L  A+ L  AI+ L+  P    L+ AR  WI AR+PY Q
Sbjct: 49  AAARAVVNHYADLALAVFGDSLSTAKALQQAIDALLAKPAADTLQAAREAWIAARVPYMQ 108

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           SEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y +    N   TANIIAN++I V E+
Sbjct: 109 SEVFRFGNPVVDEWEGQLNAWPLDEGLIDYVAADY-QHALGNPGATANIIANTEIQVGEE 167

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           +ID++ I+ + L  L+   G + N+ TGYH IEFLLWGQDL       G RP +DF  G 
Sbjct: 168 KIDVTEITGEALASLNELAGSEANVATGYHAIEFLLWGQDLNGTAPGAGQRPASDFQAGE 227

Query: 204 -CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDINA-GLNSIITGM 259
            CTGGHC RR  YL+ V+ +LVSDL+ M++ W P         L KD  A GL  ++ GM
Sbjct: 228 ACTGGHCERRRAYLEAVTDLLVSDLQYMVEQWQPQVADNYRASLEKDPAANGLRKMLFGM 287

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            SLS  ELAGERM + L  +  E E DCFSDNT+ ++  +  GI + Y GEY +++G  +
Sbjct: 288 GSLSLGELAGERMKVPLEANSTEDEQDCFSDNTHNAHFYNGKGIRNVYLGEYRKLDGSLL 347

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVR 379
            G ++  L++  +      +      +      L D A   + FDQ+I+ +N  G ++VR
Sbjct: 348 SGPNLSSLVAKADAQADATLKADLEASEARLQALVDNAAKDQHFDQLIAADNAAGQQLVR 407

Query: 380 NLINDLITQTESLRK--IRIALDLIEPN 405
           + I  L+ QT S+ +   R+ +  + P+
Sbjct: 408 DAIAALVKQTSSIEQAAARLGIGDLNPD 435


>gi|261211007|ref|ZP_05925297.1| iron-regulated protein A precursor [Vibrio sp. RC341]
 gi|260839982|gb|EEX66582.1| iron-regulated protein A precursor [Vibrio sp. RC341]
          Length = 420

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 158/385 (41%), Positives = 232/385 (60%), Gaps = 8/385 (2%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +V+++YA IAHA Y D+ + A+ L  +I+  +  P  K L++ +  W+ AR+PYQQSEV+
Sbjct: 31  QVVEHYADIAHAVYADSRVTAQQLQKSIDRFLQKPTAKGLDDVKQAWLAARVPYQQSEVF 90

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ ++NAWPLDEG IDYV  +Y  E   N    ANI+AN+ + +    ID+
Sbjct: 91  RFGNTIVDDWEGQLNAWPLDEGLIDYVAGTYQHE-LGNAGANANIVANTSLTIGANNIDV 149

Query: 148 SIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CTG 206
             I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G R YTD+  G  CT 
Sbjct: 150 QEITPELLASLNEIGGSEANVASGYHAIEFLLWGQDLNGTKAGAGTRSYTDYLQGKECTN 209

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATKDLMKDINA-GLNSIITGMTSLS 263
           G+C RR +YL   +++LV+DLE M K W  G  G   + L+ + +  GL  ++ GM SLS
Sbjct: 210 GNCDRRAQYLNAAAQLLVTDLEWMEKQWANGEKGNYRQQLLSESSENGLRKMLFGMGSLS 269

Query: 264 YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
             ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + +TG Y R +G ++ G S
Sbjct: 270 LGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNIFTGTYTRADGSELKGPS 329

Query: 324 IHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIVRNLI 382
           ++ L++  + + A+EI  +F         L   AE N + FDQ+I+ +N  G+ I+   I
Sbjct: 330 LYALVAEKDASAAKEILQQFETARTQVGELVTLAEKNNQHFDQLIAADNTAGHAIINQAI 389

Query: 383 NDLITQTESLRKIR--IALDLIEPN 405
             L+ QT S+ +    I +D + P+
Sbjct: 390 MALVVQTGSIERAAGIIGIDNLNPD 414


>gi|152986581|ref|YP_001350275.1| hypothetical protein PSPA7_4939 [Pseudomonas aeruginosa PA7]
 gi|150961739|gb|ABR83764.1| hypothetical protein PSPA7_4939 [Pseudomonas aeruginosa PA7]
          Length = 475

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 157/392 (40%), Positives = 228/392 (58%), Gaps = 8/392 (2%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   +   V++NYA +A A + DAL  AR L  A++  +  P+ + L+ A+  W  AR P
Sbjct: 79  VDEAAARAVIKNYADLAEATFADALSTARELQKAVDAFLAKPDAETLKAAKEAWFAARTP 138

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYV   Y +    N   TANI+AN++I V
Sbjct: 139 YSQSEAFRFGNAIIDDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIVANTEIQV 197

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+  I+ + L  L+   G + N+ TGYH IEFLLWGQDL       G+RP TD+ 
Sbjct: 198 GEDKIDVKEITGEKLAGLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGDRPATDYA 257

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSII 256
            G +CTGGHC RR  YLK V+ +LVSDLE M   W     D    K   + ++ GL  + 
Sbjct: 258 QGKDCTGGHCDRRAAYLKAVTDLLVSDLEYMAGQWKAGVADNYRAKLEAEPVDTGLRKMF 317

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSD+T+ +   +   I + Y GEY R++G
Sbjct: 318 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDDTHHTLFFNAKSIRNIYLGEYKRVDG 377

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGN 375
             + G S+ DL++  +      +    ++T     ++ D AE +   FDQMI+ +N EG 
Sbjct: 378 SVVKGPSLADLVAKADAAANDTLKADLADTEAKLQVIVDSAEKDGVHFDQMIAPDNKEGQ 437

Query: 376 KIVRNLINDLITQTESLRKI--RIALDLIEPN 405
           + +R+ I  L+ QT ++ +   ++ +  ++P+
Sbjct: 438 QKIRDAIAALVKQTGAIEQAAGKLGIQDLKPD 469


>gi|254427956|ref|ZP_05041663.1| hypothetical protein ADG881_1186 [Alcanivorax sp. DG881]
 gi|196194125|gb|EDX89084.1| hypothetical protein ADG881_1186 [Alcanivorax sp. DG881]
          Length = 429

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 163/378 (43%), Positives = 225/378 (59%), Gaps = 4/378 (1%)

Query: 27  EKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEV 86
           ++V+ +YA +A A + DAL  AR L + I+ L+  P + NL  AR  W  AR+PY Q+EV
Sbjct: 41  KRVVSHYADVALATFGDALSGARALKTQIDALLAAPTEANLAAARDAWRAARVPYMQTEV 100

Query: 87  YRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEID 146
           +RFGN +VD W+ +VNAWPLDEG IDYVD  Y +    N    ANIIA+  + + E+ +D
Sbjct: 101 FRFGNAVVDEWEGQVNAWPLDEGLIDYVDEDY-QAVMGNPGARANIIASESLKIGEQTLD 159

Query: 147 LSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCT 205
           L+ ++ +LL  L+   G + N+ TGYH IEFLLWGQDL       G RP TDF  G + T
Sbjct: 160 LTDLNAELLASLNELGGSEVNVATGYHAIEFLLWGQDLNGTDAGAGQRPATDFATGPDAT 219

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK-DLMKD-INAGLNSIITGMTSLS 263
           GGH  RR EYL VV+ +L+ DLE M+  W P  +  + +L  D +  GL  ++ GM SLS
Sbjct: 220 GGHNERRREYLSVVTDLLIDDLEVMVDEWRPGEENYRAELEADSVENGLRKMLFGMGSLS 279

Query: 264 YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
             ELAGERM + L  H PE E DCFSDNT+AS+  +  GI + Y GEY R NGE + G S
Sbjct: 280 LGELAGERMKVALAAHSPEDEHDCFSDNTHASHFYNGKGIRNVYLGEYQRTNGETLAGPS 339

Query: 324 IHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLIN 383
           + DL++ N      ++    + +     +L D A     FDQ+I+  N +G   V   I+
Sbjct: 340 LSDLVAANQPAADSQLKTDLNASEAALQVLVDSANQGTHFDQLIAPGNAQGADTVNAAID 399

Query: 384 DLITQTESLRKIRIALDL 401
            L+ QT S+ K    L++
Sbjct: 400 ALVVQTTSIEKAARVLNI 417


>gi|146308346|ref|YP_001188811.1| hypothetical protein Pmen_3326 [Pseudomonas mendocina ymp]
 gi|145576547|gb|ABP86079.1| imelysin, Metallo peptidase, MEROPS family M75 [Pseudomonas
           mendocina ymp]
          Length = 445

 Score =  299 bits (765), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 160/390 (41%), Positives = 232/390 (59%), Gaps = 6/390 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+ +YA +A A + DA    + L SA++ L+  P++  L+ AR  W+ AR+P
Sbjct: 49  VDEAAAKAVVNHYADLALAVFSDAASTGKALQSAVDALLADPSEATLKAAREAWLAARVP 108

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y Q+EV+RFGN +VD W+ ++NAWPLDEG IDYV   Y +    N    ANIIAN++I V
Sbjct: 109 YMQTEVFRFGNPVVDEWEGQLNAWPLDEGLIDYVADDY-QHALGNPGAQANIIANTEIQV 167

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID++ I+ +LL  L+   G + N+ TGYH IEFLLWGQDL       G RPYTD+ 
Sbjct: 168 GEDKIDVAEITGELLASLNELGGSEANVATGYHAIEFLLWGQDLNGTNPGAGERPYTDYL 227

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATKDLMKDINA-GLNSII 256
           +G   TGGH  RR  YLKV + +LVSDL +M++ W  G +G    +L+ D    GL  ++
Sbjct: 228 VGEGATGGHNERRRTYLKVATDLLVSDLNDMVEQWKDGVEGNYRSELVADSGENGLRKML 287

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y G Y +++G
Sbjct: 288 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYNGKGIRNVYLGVYKKVDG 347

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGN 375
             + G S+ +L++  +      +      T      L D AE N   FDQ+I+E+N EG 
Sbjct: 348 STLSGPSLSELVAKVDAQADASLKADLQATEAKLQALVDSAEKNNVHFDQLIAEDNAEGQ 407

Query: 376 KIVRNLINDLITQTESLRKIRIALDLIEPN 405
           ++VR+ I  L+ QT ++ +    L + + N
Sbjct: 408 QLVRDAIAALVKQTGAIEQAAAKLGISDLN 437


>gi|330504568|ref|YP_004381437.1| hypothetical protein MDS_3654 [Pseudomonas mendocina NK-01]
 gi|328918854|gb|AEB59685.1| hypothetical protein MDS_3654 [Pseudomonas mendocina NK-01]
          Length = 445

 Score =  298 bits (764), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 158/379 (41%), Positives = 227/379 (59%), Gaps = 6/379 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+ +YA +A A + DA    + L +A++ L+  P++  L+ AR  W+ AR+P
Sbjct: 49  VDEAAAKAVVNHYADLALAVFSDAASTGKALQAAVDALLADPSEATLKAAREAWLAARVP 108

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y Q+EV+RFGN +VD W+ ++NAWPLDEG IDYV   Y +    N    ANIIAN++I V
Sbjct: 109 YMQTEVFRFGNPVVDEWEGQLNAWPLDEGLIDYVADDY-QHALGNPGAQANIIANTEIQV 167

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+S I+ +LL  L+   G + N+ TGYH IEFLLWGQDL       G RPYTD+ 
Sbjct: 168 GEDKIDVSEITGELLASLNELGGSEANVATGYHAIEFLLWGQDLNGTNPGAGERPYTDYL 227

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATKDLMKD-INAGLNSII 256
           +G   TGGH  RR  YLK  + +LVSDL+EM++ W  G +G    +L+ D    GL  ++
Sbjct: 228 VGEGATGGHNERRRTYLKAATDLLVSDLDEMVEQWKDGVEGNYRSELVADSAENGLRKML 287

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY + +G
Sbjct: 288 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYKKADG 347

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGN 375
             + G S+ +L++  +      +      T      L D AE N   FDQ+I+ +N EG 
Sbjct: 348 TTLTGPSLSELVAKADAQADATLKADLQETEAKLQALVDSAEKNNVHFDQLIAADNAEGQ 407

Query: 376 KIVRNLINDLITQTESLRK 394
           ++VR+ I  L+ QT ++ +
Sbjct: 408 QLVRDAIAALVKQTGAIEQ 426


>gi|330981176|gb|EGH79279.1| iron-regulated protein A, putative [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 409

 Score =  298 bits (764), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 158/380 (41%), Positives = 220/380 (57%), Gaps = 5/380 (1%)

Query: 30  LQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRF 89
           + NYA +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RF
Sbjct: 23  VANYANMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRF 82

Query: 90  GNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSI 149
           GN I+D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  
Sbjct: 83  GNTIIDDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKE 141

Query: 150 ISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGH 208
           I+ + L  L+   G + N+ TGYH +EFLLWGQDL       G RP +D+  G   TGGH
Sbjct: 142 ITSEKLASLNELGGSEANVATGYHAVEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGH 201

Query: 209 CRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYN 265
             RR  YLK V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  
Sbjct: 202 NDRRRAYLKAVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLG 261

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+ 
Sbjct: 262 ELAGERMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLS 321

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
            L++  +      +     +T     I+ D A   E FDQ+I+  N  GN++VR+ I  L
Sbjct: 322 SLVAKADPATDATLRADLDDTQAKLQIIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAAL 381

Query: 386 ITQTESLRKIRIALDLIEPN 405
           + QT ++ +    L + + N
Sbjct: 382 VKQTGAIEQAAGKLGITDLN 401


>gi|110833100|ref|YP_691959.1| hypothetical protein ABO_0239 [Alcanivorax borkumensis SK2]
 gi|110646211|emb|CAL15687.1| Uncharacterized iron-regulated protein [Alcanivorax borkumensis
           SK2]
          Length = 429

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 166/378 (43%), Positives = 223/378 (58%), Gaps = 4/378 (1%)

Query: 27  EKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEV 86
           +KV+ +YA +A A Y DAL  AR L + I+ L+  P + +L  AR  W  AR+PY QSEV
Sbjct: 41  KKVVSHYADVALATYTDALAEARKLKTQIDALLAAPTEDSLTAARDAWRAARVPYMQSEV 100

Query: 87  YRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEID 146
           +RFGN +VD W+ +VNAWPLDEG IDYVD  Y      N    ANIIA+  + + E+ +D
Sbjct: 101 FRFGNVVVDEWEGQVNAWPLDEGLIDYVDEDY-HAVMGNPGARANIIASESLKIGEQALD 159

Query: 147 LSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCT 205
           L+ +S +LL  L+   G + N+ TGYH IEFLLWGQDL       G RP TDF  G   T
Sbjct: 160 LTDLSAELLASLNELGGSEVNVATGYHAIEFLLWGQDLNGTDAGAGERPATDFATGPQAT 219

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK-DLMKD-INAGLNSIITGMTSLS 263
           GGH  RR EYL VV+ +L++DLE M+  W P  +  + +L  D +  GL  ++ GM SLS
Sbjct: 220 GGHNARRREYLSVVTDLLINDLEVMVDEWRPGEENYRAELEADSVENGLRKMLFGMGSLS 279

Query: 264 YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
             ELAGERM + L  H PE E DCFSDNT+AS+  +  GI + Y GEY R+NGE + G S
Sbjct: 280 LGELAGERMKVALAAHSPEDEHDCFSDNTHASHFYNGKGIRNVYLGEYRRVNGETLTGPS 339

Query: 324 IHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLIN 383
           + DL++ N   +  ++      +      L D A     FDQ+I+  N EG   V   I+
Sbjct: 340 LSDLVAANKPAIDNQLKADLEASRAALQGLVDSANKGIHFDQLIAPGNSEGAATVNAAID 399

Query: 384 DLITQTESLRKIRIALDL 401
            L+ QT S+      L++
Sbjct: 400 TLVAQTTSIEAAAAVLNI 417


>gi|170720165|ref|YP_001747853.1| hypothetical protein PputW619_0979 [Pseudomonas putida W619]
 gi|169758168|gb|ACA71484.1| conserved hypothetical protein [Pseudomonas putida W619]
          Length = 445

 Score =  297 bits (761), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 157/372 (42%), Positives = 223/372 (59%), Gaps = 5/372 (1%)

Query: 27  EKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEV 86
           + V+++Y  + +A Y D+L  A++L SAI+  +  PN   L+ A+  W  AR+PY QSE 
Sbjct: 56  KAVVKHYTEMVYAVYSDSLSTAKSLQSAIDAFLAKPNDDTLKAAKEAWAAARVPYLQSEA 115

Query: 87  YRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEID 146
           +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   ++NIIAN++I V E+++D
Sbjct: 116 FRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPAASSNIIANTEIQVGEEKVD 174

Query: 147 LSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCT 205
           +  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+  G   T
Sbjct: 175 VKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYLEGKGAT 234

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSL 262
           GGH  RR  YLK V+++LV DLEEM+  W P   D        +    GL  ++ GM SL
Sbjct: 235 GGHNERRRAYLKSVTELLVKDLEEMVGNWAPNVADNYRATLEAEPATDGLRKMLFGMGSL 294

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           S  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +G K+ G 
Sbjct: 295 SLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRADGTKLTGP 354

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN++VR+ I
Sbjct: 355 SLSSLVAKADPAADATLKADLEATEAKLQVIVDHALKGEHYDQLIAADNAAGNQVVRDAI 414

Query: 383 NDLITQTESLRK 394
             L+ QT ++ +
Sbjct: 415 ASLVKQTGAIEQ 426


>gi|107100046|ref|ZP_01363964.1| hypothetical protein PaerPA_01001067 [Pseudomonas aeruginosa PACS2]
          Length = 443

 Score =  297 bits (761), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 157/392 (40%), Positives = 228/392 (58%), Gaps = 8/392 (2%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V++NYA +A A + DAL  A+ L  AI+  +  P+ + L+ A+  W  AR P
Sbjct: 47  VDEAAAKAVIKNYADLAEATFADALSTAKDLQKAIDAFLAKPDAETLKAAKEAWFAARTP 106

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYV   Y +    N   TANI+AN++I V
Sbjct: 107 YSQSEAFRFGNAIIDDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIVANTEIQV 165

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+  I+ + L  L+   G + N+ TGYH IEFLLWGQDL       GNRP TD+ 
Sbjct: 166 GEDKIDVKEITGEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYA 225

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSII 256
            G +CTGGHC RR  YLK V+ +LVSDLE M   W     D    K   + ++ GL  + 
Sbjct: 226 QGKDCTGGHCDRRAAYLKAVTDLLVSDLEYMAGQWKAGVADNYRAKLEAEPVDTGLRKMF 285

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSD+T+ +   +   I + Y GEY R++G
Sbjct: 286 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDDTHHTLFFNGKSIRNIYLGEYKRIDG 345

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGN 375
             + G S+ DL++  +      +    ++T      + D AE +   FDQMI+ +N +G 
Sbjct: 346 SVVKGPSLADLVAKADAAANDTLKADLADTEAKLQAIVDSAEKDGVHFDQMIAPDNKDGQ 405

Query: 376 KIVRNLINDLITQTESLRKI--RIALDLIEPN 405
           + +R+ I  L+ QT ++ +   ++ +  ++P+
Sbjct: 406 QKIRDAIAALVKQTGAIEQAAGKLGIQDLKPD 437


>gi|116052404|ref|YP_792715.1| metalloproteinase outer membrane [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115587625|gb|ABJ13640.1| Insulin-cleaving metalloproteinase outer membrane [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 446

 Score =  297 bits (761), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 157/392 (40%), Positives = 228/392 (58%), Gaps = 8/392 (2%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V++NYA +A A + DAL  A+ L  AI+  +  P+ + L+ A+  W  AR P
Sbjct: 50  VDEAAAKAVIKNYADLAEATFADALSTAKDLQKAIDAFLAKPDAETLKAAKEAWFAARTP 109

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYV   Y +    N   TANI+AN++I V
Sbjct: 110 YSQSEAFRFGNAIIDDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIVANTEIQV 168

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+  I+ + L  L+   G + N+ TGYH IEFLLWGQDL       GNRP TD+ 
Sbjct: 169 GEDKIDVKEITGEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYA 228

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSII 256
            G +CTGGHC RR  YLK V+ +LVSDLE M   W     D    K   + ++ GL  + 
Sbjct: 229 QGKDCTGGHCDRRAAYLKAVTDLLVSDLEYMAGQWKAGVADNYRAKLEAEPVDTGLRKMF 288

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSD+T+ +   +   I + Y GEY R++G
Sbjct: 289 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDDTHHTLFFNGKSIRNIYLGEYKRIDG 348

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGN 375
             + G S+ DL++  +      +    ++T      + D AE +   FDQMI+ +N +G 
Sbjct: 349 SVVKGPSLADLVAKADAAANDTLKADLADTEAKLQAIVDSAEKDGVHFDQMIAPDNKDGQ 408

Query: 376 KIVRNLINDLITQTESLRKI--RIALDLIEPN 405
           + +R+ I  L+ QT ++ +   ++ +  ++P+
Sbjct: 409 QKIRDAIAALVKQTGAIEQAAGKLGIQDLKPD 440


>gi|15599566|ref|NP_253060.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa PAO1]
 gi|218893461|ref|YP_002442330.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa LESB58]
 gi|254238967|ref|ZP_04932290.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa C3719]
 gi|254244820|ref|ZP_04938142.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa 2192]
 gi|296391077|ref|ZP_06880552.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa PAb1]
 gi|9950599|gb|AAG07758.1|AE004853_1 Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa PAO1]
 gi|126170898|gb|EAZ56409.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa C3719]
 gi|126198198|gb|EAZ62261.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa 2192]
 gi|218773689|emb|CAW29503.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa LESB58]
          Length = 446

 Score =  297 bits (761), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 157/392 (40%), Positives = 228/392 (58%), Gaps = 8/392 (2%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V++NYA +A A + DAL  A+ L  AI+  +  P+ + L+ A+  W  AR P
Sbjct: 50  VDEAAAKAVIKNYADLAEATFADALSTAKDLQKAIDAFLAKPDAETLKAAKEAWFAARTP 109

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYV   Y +    N   TANI+AN++I V
Sbjct: 110 YSQSEAFRFGNAIIDDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIVANTEIQV 168

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+  I+ + L  L+   G + N+ TGYH IEFLLWGQDL       GNRP TD+ 
Sbjct: 169 GEDKIDVKEITGEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYA 228

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSII 256
            G +CTGGHC RR  YLK V+ +LVSDLE M   W     D    K   + ++ GL  + 
Sbjct: 229 QGKDCTGGHCDRRAAYLKAVTDLLVSDLEYMAGQWKAGVADNYRAKLEAEPVDTGLRKMF 288

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSD+T+ +   +   I + Y GEY R++G
Sbjct: 289 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDDTHHTLFFNGKSIRNIYLGEYKRIDG 348

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGN 375
             + G S+ DL++  +      +    ++T      + D AE +   FDQMI+ +N +G 
Sbjct: 349 SVVKGPSLADLVAKADAAANDTLKADLADTEAKLQAIVDSAEKDGVHFDQMIAPDNKDGQ 408

Query: 376 KIVRNLINDLITQTESLRKI--RIALDLIEPN 405
           + +R+ I  L+ QT ++ +   ++ +  ++P+
Sbjct: 409 QKIRDAIAALVKQTGAIEQAAGKLGIQDLKPD 440


>gi|153827295|ref|ZP_01979962.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae MZO-2]
 gi|149738786|gb|EDM53128.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae MZO-2]
          Length = 379

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 156/375 (41%), Positives = 221/375 (58%), Gaps = 12/375 (3%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I++ +    S + +  P  +  +V+++YA IAHA Y D+ + A+ L   I+  +  P  
Sbjct: 10  AILASLTLTTSASFAAAPTQA--QVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQAPTA 67

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--N 122
           + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  N
Sbjct: 68  QGLEEVKKAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHELGN 127

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           E  N   ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 128 EGAN---ANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DG 238
           DL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D 
Sbjct: 185 DLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKDN 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   AE
Sbjct: 305 NEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAE 364

Query: 359 -NIESFDQMISENNP 372
            N + FDQ+I+ +N 
Sbjct: 365 KNNQHFDQLIAADNA 379


>gi|330943761|gb|EGH46039.1| iron-regulated protein A, putative [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 452

 Score =  293 bits (749), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 155/371 (41%), Positives = 215/371 (57%), Gaps = 5/371 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+D W+
Sbjct: 75  AVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTIIDDWE 134

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 135 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 193

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 194 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGHNDRRRAYLK 253

Query: 218 VVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNL 274
            V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGERM +
Sbjct: 254 AVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGERMKV 313

Query: 275 GLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRN 334
            L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  +  
Sbjct: 314 ALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKADPA 373

Query: 335 LAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
               +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ +
Sbjct: 374 TDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIEQ 433

Query: 395 IRIALDLIEPN 405
               L + + N
Sbjct: 434 AAGKLGITDLN 444


>gi|66047288|ref|YP_237129.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae B728a]
 gi|63257995|gb|AAY39091.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae B728a]
          Length = 458

 Score =  293 bits (749), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 155/371 (41%), Positives = 215/371 (57%), Gaps = 5/371 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+D W+
Sbjct: 81  AVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTIIDDWE 140

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 141 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 199

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 200 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGHNDRRRAYLK 259

Query: 218 VVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNL 274
            V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGERM +
Sbjct: 260 AVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGERMKV 319

Query: 275 GLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRN 334
            L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  +  
Sbjct: 320 ALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKADPA 379

Query: 335 LAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
               +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ +
Sbjct: 380 TDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIEQ 439

Query: 395 IRIALDLIEPN 405
               L + + N
Sbjct: 440 AAGKLGITDLN 450


>gi|330973344|gb|EGH73410.1| iron-regulated protein A, putative [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 453

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 155/371 (41%), Positives = 215/371 (57%), Gaps = 5/371 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+D W+
Sbjct: 76  AVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTIIDDWE 135

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 136 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 194

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 195 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRRAYLK 254

Query: 218 VVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNL 274
            V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGERM +
Sbjct: 255 AVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGERMKV 314

Query: 275 GLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRN 334
            L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  +  
Sbjct: 315 ALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKADPA 374

Query: 335 LAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
               +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ +
Sbjct: 375 TDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIEQ 434

Query: 395 IRIALDLIEPN 405
               L + + N
Sbjct: 435 AAGKLGITDLN 445


>gi|302189751|ref|ZP_07266424.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae 642]
          Length = 452

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 155/371 (41%), Positives = 215/371 (57%), Gaps = 5/371 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+D W+
Sbjct: 75  AVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTIIDDWE 134

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 135 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 193

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 194 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRRAYLK 253

Query: 218 VVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNL 274
            V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGERM +
Sbjct: 254 AVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGERMKV 313

Query: 275 GLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRN 334
            L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  +  
Sbjct: 314 ALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKADPA 373

Query: 335 LAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
               +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ +
Sbjct: 374 TDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIEQ 433

Query: 395 IRIALDLIEPN 405
               L + + N
Sbjct: 434 AAGKLGITDLN 444


>gi|237799577|ref|ZP_04588038.1| putative lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331022433|gb|EGI02490.1| putative lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 436

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 153/360 (42%), Positives = 211/360 (58%), Gaps = 5/360 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+D W+
Sbjct: 74  AVFDDAEAGAKKLSTAVDAFLAKPNNETLKAARDAWVAARVPYMQSEVFRFGNTIIDDWE 133

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+P+ L  L
Sbjct: 134 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITPEKLASL 192

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       GNRP +D+  G   TGGH  RR  YLK
Sbjct: 193 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYIEGAGATGGHNERRRAYLK 252

Query: 218 VVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNL 274
            V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELAGERM +
Sbjct: 253 AVTDLLVSDLEEMSGNWRAGVADNYRASLEAEPGESGLRKMLFGMGSLSLGELAGERMKV 312

Query: 275 GLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRN 334
            L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  +  
Sbjct: 313 ALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKVDPA 372

Query: 335 LAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
               +     +T      + D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ +
Sbjct: 373 TDATLRADLDDTQAKLQAIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIEQ 432


>gi|330950176|gb|EGH50436.1| iron-regulated protein A, putative [Pseudomonas syringae Cit 7]
          Length = 408

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 155/371 (41%), Positives = 215/371 (57%), Gaps = 5/371 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+D W+
Sbjct: 31  AVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTIIDDWE 90

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 91  GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 149

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 150 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRRAYLK 209

Query: 218 VVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNL 274
            V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGERM +
Sbjct: 210 AVTDLLVSDLEEMSGNWKAGVPDNYRATLEAEPGESGLRKMLFGMGSLSLGELAGERMKV 269

Query: 275 GLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRN 334
            L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  +  
Sbjct: 270 ALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKVDPA 329

Query: 335 LAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
               +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ +
Sbjct: 330 TDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIEQ 389

Query: 395 IRIALDLIEPN 405
               L + + N
Sbjct: 390 AAGKLGITDLN 400


>gi|71734726|ref|YP_276192.1| lipoprotein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71555279|gb|AAZ34490.1| lipoprotein, putative [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 452

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 218/372 (58%), Gaps = 7/372 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+D W+
Sbjct: 75  AVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTIIDDWE 134

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 135 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 193

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 194 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRRAYLK 253

Query: 218 VVSKILVSDLEEMMKAW----GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMN 273
            V+ +LVSDLEEM   W      + +AT +  +   +GL  ++ GM SLS  ELAGERM 
Sbjct: 254 AVTDLLVSDLEEMSGNWKAGVADNYRATLE-AESGESGLRKMLFGMGSLSLGELAGERMK 312

Query: 274 LGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR 333
           + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  + 
Sbjct: 313 VALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKVDP 372

Query: 334 NLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR 393
                +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ 
Sbjct: 373 ATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIE 432

Query: 394 KIRIALDLIEPN 405
           +    L + + N
Sbjct: 433 QAASKLGITDLN 444


>gi|320322412|gb|EFW78505.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320330120|gb|EFW86107.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330989423|gb|EGH87526.1| putative lipoprotein [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 452

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 218/372 (58%), Gaps = 7/372 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+D W+
Sbjct: 75  AVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTIIDDWE 134

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 135 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 193

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 194 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRRAYLK 253

Query: 218 VVSKILVSDLEEMMKAW----GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMN 273
            V+ +LVSDLEEM   W      + +AT +  +   +GL  ++ GM SLS  ELAGERM 
Sbjct: 254 AVTDLLVSDLEEMSGNWKAGVADNYRATLE-AESGESGLRKMLFGMGSLSLGELAGERMK 312

Query: 274 LGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR 333
           + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  + 
Sbjct: 313 VALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKVDP 372

Query: 334 NLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR 393
                +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ 
Sbjct: 373 ATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIE 432

Query: 394 KIRIALDLIEPN 405
           +    L + + N
Sbjct: 433 QAAGKLGITDLN 444


>gi|289625673|ref|ZP_06458627.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647253|ref|ZP_06478596.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298488573|ref|ZP_07006603.1| Iron-regulated protein A precursor [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156914|gb|EFH98004.1| Iron-regulated protein A precursor [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330870178|gb|EGH04887.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 452

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 218/372 (58%), Gaps = 7/372 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+D W+
Sbjct: 75  AVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTIIDDWE 134

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 135 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 193

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 194 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRRAYLK 253

Query: 218 VVSKILVSDLEEMMKAW----GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMN 273
            V+ +LVSDLEEM   W      + +AT +  +   +GL  ++ GM SLS  ELAGERM 
Sbjct: 254 AVTDLLVSDLEEMSGNWKAGVADNYRATLE-AESGESGLRKMLFGMGSLSLGELAGERMK 312

Query: 274 LGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR 333
           + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  + 
Sbjct: 313 VALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKVDP 372

Query: 334 NLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR 393
                +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ 
Sbjct: 373 ATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIE 432

Query: 394 KIRIALDLIEPN 405
           +    L + + N
Sbjct: 433 QAAGKLGITDLN 444


>gi|330874919|gb|EGH09068.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 402

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 218/372 (58%), Gaps = 7/372 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+D W+
Sbjct: 25  AVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTIIDDWE 84

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 85  GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 143

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 144 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRRAYLK 203

Query: 218 VVSKILVSDLEEMMKAW----GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMN 273
            V+ +LVSDLEEM   W      + +AT +  +   +GL  ++ GM SLS  ELAGERM 
Sbjct: 204 AVTDLLVSDLEEMSGNWKAGVADNYRATLE-AESGESGLRKMLFGMGSLSLGELAGERMK 262

Query: 274 LGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR 333
           + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  + 
Sbjct: 263 VALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKVDP 322

Query: 334 NLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR 393
                +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ 
Sbjct: 323 ATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIE 382

Query: 394 KIRIALDLIEPN 405
           +    L + + N
Sbjct: 383 QAAGKLGITDLN 394


>gi|331017972|gb|EGH98028.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 452

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 216/372 (58%), Gaps = 7/372 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+D W+
Sbjct: 75  AVFDDAQGAAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTIIDDWE 134

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 135 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 193

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 194 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRRAYLK 253

Query: 218 VVSKILVSDLEEMMKAW----GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMN 273
            V+ +LVSDLEEM   W      + +AT +  +   +GL  ++ GM SLS  ELAGERM 
Sbjct: 254 AVTDLLVSDLEEMAGNWKAGVADNYRATLE-AESGESGLRKMLFGMGSLSLGELAGERMK 312

Query: 274 LGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR 333
           + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  + 
Sbjct: 313 VALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKVDP 372

Query: 334 NLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR 393
                +     +T      + D A   E FDQ+I   N  GN++VR+ I  L+ QT ++ 
Sbjct: 373 ATDATLRADLDDTQAKLQAIVDHANKGEHFDQLIGAGNTAGNQVVRDAIAALVKQTGAIE 432

Query: 394 KIRIALDLIEPN 405
           +    L + + N
Sbjct: 433 QAAGKLGITDLN 444


>gi|330877884|gb|EGH12033.1| iron-regulated protein A [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 452

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 153/371 (41%), Positives = 213/371 (57%), Gaps = 5/371 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+D W+
Sbjct: 75  AVFDDAEGAAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTIIDDWE 134

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 135 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 193

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 194 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRRAYLK 253

Query: 218 VVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNL 274
            V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELAGERM +
Sbjct: 254 AVTDLLVSDLEEMAGNWKAGVADNYRATLKAESGESGLRKMLFGMGSLSLGELAGERMKV 313

Query: 275 GLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRN 334
            L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  +  
Sbjct: 314 ALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKVDPA 373

Query: 335 LAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
               +     +T      + D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ +
Sbjct: 374 TDATLRADLDDTQAKLQAIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIEQ 433

Query: 395 IRIALDLIEPN 405
               L + + N
Sbjct: 434 AAGKLGITDLN 444


>gi|28871502|ref|NP_794121.1| iron-regulated protein A [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213970316|ref|ZP_03398446.1| iron-regulated protein A [Pseudomonas syringae pv. tomato T1]
 gi|301385468|ref|ZP_07233886.1| iron-regulated protein A, putative [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063002|ref|ZP_07254543.1| iron-regulated protein A, putative [Pseudomonas syringae pv. tomato
           K40]
 gi|302135286|ref|ZP_07261276.1| iron-regulated protein A, putative [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28854753|gb|AAO57816.1| iron-regulated protein A, putative [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213924988|gb|EEB58553.1| iron-regulated protein A [Pseudomonas syringae pv. tomato T1]
          Length = 452

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 216/372 (58%), Gaps = 7/372 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+D W+
Sbjct: 75  AVFDDAQGAAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTIIDDWE 134

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 135 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 193

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 194 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRRTYLK 253

Query: 218 VVSKILVSDLEEMMKAW----GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMN 273
            V+ +LVSDLEEM   W      + +AT +  +   +GL  ++ GM SLS  ELAGERM 
Sbjct: 254 AVTDLLVSDLEEMAGNWKAGVADNYRATLE-AESGESGLRKMLFGMGSLSLGELAGERMK 312

Query: 274 LGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR 333
           + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  + 
Sbjct: 313 VALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKVDP 372

Query: 334 NLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR 393
                +     +T      + D A   E FDQ+I   N  GN++VR+ I  L+ QT ++ 
Sbjct: 373 ATDATLRADLDDTQAKLQAIVDHANKGEHFDQLIGAGNTAGNQVVRDAIAALVKQTGAIE 432

Query: 394 KIRIALDLIEPN 405
           +    L + + N
Sbjct: 433 QAAGKLGITDLN 444


>gi|330966144|gb|EGH66404.1| iron-regulated protein A [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 450

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 217/372 (58%), Gaps = 7/372 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+D W+
Sbjct: 73  AVFDDAEGAAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTIIDDWE 132

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 133 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 191

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 192 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRRAYLK 251

Query: 218 VVSKILVSDLEEMMKAW----GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMN 273
            V+ +LVSDLEEM   W      + +AT +  +   +GL  ++ GM SLS  ELAGERM 
Sbjct: 252 AVTDLLVSDLEEMAGNWKAGVADNYRATLE-AESGESGLRKMLFGMGSLSLGELAGERMK 310

Query: 274 LGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR 333
           + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  + 
Sbjct: 311 VALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKVDP 370

Query: 334 NLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR 393
                +     +T      + D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ 
Sbjct: 371 ATDATLRADLDDTQAKLQAIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIE 430

Query: 394 KIRIALDLIEPN 405
           +    L + + N
Sbjct: 431 QAAGKLGITDLN 442


>gi|331009887|gb|EGH89943.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 452

 Score =  285 bits (730), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 153/372 (41%), Positives = 217/372 (58%), Gaps = 7/372 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L + ++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+D W+
Sbjct: 75  AVFDDAETGAKKLSTVVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTIIDDWE 134

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 135 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 193

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 194 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRRAYLK 253

Query: 218 VVSKILVSDLEEMMKAW----GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMN 273
            V+ +LVSDLEEM   W      + +AT +  +   +GL  ++ GM SLS  ELAGERM 
Sbjct: 254 AVTDLLVSDLEEMSGNWKAGVADNYRATLE-AESGESGLRKMLFGMGSLSLGELAGERMK 312

Query: 274 LGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR 333
           + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  + 
Sbjct: 313 VALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKVDP 372

Query: 334 NLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR 393
                +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ 
Sbjct: 373 ATDAPLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIE 432

Query: 394 KIRIALDLIEPN 405
           +    L + + N
Sbjct: 433 QAAGKLGITDLN 444


>gi|330895180|gb|EGH27518.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 366

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 151/359 (42%), Positives = 208/359 (57%), Gaps = 5/359 (1%)

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+D W+ +VNAWPLDEG 
Sbjct: 1   LSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTIIDDWEGQVNAWPLDEGL 60

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L+   G + N+ T
Sbjct: 61  IDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASLNELGGSEANVAT 119

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEE 229
           GYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK V+ +LVSDLEE
Sbjct: 120 GYHAIEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGHNDRRRAYLKAVTDLLVSDLEE 179

Query: 230 MMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEID 286
           M   W    PD        +   +GL  ++ GM SLS  ELAGERM + L  +  E E D
Sbjct: 180 MSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGERMKVALEANSSEDEHD 239

Query: 287 CFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNT 346
           CFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  +      +     +T
Sbjct: 240 CFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVRGPSLSSLVAKADPATDATLRADLDDT 299

Query: 347 MKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
                ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ +    L + + N
Sbjct: 300 QAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIEQAAGKLGITDLN 358


>gi|330888530|gb|EGH21191.1| putative lipoprotein [Pseudomonas syringae pv. mori str. 301020]
          Length = 452

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 153/372 (41%), Positives = 217/372 (58%), Gaps = 7/372 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+D W+
Sbjct: 75  AVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTIIDDWE 134

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 135 GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 193

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  R   YLK
Sbjct: 194 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRPRAYLK 253

Query: 218 VVSKILVSDLEEMMKAW----GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMN 273
            V+ +LVSDLEEM   W      + +AT +  +   +GL  ++ GM SLS  ELAGERM 
Sbjct: 254 AVTDLLVSDLEEMSGNWKAGVADNYRATLE-AESGESGLRKMLFGMGSLSLGELAGERMK 312

Query: 274 LGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR 333
           + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  + 
Sbjct: 313 VALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAKVDP 372

Query: 334 NLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR 393
                +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ 
Sbjct: 373 ATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIE 432

Query: 394 KIRIALDLIEPN 405
           +    L + + N
Sbjct: 433 QAAGKLGITDLN 444


>gi|88799522|ref|ZP_01115099.1| putative iron-regulated protein A [Reinekea sp. MED297]
 gi|88777832|gb|EAR09030.1| putative iron-regulated protein A [Reinekea sp. MED297]
          Length = 407

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 155/404 (38%), Positives = 236/404 (58%), Gaps = 12/404 (2%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M  +  ++++    +HA      ++ + V++ Y  IA+  Y DAL  A  L S IE LV 
Sbjct: 1   MKHLIAVTLLAAGVAHA-----EITSQDVVEGYTDIAYTNYADALQTAEALQSTIENLVD 55

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P+ + L  A+  W+ AR  YQQSEV+RFGN +VD W+ ++NAWPLDEG IDYVD    +
Sbjct: 56  HPSAEALAAAKAAWLEARPSYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVDDRAYE 115

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
               N+  TAN++AN ++     ++ +S + P+ L  L+   G + N+ TGYH IEFLLW
Sbjct: 116 FELGNDGGTANLVANKRV----GDLKVSRLKPETLASLNEFGGSEANVATGYHAIEFLLW 171

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GQDL  +    G RP+TD+  GN CT  +C+RR +YL+  +++LV DLE M+  W PDG 
Sbjct: 172 GQDLNGHQAGAGERPWTDYAKGNDCTNENCKRRGQYLEAAAELLVEDLEYMVAQWAPDGD 231

Query: 240 ATKDLMK-DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
             + L++ D    LN ++ GM SL+  ELAGER+ + L  +  E E DCFSDNT+ S+  
Sbjct: 232 YRQQLLQEDEQTVLNKMLFGMGSLALGELAGERIKVALTANSTEDEHDCFSDNTHNSHYY 291

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR-NLAQEINDKFSNTMKDFHILKDRA 357
           +  G+ + Y G Y   +GE      + DL+  N   +L  + +  F+ T +    +  RA
Sbjct: 292 NAKGVANLYFGSYTNADGETTRVVGLRDLLLVNGHADLIADADRAFAATQQSMAAMVTRA 351

Query: 358 ENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           EN E+FDQMI+  N  G  ++ + IN L+ +T ++  + +AL +
Sbjct: 352 ENGEAFDQMIAPGNTSGAALLNDAINRLVEETAAIESMALALGI 395


>gi|218659024|ref|ZP_03514954.1| hypothetical protein RetlI_04866 [Rhizobium etli IE4771]
          Length = 242

 Score =  275 bits (703), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 126/235 (53%), Positives = 166/235 (70%), Gaps = 1/235 (0%)

Query: 138 IIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
           I ++ K++D S ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP 
Sbjct: 8   IKIDGKDVDASKLTPEFLSGTLQEAGGIEANVATGYHAIEFLLWGQDLNGTSPGAGNRPA 67

Query: 197 TDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSII 256
           TD+D+ NCT G+C RR EYLK  S +LVSDL+EM  +W PDG ATK++  D  AGL +I+
Sbjct: 68  TDYDLKNCTHGNCDRRAEYLKSASTLLVSDLQEMTDSWKPDGAATKNVEADPKAGLVAIL 127

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
           TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G
Sbjct: 128 TGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDG 187

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENN 371
            K+ G S+HDL++  ++ L  E+  K + T+   + +  R E +E +DQMI+E N
Sbjct: 188 TKLSGPSLHDLVAAKDKALDAEMEGKLNKTLDAMNAMAKRGETVEKYDQMIAEGN 242


>gi|254226417|ref|ZP_04920004.1| iron-regulated protein A, putative [Vibrio cholerae V51]
 gi|125621039|gb|EAZ49386.1| iron-regulated protein A, putative [Vibrio cholerae V51]
          Length = 346

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 140/327 (42%), Positives = 197/327 (60%), Gaps = 11/327 (3%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I++ +    S + +  P  +  +V+++YA IA+A Y D+ + A+ L   I+  +  P  
Sbjct: 25  AILASLTLTTSASFAAAPTQA--QVVEHYADIAYAVYADSRVTAQQLQKTIDRFLQAPTA 82

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--N 122
           + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  N
Sbjct: 83  QGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHELGN 142

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           E  N   ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 143 EGAN---ANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQ 199

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DG 238
           DL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D 
Sbjct: 200 DLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKDN 259

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 260 YRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 319

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIH 325
           +  GI + YTG Y R +G ++ G S++
Sbjct: 320 NEQGIYNIYTGSYTRADGSELKGPSLY 346


>gi|83643091|ref|YP_431526.1| putative iron-regulated protein [Hahella chejuensis KCTC 2396]
 gi|83631134|gb|ABC27101.1| uncharacterized iron-regulated protein [Hahella chejuensis KCTC
           2396]
          Length = 459

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 146/405 (36%), Positives = 222/405 (54%), Gaps = 39/405 (9%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V  ++V+ ++A +AHA Y D+L  A  L+ +I+  + TP + NL+ A+  + +AR+PYQQ
Sbjct: 32  VEPKQVVDHFANMAHAMYADSLQAATQLNKSIDVFLATPTQANLDAAKAAYAQARVPYQQ 91

Query: 84  SEVYRF---------------GNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
           SEV RF               G   +D W+ +VNAWPLDE  IDYV  SY  E E N+  
Sbjct: 92  SEVLRFDVENGHVTEGLDADGGLASIDAWEGQVNAWPLDEALIDYVSGSY--EGEYNS-- 147

Query: 129 TANIIANSKII-VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
             NII ++ +  V  + ID+S I+P+L+  ++   G + N+T+G H IEFLLWGQDL   
Sbjct: 148 PKNIINSTGVFTVGGQSIDISTITPELIAGMNEIGGAEANVTSGVHAIEFLLWGQDLNGT 207

Query: 188 VREPGNRP----YTDFDIGNCTGGH-------CRRRVEYLKVVSKILVSDLEEMMKAWGP 236
               G RP    YTD   G CT G        C+RR +YLK  + +LVSDL+ M   W P
Sbjct: 208 GPGAGARPVSDYYTDSSQGACTSGDKKSDYKICQRRAQYLKAAADLLVSDLQAMEAEWTP 267

Query: 237 DGQATKDLMKD----INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNT 292
              A K  +++       GL  I+  M  ++  ELA ERM + ++    E E DCFSD T
Sbjct: 268 AAGAKKGTLRNDFLTRGDGLQRILDSMGDMAIGELASERMKVAILFGSTEDEHDCFSDLT 327

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHI 352
           + +  N+ +G++ +Y G Y R++G  + G SI DL++H+N  L Q++++  S        
Sbjct: 328 HIAIYNNAMGVVDAYRGSYARLDGSVVSGPSIADLVAHHNPALKQQMDEHMSLIESRMRA 387

Query: 353 LKDRAE---NIESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
           + D+AE     + FDQ++   + E  K+V +    L++  E L +
Sbjct: 388 IVDKAEAKSGGKKFDQLVG-GSAEDKKLVLDAAAALVSLEEPLSE 431


>gi|71066359|ref|YP_265086.1| imelysin [Psychrobacter arcticus 273-4]
 gi|71039344|gb|AAZ19652.1| imelysin. Metallo peptidase. MEROPS family M75 [Psychrobacter
           arcticus 273-4]
          Length = 480

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 144/383 (37%), Positives = 212/383 (55%), Gaps = 36/383 (9%)

Query: 15  SHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
           S   S      ++++L +YA +AHA Y+DAL  A+ L +A+ T V TP + NL+ A+  +
Sbjct: 51  SKTSSAAGQAHMDRLLISYADMAHAAYKDALETAKILQTAVNTYVETPTQANLDAAKAAY 110

Query: 75  IRARIPYQQSEVYRFGNKIV-----------DTWDKKVNAWPLDEGFIDYVDSSY-GKEN 122
             AR PY Q+EV+RF    V           D+W+ +VNAWPLDE  IDYV ++Y GK N
Sbjct: 111 KAARQPYSQTEVFRFDEGFVTANEQRKIASTDSWEGQVNAWPLDEALIDYVSTNYEGKYN 170

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
            ++N     II +  I V   + D S I+P+LL ++    G + N+TTGYH IEF+LWGQ
Sbjct: 171 SQDN-----IINSDSITVGSIKQDTSTITPELLAEMTEIGGSEANVTTGYHAIEFMLWGQ 225

Query: 183 DLKTNVREPGNRPYTDF--DIGNCTGGH--------CRRRVEYLKVVSKILVSDLEEMMK 232
           D        GNRP++D+    G CT G         C RR +YLK  +++LV DL  M  
Sbjct: 226 DTNGVAEGAGNRPFSDYLTTDGQCTSGESKNPEASVCERRGQYLKAATQLLVDDLTAMEA 285

Query: 233 AWGPDGQAT--KDLM--KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCF 288
            W PD + T   D+M  KD N+ L+ I+  M SL+  ELA +R+ +  +    E E +CF
Sbjct: 286 EWQPDSENTLRSDIMARKDKNS-LHQIMYQMGSLALGELASDRIQVAFVTGSTEDEHECF 344

Query: 289 SDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD-LISHNNRNLAQEINDKFSNTM 347
           SD T+ SY N+  GI + + G+Y  + G+ I G  + + L+   N   A ++   F+   
Sbjct: 345 SDLTHLSYANNARGIQNVFNGDYKTVAGKTIGGYGLKNYLVDTGNTEAADKLAADFAKVE 404

Query: 348 KDFHIL--KDRAENIESFDQMIS 368
             F+++  K   ENI+  DQMI+
Sbjct: 405 AAFNVIVEKGEKENIK-IDQMIA 426


>gi|121729789|ref|ZP_01682225.1| anthranilate synthase component II [Vibrio cholerae V52]
 gi|121628464|gb|EAX60954.1| anthranilate synthase component II [Vibrio cholerae V52]
          Length = 289

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 121/278 (43%), Positives = 167/278 (60%), Gaps = 11/278 (3%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I++ +    S + +  P  +  +V+++YA IAHA Y D+ + A+ L   I+  +  P  
Sbjct: 10  AILASLTLTTSASFAAAPTQA--QVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQAPTA 67

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--N 122
           + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  N
Sbjct: 68  QGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHELGN 127

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           E  N   ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 128 EGAN---ANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DG 238
           DL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D 
Sbjct: 185 DLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKDN 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGL 276
              + L +    GL  ++ GM SLS  ELAGERM + L
Sbjct: 245 YRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVAL 282


>gi|93006910|ref|YP_581347.1| hypothetical protein Pcryo_2086 [Psychrobacter cryohalolentis K5]
 gi|92394588|gb|ABE75863.1| imelysin. Metallo peptidase. MEROPS family M75 [Psychrobacter
           cryohalolentis K5]
          Length = 482

 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 143/383 (37%), Positives = 211/383 (55%), Gaps = 34/383 (8%)

Query: 14  PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ 73
            S   S      ++++L +YA +AHA Y+D+L  A+ L SA+ T V TP + NL+ A+  
Sbjct: 50  ASKTSSAADKAHMDRLLISYADMAHAAYKDSLEMAKLLQSAVNTYVETPTQANLDAAKAA 109

Query: 74  WIRARIPYQQSEVYRFGNKIV-----------DTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +  AR PY Q+EV+RF    V           D+W+ +VNAWPLDE  IDYV + Y  E 
Sbjct: 110 YKAARQPYSQTEVFRFDEGFVTANDNRNIGSTDSWEGQVNAWPLDEALIDYVSADY--EG 167

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           E N+    NII +  I V   + D S I+P+LL +++   G ++N+TTGYH IEF+LWGQ
Sbjct: 168 EYNS--KDNIINSDSISVGSLKQDTSTITPELLAEMNEIGGSESNVTTGYHAIEFMLWGQ 225

Query: 183 DLKTNVREPGNRPYTDFDI--GNCTGGH--------CRRRVEYLKVVSKILVSDLEEMMK 232
           D        GNRP++D+ +  G CT G         C RR +YLK  +++LV DL  M  
Sbjct: 226 DTNGVAEGAGNRPFSDYLMTDGQCTSGESVNPEASICERRGQYLKAATQLLVDDLTAMEA 285

Query: 233 AWGPDGQAT--KDLM--KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCF 288
            W PD + T   D+M  +D N+ L  I+  M SL+  ELA +R+ +  +    E E +CF
Sbjct: 286 QWQPDSENTLRSDMMARRDSNS-LRQIMYQMGSLALGELASQRIQVAFVTGSTEDEHECF 344

Query: 289 SDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD-LISHNNRNLAQEINDKFSNTM 347
           SD T+ SY N+  GI + + G Y  + G+ + G  + + LI   N   A ++   F+   
Sbjct: 345 SDLTHLSYANNARGIQNVFNGSYKTVAGKTVGGYGLKNYLIDTGNTEAADKLAADFAKVE 404

Query: 348 KDFHIL--KDRAENIESFDQMIS 368
             F+++  K   ENI+  DQMI+
Sbjct: 405 AAFNVIVEKGEKENIK-IDQMIA 426


>gi|254448122|ref|ZP_05061585.1| insulin-cleaving metalloproteinase outer membrane protein [gamma
           proteobacterium HTCC5015]
 gi|198262248|gb|EDY86530.1| insulin-cleaving metalloproteinase outer membrane protein [gamma
           proteobacterium HTCC5015]
          Length = 462

 Score =  235 bits (600), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 146/423 (34%), Positives = 219/423 (51%), Gaps = 50/423 (11%)

Query: 26  LEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSE 85
           ++ +L N A++A+A Y D++  A+ L SAIETLV  P   +L  A+  WI+AR PY Q+E
Sbjct: 30  IQAILSNDASMAYAAYSDSVTTAQQLQSAIETLVKAPTDTHLSEAKSAWIKAREPYGQTE 89

Query: 86  VYRFGNKIVDTW-------------DKKVNAWPLDEGFIDYVDSSY----GKENEEN-NL 127
           VYRF    +D               + ++NAWPL E  IDYV ++     G ++ EN   
Sbjct: 90  VYRFREGPIDALKGDGTLGTEGDGPEGEINAWPLGEALIDYVAATPPIADGVDHAENFPA 149

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL--- 184
             A+IIA++ I +N +++D +I   + L     ANG + N+ TGYH IEFLLWGQDL   
Sbjct: 150 VNASIIADTSIPLNGEDLDSTI---ETLAAFQEANGDEANVATGYHAIEFLLWGQDLNQG 206

Query: 185 -----KTNVREPGNRPYTDFDIG-NCT----------GGHCRRRVEYLKVVSKILVSDLE 228
                K     PG RP +D+     CT          G  C+RR  YL+ V++ LV DL 
Sbjct: 207 QAQWGKQRDNSPGQRPVSDYAQNEQCTVDAQGNTDSSGKICQRRAIYLRAVAQKLVDDLS 266

Query: 229 EMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCF 288
            +  AW P     +  +      L S++  M  LS+ ELAGER+N+ L     E E  CF
Sbjct: 267 RVRDAWAPQSPLRQQYIDGGKHSLASVLESMGRLSFGELAGERINIALTQDSQEDEHSCF 326

Query: 289 SDNTYASYLNDVIGIISSYTGEY----IRMNGEKIHGASIHDLI-SHNNRNLAQEINDKF 343
           SDNT+   L +  GI +SY G+Y    +  +   + G SI  L+    +  LA+++    
Sbjct: 327 SDNTHRDILLNAKGIQNSYLGQYGNTTLYTDATAVSGDSIDALLRKRGHTELAKQLKGAL 386

Query: 344 SNTMKDFHILKDRAENIESFDQMIS-----ENNPEGNKIVRNLINDLITQTESLRKIRIA 398
           ++T      +   A++   FDQ I+       +P+ N+ +R+LI  L+ QTE + +   A
Sbjct: 387 AHTQSLAQAIDQTAQSGTPFDQQIAGGEIDPKHPKANQTIRDLIQALVAQTELIEQAIAA 446

Query: 399 LDL 401
           L+L
Sbjct: 447 LEL 449


>gi|330957925|gb|EGH58185.1| putative lipoprotein [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 324

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 132/318 (41%), Positives = 182/318 (57%), Gaps = 7/318 (2%)

Query: 93  IVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISP 152
           I+D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ 
Sbjct: 1   IIDDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITA 59

Query: 153 DLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRR 211
           D L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+  G   TGGH  R
Sbjct: 60  DKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYLEGAGATGGHNDR 119

Query: 212 RVEYLKVVSKILVSDLEEMMKAW----GPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           R  YLK V+ +LVSDLEEM   W      + +AT +  +   +GL  ++ GM SLS  EL
Sbjct: 120 RRAYLKAVTDLLVSDLEEMSGNWRAGVADNYRATLE-AESGESGLRKMLFGMGSLSLGEL 178

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L
Sbjct: 179 AGERMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSL 238

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  +      +     +T      + D A   E FDQ+I+  N  GN++VR+ I  L+ 
Sbjct: 239 VAKVDPATDATLRADLDDTQAKLQAIVDHASKGEHFDQLIASGNTAGNQVVRDAIAALVK 298

Query: 388 QTESLRKIRIALDLIEPN 405
           QT ++ +    L + + N
Sbjct: 299 QTGAIEQAAGKLGITDLN 316


>gi|148653942|ref|YP_001281035.1| hypothetical protein PsycPRwf_2145 [Psychrobacter sp. PRwf-1]
 gi|148573026|gb|ABQ95085.1| Uncharacterized iron-regulated protein-like protein [Psychrobacter
           sp. PRwf-1]
          Length = 486

 Score =  233 bits (595), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 137/370 (37%), Positives = 200/370 (54%), Gaps = 29/370 (7%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
            S+ K+L +YA +A A YED+L  A+ L +A++ LV  P ++NLE A+  +  AR PY Q
Sbjct: 65  ASVNKLLTSYADMAQAAYEDSLSEAKKLQAAVDALVANPTQQNLEAAQAAYKAARQPYSQ 124

Query: 84  SEVYRFGNKIV-----------DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
           +EV+RF    V           D W+ +VNAWPLDE  IDYV   Y  E    +    NI
Sbjct: 125 TEVFRFDEGFVGKDDKRAIGSIDGWEGQVNAWPLDEALIDYVADGYAGEYNSKD----NI 180

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           I + KI V     D   I+P+LL +++   G + N+TTGYH IEFLLWGQDL       G
Sbjct: 181 INSDKITVGSTSQDTKTITPELLAEMNEIGGSEANVTTGYHAIEFLLWGQDLNGVGEGAG 240

Query: 193 NRPYTDFDIGN-CTGGH--------CRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT-- 241
            RP TD+   + CT G         C +R EYLK  +++LV+DL +M+  W P+ + T  
Sbjct: 241 QRPVTDYMANDSCTSGEGNSAEAAVCAKRGEYLKAATQLLVNDLTDMVAQWQPNTENTLR 300

Query: 242 KDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
            DLM +  +  +  I   M SL+  ELA ERM +  +    E E +CFSD T+ SY N+ 
Sbjct: 301 SDLMARSSDNAVRQIFYQMGSLALGELASERMQVAFVTGSTEDEHECFSDLTHLSYANNA 360

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHD-LISHNNRNLAQEINDKFSNTMKDFHILKDRAE- 358
            GI + + G+Y  ++G  +    I   LI    ++ A++++  F      F+ + ++ E 
Sbjct: 361 RGIANIFNGQYKTVSGSTVGDYGIKQYLIDAGQKDSAEQLDAAFKKVEASFNTIAEQGEK 420

Query: 359 NIESFDQMIS 368
           N    DQMI+
Sbjct: 421 NGIKIDQMIA 430


>gi|332968652|gb|EGK07705.1| iron-regulated protein A [Psychrobacter sp. 1501(2011)]
          Length = 484

 Score =  226 bits (577), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 148/407 (36%), Positives = 211/407 (51%), Gaps = 41/407 (10%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
            S+ K+L NYA +A A YED+L  A+ L  A++  +  P + NLE AR  +  AR PY Q
Sbjct: 63  ASVNKLLTNYADMAQAAYEDSLTEAKKLQQAVDVFIADPTEANLEAARAAYKAARQPYSQ 122

Query: 84  SEVYRFGNKIV-----------DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
           +E++RF    V           D W+ +VNAWPLDE  IDYV   Y  E    +    NI
Sbjct: 123 TEIFRFDEGFVTANDKRALGSVDGWEGQVNAWPLDEALIDYVSEGYAGEYNSKD----NI 178

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           I +  I V   E D   I+PDLL +++   G + N+TTGYH IEFLLWGQD        G
Sbjct: 179 INSDHITVGSVEQDTKNITPDLLAEMNEIGGSEANVTTGYHAIEFLLWGQDNNGTAEGAG 238

Query: 193 NRPYTDFDIG-NCTGGH--------CRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT-- 241
           NRP TD+     CT G         C +R +YLK  +++LV+DL  M+  W P+ + T  
Sbjct: 239 NRPVTDYMTNEQCTSGEGNTVDASVCAKRGQYLKAATQLLVNDLTTMVAEWQPNSENTLR 298

Query: 242 KDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
            DLM +  N  +  +   M SL+  ELA ERM +  +    E E +CFSD T+ SY N+ 
Sbjct: 299 SDLMARSSNNAVRQLFYQMGSLALGELASERMQVAFVTGSTEDEHECFSDLTHLSYANNA 358

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHD-LISHNNRNLAQEINDKFSNTMKDFHILKDRAE- 358
            GI + + G+Y  ++G  +    I   LI    +  A ++  +F+   K F  + ++ E 
Sbjct: 359 RGIDNVFKGQYKTVSGSTVGNYGIKQFLIDAGQQEAADKLEAEFNKVEKSFDTIVEQGEK 418

Query: 359 NIESFDQMI------SENN---PEGNK---IVRNLINDLITQTESLR 393
           N    DQMI      S++N    E NK    V + INDL + T+++ 
Sbjct: 419 NGIKVDQMIATVGQASKHNVSAEEQNKRRGWVESAINDLKSLTDAIE 465


>gi|149910670|ref|ZP_01899307.1| uncharacterized iron-regulated protein [Moritella sp. PE36]
 gi|149806297|gb|EDM66273.1| uncharacterized iron-regulated protein [Moritella sp. PE36]
          Length = 425

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 136/375 (36%), Positives = 200/375 (53%), Gaps = 45/375 (12%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V+ + V  NY  +AHA Y D+L  A TL + +ETL+  P  +NL+NA+  +  AR+PYQQ
Sbjct: 34  VTEQDVKDNYIMMAHAAYADSLTTALTLQAKVETLLAAPTVQNLDNAKEAYKLARVPYQQ 93

Query: 84  SEVYRFGNKI--------------VDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           SE+ R+   I              VD W+ +VNAWPLDE  IDYV+   G EN       
Sbjct: 94  SEILRWDTDITINAGLDKDGGLNSVDEWEGQVNAWPLDEQAIDYVE---GNEN------- 143

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
                 S II  +   D++I   D L   +   G + N+TTG+H IEFLLWGQDL     
Sbjct: 144 ------SGIINQKNGADITI---DYLIAQNGVGG-EANVTTGFHAIEFLLWGQDLNGTKA 193

Query: 190 EPGNRPYTDFDI---GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM- 245
             G R   DF +   G C+  +C RR +YL VV+++LV DL  M   W      TK  + 
Sbjct: 194 GAGERSVNDFQMDKSGTCSASNCDRRRDYLNVVTQLLVDDLTAMTAEWTEQAADTKGTLA 253

Query: 246 ---KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
              K    G+  ++  M +++ +ELA  RMN GL   DPEQE DCFSD ++ +   ++  
Sbjct: 254 NNFKTSADGIRYMLFAMKAMATDELASARMNEGLEGLDPEQEHDCFSDLSHVAIYYNLQS 313

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE- 361
           + + + G Y  ++GEK+ GAS+ D I+  N  L ++ +D  +   K+  ++ +  E  E 
Sbjct: 314 VRNVFYGSYQTIDGEKVSGASLADFINQQNPALFKQFDDALNAIEKNMLVVYNAGEQAEP 373

Query: 362 -SFDQMI--SENNPE 373
             FDQ+I  +++ PE
Sbjct: 374 IRFDQIIGQADDAPE 388


>gi|330721293|gb|EGG99378.1| Iron-regulated protein A precursor [gamma proteobacterium IMCC2047]
          Length = 251

 Score =  220 bits (560), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 143/214 (66%), Gaps = 2/214 (0%)

Query: 27  EKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEV 86
           + ++ +YA +AHA ++DAL+ A+ L  A + L+  P++K L  AR  W ++R+PYQQSEV
Sbjct: 23  QAIVSHYADLAHAVFDDALITAQQLQQATDALLANPSEKTLAAARDAWKQSRVPYQQSEV 82

Query: 87  YRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEID 146
           +RFGN +VD W+ ++NAWPLDEG IDYV S Y  E   N   T NII+  ++ V  + ID
Sbjct: 83  FRFGNPVVDDWEGQLNAWPLDEGLIDYVASDYHYE-LGNEGATINIISKEELNVGGEVID 141

Query: 147 LSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCT 205
           +S ++PDLL  L+   G + N+ TGYH IEFLLWGQDL  N    G RPYTDF +G  CT
Sbjct: 142 VSNLTPDLLASLNELAGSEANVATGYHAIEFLLWGQDLYGNNAGAGERPYTDFVVGEGCT 201

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GG+C RR +YL+  S++LV DL  M+  W  D Q
Sbjct: 202 GGNCDRRGDYLRAASQLLVDDLAYMVDEWSADKQ 235


>gi|160896972|ref|YP_001562554.1| putative iron-regulated protein [Delftia acidovorans SPH-1]
 gi|160362556|gb|ABX34169.1| putative iron-regulated protein [Delftia acidovorans SPH-1]
          Length = 428

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 125/391 (31%), Positives = 206/391 (52%), Gaps = 37/391 (9%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
           ++S+ +V+++Y T+ HA Y D++  A+T+  AI   +  P+++ L  AR  W+ AR  Y 
Sbjct: 64  SLSVAEVVKHYGTLVHANYSDSISSAKTMQKAIAAFLAAPSEQGLNQARKAWLDAREYYG 123

Query: 83  QSEVYRFGNKIVDT---WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKII 139
           Q+E +RF    +D     + ++NAWP+DE ++DYV+ +                 N+ II
Sbjct: 124 QTEAFRFYAGPIDNDQGPEGQINAWPMDESYVDYVEGN----------------PNAGII 167

Query: 140 VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
            N KE     I+   L +L+  +G + N++TG+H IEF+LWGQDL  N + PG RPYTDF
Sbjct: 168 NNRKEA----ITKKRLAELNEHDG-EENVSTGWHAIEFMLWGQDL--NDKGPGARPYTDF 220

Query: 200 DIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT--KDLMKDINAGLNSIIT 257
             G  +  +  RR EYLKVV+ +L+ DL+ +   W P           K  +  L  I  
Sbjct: 221 VDGKKS--NADRRREYLKVVTALLIEDLQSVADQWKPGSPKNFRAQFEKKPDDALRRIFV 278

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           G+ SLS  ELAGER+ + L   D E E  CFSDNT+   + +  GI++ + G Y R++G 
Sbjct: 279 GLGSLSRGELAGERLEVALASRDQEDEHSCFSDNTHRDAVTNAQGILNVWQGSYKRLDGS 338

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKI 377
           ++ G  I D ++  +  LA     + + +++    +         FDQ I       ++ 
Sbjct: 339 ELQGPGIKDWVASKDSALADRTTRQITQSVQAAQAIP------APFDQAIQGARDSASRA 392

Query: 378 -VRNLINDLITQTESLRKIRIALDLIEPNRV 407
            ++  I+ L+ Q++ L +   A+ + + N V
Sbjct: 393 KIQATIDSLVQQSKDLVEAANAVGITQLNLV 423


>gi|149921138|ref|ZP_01909596.1| hypothetical protein PPSIR1_24909 [Plesiocystis pacifica SIR-1]
 gi|149818025|gb|EDM77484.1| hypothetical protein PPSIR1_24909 [Plesiocystis pacifica SIR-1]
          Length = 375

 Score =  209 bits (532), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 135/386 (34%), Positives = 206/386 (53%), Gaps = 56/386 (14%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
            V +NYA I  A Y DA M A  L +AI+T V  P++ NL  AR  W+ AR PY Q+EV+
Sbjct: 29  PVAENYADIVAANYADARMTAEALATAIDTFVGDPSEANLTAAREAWLAAREPYGQTEVF 88

Query: 88  RFGNKIVDT----WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           RF +  +D      + ++NAWP+DE +IDYVD           +  A II +     +  
Sbjct: 89  RFYDGPIDNPTDGPEGQLNAWPMDEAYIDYVD----------GMPDAGIINDLATYPD-- 136

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF-DIG 202
                 I+P+LL +L+ A G +TNI++GYH +EFLLWGQDL  +   PG RP TD+   G
Sbjct: 137 ------ITPELLAELNEAGG-ETNISSGYHAVEFLLWGQDLSAD--GPGARPATDYLTDG 187

Query: 203 NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD------GQATKDLMKDINAGLNSII 256
           N T  +  RR  YL+    +L+ DLE +  AW         G+A +++++        I+
Sbjct: 188 NGTAMNQDRRAAYLQAAVTLLIEDLEGLETAWAGSYRDSFVGEAPEEIVR-------RIL 240

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L   + E E  CFSDNT+   + + +GI + Y G Y  ++G
Sbjct: 241 LGMGSLSGAELAGERMEVALETQEQEDEHSCFSDNTHRDVVTNALGIQNVYLGRYGALDG 300

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES-FDQMISENNPEGN 375
           +     S++DL++  + +LA  + D+ + ++         AE I + FD+ I ++     
Sbjct: 301 Q-----SVYDLVAARDADLADRLRDEIAASVS-------AAEAIPAPFDRAIVDD----V 344

Query: 376 KIVRNLINDLITQTESLRKIRIALDL 401
           + V+  I+ L  Q +S+       D+
Sbjct: 345 ESVQATIDALRVQADSIADAAALFDI 370


>gi|262197051|ref|YP_003268260.1| peptidase M75, Imelysin [Haliangium ochraceum DSM 14365]
 gi|262080398|gb|ACY16367.1| Peptidase M75, Imelysin [Haliangium ochraceum DSM 14365]
          Length = 441

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 140/408 (34%), Positives = 200/408 (49%), Gaps = 54/408 (13%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           A   V  VS  +V+++YATI HA Y+DAL  A  L S I+  +  P     E  +  W+ 
Sbjct: 56  AAPPVAQVSRAEVVEHYATIVHANYKDALDRALHLQSTIDLFLAEPTASRFETVKRAWLE 115

Query: 77  ARIPYQQSEVYRFGNKIVDTWD---KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
           AR+PY QSE YRF    +D  D    ++NAWP+DE ++DYV     +E          II
Sbjct: 116 ARVPYGQSEAYRFYEGPIDDADGPEGQLNAWPMDEAYVDYVIDPQTEE---------TII 166

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGID-----------TNITTGYHVIEFLLWGQ 182
                IVN+ E +   I+ + L  L+     D             ++TGYH IEFLLWGQ
Sbjct: 167 TG---IVNDPERE---ITKEALASLNEGGEGDIFDGGDNFDPEKAVSTGYHAIEFLLWGQ 220

Query: 183 DLKTNVREPGNRPYTDF---DIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           DL  N   PG RP+ D+   D  + T  +  RR EYLKVV+++L+ DL  ++ AW PD  
Sbjct: 221 DL--NDEAPGERPFQDYLASDDPDATAPNGERRGEYLKVVTELLIDDLSGLVDAWAPD-- 276

Query: 240 ATKDLMK------DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTY 293
            T D  +      D +  L  +++G+  LS  EL  ERM++ L   D E E  CFSDNT+
Sbjct: 277 -TADNYRASFTGGDPDDALRDVLSGIGVLSKGELGAERMDVALRSLDQEDEHSCFSDNTH 335

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
                +  GI + Y G Y  ++     G SI DL+   +  L  E+   F  ++     +
Sbjct: 336 VDIAMNAQGIQNVYLGRYSYLS-----GPSISDLVRQEDPALDAEMRAAFEKSLAAVQAI 390

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
                    FDQ I     EG  +V   +N L  Q+E++ ++  AL L
Sbjct: 391 P------VPFDQNIDAQGSEGWNLVNEAVNALFDQSETIIEVGEALGL 432


>gi|88859144|ref|ZP_01133785.1| hypothetical protein PTD2_09069 [Pseudoalteromonas tunicata D2]
 gi|88819370|gb|EAR29184.1| hypothetical protein PTD2_09069 [Pseudoalteromonas tunicata D2]
          Length = 475

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 137/418 (32%), Positives = 207/418 (49%), Gaps = 48/418 (11%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V+ + V++  A  A+A Y D+L+ A+ L   +   V  P+ ++   A+  W+ AR PY Q
Sbjct: 52  VTTQDVIKTNAQHAYAVYADSLIAAKALKEQLAIFVANPSDESFSLAKKAWLAAREPYGQ 111

Query: 84  SEVYRFGNKIVDT--------W--------DKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           SEV+RF    +D         W        +  +NAWPL E  IDY     G +N EN  
Sbjct: 112 SEVFRFREGPIDNLTQDAAGNWVLAPEAGPEGAINAWPLAEALIDYTQDMDGLQNPEN-- 169

Query: 128 YTANIIANSKIIVNEKEID-LSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
             + + A   II    +ID   +I    ++        + N+T+GYH IEFLLWGQDL  
Sbjct: 170 -PSTLPAGGNIIA---DIDSFPVIDKATIQAQFERGDDEANVTSGYHAIEFLLWGQDLNA 225

Query: 187 NVREPGNRPYT-------DF-----DIGNCTGGH-------CRRRVEYLKVVSKILVSDL 227
           +     NR Y+       DF      +G CT G        C RR +YL   + +L+ DL
Sbjct: 226 DGTYTANRDYSAGYRKASDFYTVGNQMGQCTSGEAGAANVICIRRSQYLLAAADLLIDDL 285

Query: 228 EEMMKAWGPD-GQATKDLMKD--INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQE 284
           + ++ AW P  G   +  +K+      L  I+ GM  LSY ELAGERM++ L     E E
Sbjct: 286 KSVVDAWTPGTGFHYQAFIKEETQKQSLAKILEGMGRLSYGELAGERMSIALRTDSQEDE 345

Query: 285 IDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR-NLAQEINDKF 343
             CFSDNT+     +  GI +++ G+Y+R +GE + GASI++L+    +  LA ++    
Sbjct: 346 HSCFSDNTHRDIFLNAKGIQNTFNGQYVRFDGEVLQGASIYNLLVVAGKPELANKLRGAL 405

Query: 344 SNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            +TM    ++   A+   SFD  I +  PE    V N I  L TQT+ ++++  AL +
Sbjct: 406 EDTMAKAAVIDTTAKLGYSFDVQIQQ--PELKGAVTNTIEALKTQTQVIKEVIEALGV 461


>gi|124266651|ref|YP_001020655.1| iron-regulated protein A [Methylibium petroleiphilum PM1]
 gi|124259426|gb|ABM94420.1| iron-regulated protein A, putative [Methylibium petroleiphilum PM1]
          Length = 399

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 119/368 (32%), Positives = 188/368 (51%), Gaps = 39/368 (10%)

Query: 32  NYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGN 91
           +YA + HA YED+L  AR L  A+   V TP+ + L  AR +W+ AR  Y Q+E +RF  
Sbjct: 47  HYAVLVHANYEDSLQAARALQQAVVAFVATPSAEALAEARKRWLAAREFYGQTEAFRFYG 106

Query: 92  KIVDTWDK----KVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
             +D  DK    ++NAWP+DE F+D V    G          + +I N K ++++K +  
Sbjct: 107 GPIDD-DKGPEGRINAWPMDESFVDGVQGKPG----------SGLIGNRKFVISKKNL-- 153

Query: 148 SIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
                          G + NI TG+H IEFLLWGQD       PG+R + DF  G     
Sbjct: 154 ---------AAQNERGGEENIATGWHAIEFLLWGQDRSET--GPGDRSFEDFVDGKAP-- 200

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGP--DGQATKDLMKDINAGLNSIITGMTSLSYN 265
           +  RR +YL VV+++L+ DL  ++KAW P   G       +     +  I+ G+ SLS  
Sbjct: 201 NADRRRQYLTVVTELLIDDLAGLVKAWAPATKGNYRARFEQGGKESVRKILVGLGSLSRG 260

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           ELAGER+ + L   D E E  CFSDNT+   +N+  GI + + G Y+R +G  + GAS+ 
Sbjct: 261 ELAGERLEVALNSQDQEDEHSCFSDNTHRDAVNNAKGIENVWLGRYVRADGSTLQGASLR 320

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD-QMISENNPEGNKIVRNLIND 384
           +L++  +  LA+    + + ++     ++        FD +++   +  G + ++  I  
Sbjct: 321 ELVAEKDAALAERGTRQIAASVAAAEAIQ------APFDREIVGAKDAPGRQRIQKTIAS 374

Query: 385 LITQTESL 392
           L  Q++ L
Sbjct: 375 LTQQSKDL 382


>gi|119944460|ref|YP_942140.1| uncharacterized iron-regulated protein [Psychromonas ingrahamii 37]
 gi|119863064|gb|ABM02541.1| uncharacterized iron-regulated protein [Psychromonas ingrahamii 37]
          Length = 429

 Score =  202 bits (514), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 133/393 (33%), Positives = 198/393 (50%), Gaps = 45/393 (11%)

Query: 2   YFITIISIVFT-LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +F +     F     H  +    VS  +V  NY  +A+A YED+L  A  L + I  L+ 
Sbjct: 14  FFCSTAFAAFADKAEHRSASSTQVSESEVKANYVKMAYAAYEDSLNSALYLQNNIGKLLA 73

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRF--------------GNKIVDTWDKKVNAWPL 106
           +P++  L  A+  +  ARIPYQQ+E+ R+              G   VD W+ +VNAWPL
Sbjct: 74  SPSEGQLLQAKAAYKLARIPYQQTEIMRWDTDITITAELDKDGGPASVDQWEGQVNAWPL 133

Query: 107 DEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDT 166
           DE  IDYV  +                AN+ II N+K  +   I+PD L   +   G + 
Sbjct: 134 DEQAIDYVQGN----------------ANAGII-NKK--NGPAINPDYLIAQNGMGG-EA 173

Query: 167 NITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI---GNCTGGHCRRRVEYLKVVSKIL 223
           N+TTG+H IEFLLWGQDL       G R   DF     G C+  +C RR  YL+  S++L
Sbjct: 174 NVTTGFHAIEFLLWGQDLNGTNAGAGQRNVNDFQTDLSGKCSVNNCDRRRTYLQAASQLL 233

Query: 224 VSDLEEMMKAWGPDGQATKDLMK----DINAGLNSIITGMTSLSYNELAGERMNLGLILH 279
           V+DL EM   W       +  +       + G+  I+  M S++ +ELA  RMN GL   
Sbjct: 234 VADLREMRDQWSATASRQQGTLAYNFLASDDGIRYILFAMKSMATDELASARMNEGLDGL 293

Query: 280 DPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEI 339
           DPEQE DCFSD ++ +   +   I +++ G Y    G+ + GAS+ D I   +  + ++ 
Sbjct: 294 DPEQEHDCFSDLSHLAIYYNFQAIRNAFYGGYQNTMGQYVSGASLGDYIHQQSPAIFKQF 353

Query: 340 NDKFSNTMKDFHILKDRAENIES---FDQMISE 369
           +D+F++  K+  I+ D  E I +   FDQ+I +
Sbjct: 354 DDQFNDIEKNMKIVFDAGERINNPIRFDQIIGQ 386


>gi|332529697|ref|ZP_08405651.1| iron-regulated protein A [Hylemonella gracilis ATCC 19624]
 gi|332040718|gb|EGI77090.1| iron-regulated protein A [Hylemonella gracilis ATCC 19624]
          Length = 418

 Score =  200 bits (508), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 131/394 (33%), Positives = 202/394 (51%), Gaps = 51/394 (12%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+ +YAT+ HA YED L+ A  L  ++   +  P++  LE AR  W+ AR  Y Q+E +R
Sbjct: 58  VVAHYATLVHANYEDTLLAALELQKSVRAFIAAPSQARLEAARKAWLDAREVYGQTEAFR 117

Query: 89  F-GNKIVDTW--DKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEI 145
           F G  I D    + ++NAWP+DE ++D VD   G                   ++N+++ 
Sbjct: 118 FYGGPIDDEEGPEGRINAWPMDESYVDGVDGKPGSG-----------------LINDRKF 160

Query: 146 DLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCT 205
            ++  S   L + +  +G + NI TG+H IEF+LWGQDL  N   PG R +TDF  G   
Sbjct: 161 KITKAS---LSEANEKDG-EENIATGWHAIEFMLWGQDLDDN--GPGQRAHTDFVDGKTP 214

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD-----LMKDINAGLNSIITGMT 260
             +  RR  YL VV+ +L+ DL  +++AW P     K        +  +  +  II G+ 
Sbjct: 215 --NADRRRLYLNVVTDLLIDDLRFLVQAWTPAKAGAKKNYRVTFEQGGSESVRKIIVGLG 272

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEK-- 318
           SLS  EL+GERM + L   D E E  CFSDNT+   + +  GI + + G Y R  G K  
Sbjct: 273 SLSRGELSGERMEVALNTQDQEDEHSCFSDNTHRDIVANATGIQNVWLGSYKRRPGAKGP 332

Query: 319 --IHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES-FDQMISENNPEGN 375
             + G S+  L++  ++ LA  +  + + ++ D       AE I + FD+ I + +P G 
Sbjct: 333 QTLEGPSLRALVAAKDKALADRVTAQIAQSVAD-------AERIPAPFDRAILDGSP-GQ 384

Query: 376 KIVRNLINDLITQT----ESLRKIRIA-LDLIEP 404
            +++  I  L+ Q+    ES   I I  L L+EP
Sbjct: 385 PLIKKTIASLVEQSKLLVESASAIGITQLTLVEP 418


>gi|326318038|ref|YP_004235710.1| peptidase M75, Imelysin [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323374874|gb|ADX47143.1| Peptidase M75, Imelysin [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 409

 Score =  199 bits (506), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 135/403 (33%), Positives = 203/403 (50%), Gaps = 56/403 (13%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            A S  P      V  +YA + HA YED L  ART+ +AI+     P+ + L  AR  W+
Sbjct: 45  QATSATPAA----VAAHYAVLVHANYEDTLNAARTMQAAIKAFTARPSAETLAEARKTWL 100

Query: 76  RARIPYQQSEVYRF-GNKIVDTWDK----KVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
            AR  Y Q+E +RF G  I D  DK    ++NAWP+DE    YVDS  G+ +        
Sbjct: 101 AAREFYGQTEAFRFYGGPIDD--DKGPEGQLNAWPMDE---SYVDSVEGRPDSG------ 149

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
                   +VN+++   +I   +L  +  R  G + N+ TG+H IEF LWGQDL      
Sbjct: 150 --------LVNDRK--FAITKKNLAAQNER--GGEENVATGWHAIEFFLWGQDLSET--G 195

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDI 248
           PG+R + DF  G   G +  RR +YL VV+ +L+ DL  ++KAW P          +K  
Sbjct: 196 PGDRNFEDFVDGK--GRNADRRRQYLNVVTDLLIDDLASLVKAWDPKTPNNYRAKFVKGG 253

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
              +  ++ G+ SLS  ELAGER+ + L   D E E  CFSDNT+   + + +GI + + 
Sbjct: 254 QESVRKMLVGLGSLSRGELAGERLEVALNSQDQEDEHSCFSDNTHRDAVTNALGIRNVWL 313

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES-FD-QM 366
           GEY R +G  + GAS+ DL++  +  LA     + + ++K        AE I++ FD ++
Sbjct: 314 GEYRRADGSLVQGASLRDLVAAKDAALADRTTQQIAASVK-------AAEGIQAPFDREI 366

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIG 409
           I   +  G   ++  I+ L  Q++         DL+E    IG
Sbjct: 367 IGGKDAPGRLRIQKTIDSLTQQSK---------DLVEAANAIG 400


>gi|289677765|ref|ZP_06498655.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae FF5]
          Length = 234

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 127/199 (63%), Gaps = 2/199 (1%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+D W+
Sbjct: 26  AVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTIIDDWE 85

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
            +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L
Sbjct: 86  GQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASL 144

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLK 217
           +   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK
Sbjct: 145 NELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGHNDRRRAYLK 204

Query: 218 VVSKILVSDLEEMMKAWGP 236
            V+ +LVSDLEEM   W P
Sbjct: 205 AVTDLLVSDLEEMSGNWKP 223


>gi|313676340|ref|YP_004054336.1| peptidase m75, imelysin [Marivirga tractuosa DSM 4126]
 gi|312943038|gb|ADR22228.1| Peptidase M75, Imelysin [Marivirga tractuosa DSM 4126]
          Length = 386

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 137/396 (34%), Positives = 204/396 (51%), Gaps = 37/396 (9%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           ++I+ +V  L S   S    +S ++V++NYA I +A Y DA   A  L   I+     P+
Sbjct: 5   LSIVILVLFLFS--CSTKQEISKKEVVENYANIVYANYLDAHEHALALRREIKHFTENPS 62

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTW---DKKVNAWPLDEGFIDYVDSSYGK 120
           +   +  +  W+  R  Y Q+E +RF    +D     + ++NAWPLDE +IDYV S    
Sbjct: 63  QNGFDRTKEAWLLTRESYGQTEAFRFYGGPIDGENGPEGQLNAWPLDEAYIDYVAS---- 118

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
              ENN   ANII NS     E       I+ D +  ++   G +TN+++GYH IEFLLW
Sbjct: 119 ---ENN--NANII-NSPETFPE-------ITADFIASMNE-KGSETNVSSGYHAIEFLLW 164

Query: 181 GQDLKTNVREPGNRPYTDF-DIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GQDL ++    G R YTD+ D    T  +  RR  YL   + +LVSDL+ +M+ W P+ Q
Sbjct: 165 GQDL-SDGPGAGERKYTDYIDGEEATAKNANRRKTYLLETANLLVSDLKSVMEEWAPNQQ 223

Query: 240 ATK-DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
             +   + + +  +  I++G+  LS  ELAGERM +   L   E E  CFSDNT+   + 
Sbjct: 224 NYRATFISNPDQSIEKIVSGLGKLSKGELAGERMFVAYDLRSKEDEHSCFSDNTHRDIVA 283

Query: 299 DVIGIISSYTGEYIRM-NGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
           +  GI + Y G+Y    N   I G SI+DL+      LA+E+    +N + D       +
Sbjct: 284 NATGIQNVYLGKYKTFRNDSTISGPSIYDLVKQQEEALAEELKQTIANGLAD-------S 336

Query: 358 ENIES-FDQMISENNPEGNKIVRNLINDLITQTESL 392
           + IE+ FDQ I   N EG K +   I+    Q + L
Sbjct: 337 KKIEAPFDQQI--KNEEGRKQIAKTISLFRKQGDLL 370


>gi|149927624|ref|ZP_01915877.1| iron-regulated protein A, putative [Limnobacter sp. MED105]
 gi|149823678|gb|EDM82906.1| iron-regulated protein A, putative [Limnobacter sp. MED105]
          Length = 389

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 120/378 (31%), Positives = 193/378 (51%), Gaps = 37/378 (9%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   S + V++ Y  + +A Y D+++ A+ L S+I+  +  P++  LE A+  W+ AR  
Sbjct: 26  VAAPSDQDVVKGYGQLVYANYTDSVIAAQKLQSSIDAFLKAPSEAGLEAAKKAWLNAREF 85

Query: 81  YQQSEVYRFGNKIVD---TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           Y Q+E +RF    +D     + ++NAWP+DE ++DYV  +                A S 
Sbjct: 86  YGQTEAFRFYGGPIDDENGPEGQINAWPMDESYVDYVQGN----------------ARSG 129

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYT 197
            I N  E     IS D L + +     + NI TG+H IEFLLWGQDL  N   PG RPYT
Sbjct: 130 FI-NNPEFK---ISRDALIEENERG-GEENIATGWHAIEFLLWGQDLNEN--GPGQRPYT 182

Query: 198 DFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG--QATKDLMKDINAGLNSI 255
           D+  G   G +  RR  YL+ ++ +L+ DL+ +  AW P        +  KD    +  I
Sbjct: 183 DYVKGK--GQNAERRATYLREITALLIHDLQTVQSAWAPKKPDNFRANFEKDGKESIRKI 240

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           + G+ SLS  ELAGER+ + L   D E E  CFSDNT+   + +  GI++ +TG Y + +
Sbjct: 241 LVGLGSLSRGELAGERLEVALFSQDQEDEHSCFSDNTHRDAVTNAQGILNVWTGTYKQAD 300

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD-QMISENNPEG 374
           G  +   S+ +L+      +A++   +  N++K    ++        FD ++I   N  G
Sbjct: 301 GAVLKVPSLAELVGARAPEVAKKTTQQIQNSVKAASAIQ------APFDREIIGGANAPG 354

Query: 375 NKIVRNLINDLITQTESL 392
            + V+  ++ L+ Q+  L
Sbjct: 355 PQRVKATVDSLVEQSTLL 372


>gi|124007535|ref|ZP_01692240.1| insulin-cleaving metalloproteinase outer membrane protein
           [Microscilla marina ATCC 23134]
 gi|123987018|gb|EAY26774.1| insulin-cleaving metalloproteinase outer membrane protein
           [Microscilla marina ATCC 23134]
          Length = 392

 Score =  186 bits (472), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 131/383 (34%), Positives = 185/383 (48%), Gaps = 44/383 (11%)

Query: 26  LEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSE 85
           + +VL+ YA IAH  Y D+      L ++I+  V  P++   + A+  W  AR PY Q+E
Sbjct: 35  VAEVLETYAKIAHQSYSDSYDKVVALKTSIDAFVANPDQAKFDAAKQAWKDAREPYGQTE 94

Query: 86  VYRFGNKIVDTW----DKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
           V+RF    +D      +  +NAWPLDE FIDYV  +           TA II        
Sbjct: 95  VFRFYEGPIDNSATGPEGAINAWPLDENFIDYVAGNA----------TAGIIN------- 137

Query: 142 EKEIDLS-IISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT--NVREPGNRPYTD 198
               DL+  I    LR  +   G + NI+ GYH IEFLLWGQD     +    G R +TD
Sbjct: 138 ----DLTQTIDAATLRGNNEKGG-EKNISIGYHAIEFLLWGQDTNPGGDYSNAGQRAFTD 192

Query: 199 FDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITG 258
           +     T  +  RR  YL V   +L+ DL+ +  AW          + D N  +  I+TG
Sbjct: 193 Y----TTATNADRRKTYLHVTIDLLLEDLKTVRDAWAEGASYRTSFVADGNKSIVRILTG 248

Query: 259 MTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEK 318
           M SLS  ELAGERM + L  HD E E  CFSDNT+   + +  GI + Y G Y  + G+ 
Sbjct: 249 MGSLSEAELAGERMKVALFNHDQEDEHSCFSDNTHRDIVTNAQGIYNVYWGTYGSVTGKG 308

Query: 319 IHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIV 378
           I  AS+ +++   ++ L  +I  +   T      ++        FD+ IS+ N  GN+ V
Sbjct: 309 I--ASLVEVV---DKELYAQIKTELEATKAATLAIQ------APFDKEISQGNTAGNQRV 357

Query: 379 RNLINDLITQTESLRKIRIALDL 401
              I  L  QT S+  I   L+L
Sbjct: 358 EVAITALRAQTRSIESIAQKLNL 380


>gi|150025534|ref|YP_001296360.1| lipoprotein precursor [Flavobacterium psychrophilum JIP02/86]
 gi|149772075|emb|CAL43551.1| Probable lipoprotein precursor [Flavobacterium psychrophilum
           JIP02/86]
          Length = 390

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 131/364 (35%), Positives = 187/364 (51%), Gaps = 37/364 (10%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V NV+ ++V++NYA IA+  Y+ A   A  L SAI T  TTP + N +NA+ +W  AR  
Sbjct: 31  VKNVTKKEVIENYANIAYENYKKAYDDAVILKSAITTFTTTPTQVNFDNAKNKWKVARES 90

Query: 81  YQQSEVYRFGNKIVDTW---DKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           Y  +E +RF N  +D     +  +N+WPLDE FIDYV+ +                 N+ 
Sbjct: 91  YGTTEAFRFANGPIDNTTGPESFLNSWPLDENFIDYVNGA----------------PNAG 134

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT-NVREPGNRPY 196
           I+ NE      II+  +L++ +   G + NI+ GYH IEFLLWGQDL   +V +PG RPY
Sbjct: 135 IVNNEAL--FPIITKSVLKEQNELGG-EKNISVGYHAIEFLLWGQDLTAPSVNKPGQRPY 191

Query: 197 TDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ-ATKDLMKDINAGLNSI 255
           TD+ I   T  +  RR  YL   S +L  +L E++  W   G   T  L    N  L ++
Sbjct: 192 TDYIIAGGTAANQARRTAYLVACSDLLTDNLLEVVNQWKVGGAYRTTFLGLPENEALKNM 251

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
             G+T+L   EL  ERM + L   D E E  CFSDNT+   + ++ G+I+ Y G+Y    
Sbjct: 252 YLGITTLISAELPVERMEVALGNADQEDEHSCFSDNTHRDIILNLQGVINVYQGKY---- 307

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS--ENNPE 373
              I GAS+ DL+S  N     E N   + ++   + L         FD  IS    + E
Sbjct: 308 -GSIDGASLEDLVSQANVQANTETNASIALSLTKANAL------FNPFDLAISGGATSVE 360

Query: 374 GNKI 377
           G K+
Sbjct: 361 GAKV 364


>gi|121605456|ref|YP_982785.1| putative iron-regulated protein [Polaromonas naphthalenivorans CJ2]
 gi|120594425|gb|ABM37864.1| putative iron-regulated protein [Polaromonas naphthalenivorans CJ2]
          Length = 400

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 128/402 (31%), Positives = 199/402 (49%), Gaps = 43/402 (10%)

Query: 1   MYFITIISIVFTLPSHALSIVPN--VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETL 58
           ++  +  ++  T P+ A    P   VS   V  +YA +  A Y D L  A+T+  AI+  
Sbjct: 13  LFPASQTAMAQTAPAPAGVTAPAGAVSFNAVASHYAALVEASYADTLTAAKTMQQAIDAF 72

Query: 59  VTTPNKKNLENARLQWIRARIPYQQSEVYRF-GNKIVDT--WDKKVNAWPLDEGFIDYVD 115
             +P+  +L  AR  W+ AR  Y Q+E +RF G  I D    + ++NAWP+DE ++D V+
Sbjct: 73  AKSPSADSLAAARKAWLAAREFYGQTEAFRFYGGPIDDANGPEGRINAWPMDESYVDGVN 132

Query: 116 SSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVI 175
           S  G          + +I   K  +++K +                 G + NI TG+H I
Sbjct: 133 SKPG----------SGLINKRKFAISKKAL-----------AAQNERGGEENIATGWHAI 171

Query: 176 EFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG 235
           EFLLWGQD+      PG+R + DF  G     +  RR +YL  V+++LV DL  + K W 
Sbjct: 172 EFLLWGQDVSET--GPGDRSFEDFVDGKKP--NADRRRQYLTTVTELLVDDLSGVAKQWA 227

Query: 236 PDGQATKDLMKDINAGLNS---IITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNT 292
           P G  T    K    G  S   I+ G+ SLS  ELAGER+ + L   D E E  CFSDNT
Sbjct: 228 P-GVKTNYRAKFEKGGQESVRKILLGLGSLSRGELAGERLEVALNSQDQEDEHSCFSDNT 286

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHI 352
           +   +N+  GI + + GEY R +   + GAS+ DL++  +  LA+    + + ++     
Sbjct: 287 HRDVVNNARGIQNVWLGEYKRADDSVLKGASLRDLVAVKDAGLAERTTKQITGSVV---- 342

Query: 353 LKDRAENIES-FD-QMISENNPEGNKIVRNLINDLITQTESL 392
               AE I++ FD +++   +  G   ++  I  L  Q++ L
Sbjct: 343 ---AAEGIQAPFDREIVGAKDAAGRLRIQKTIASLTQQSKDL 381


>gi|120610605|ref|YP_970283.1| putative iron-regulated protein [Acidovorax citrulli AAC00-1]
 gi|120589069|gb|ABM32509.1| putative iron-regulated protein [Acidovorax citrulli AAC00-1]
          Length = 407

 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 123/386 (31%), Positives = 193/386 (50%), Gaps = 50/386 (12%)

Query: 32  NYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGN 91
           +YA + HA Y DAL  A+T+ +AI      P+ + L  AR  W+ AR  Y Q+E +RF  
Sbjct: 55  HYAVLVHANYADALAAAKTMQAAIRAFTAKPSAETLAEARKTWLAAREFYGQTEAFRFYG 114

Query: 92  KIVDTWDK----KVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
             +D  DK    ++NAWP+DE    YVDS  G+ +       A ++ + K  + +K +  
Sbjct: 115 GPIDD-DKGPEGQINAWPMDE---SYVDSVEGRPD-------AGLVNDRKFAITKKNL-- 161

Query: 148 SIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
                          G + N+ TG+H IEF LWGQDL      PG+R   DF  G   G 
Sbjct: 162 ---------AAQNERGGEENVATGWHAIEFFLWGQDLSET--GPGDRNVDDFVDGK--GK 208

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDINAGLNSIITGMTSLSYN 265
           +  RR +YL VV+ +L+ DL  +++AW P          ++     +  ++ G+ SLS  
Sbjct: 209 NADRRRQYLNVVTDLLIDDLSFLVQAWDPKVPNNYRAKFVRGGQESVRKMLVGLGSLSRG 268

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           ELAGER+ + L   D E E  CFSDNT+   + + +GI + + GEY R +G  + GAS+ 
Sbjct: 269 ELAGERLEVALNSQDQEDEHSCFSDNTHRDAVTNALGIRNVWLGEYKRADGSLVKGASLR 328

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES-FD-QMISENNPEGNKIVRNLIN 383
           DL++  +  LA     + + ++       + AE I++ FD ++I   +  G   ++  I+
Sbjct: 329 DLVAAKDAALAGRTTRQIAASV-------EAAEGIQAPFDREIIGGKDAPGRLRIQKTID 381

Query: 384 DLITQTESLRKIRIALDLIEPNRVIG 409
            L  Q++         DL+E    IG
Sbjct: 382 SLTQQSK---------DLVEAANAIG 398


>gi|301166521|emb|CBW26097.1| putative exported protein [Bacteriovorax marinus SJ]
          Length = 441

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 145/441 (32%), Positives = 216/441 (48%), Gaps = 73/441 (16%)

Query: 3   FITIISIVFTLPSHALSIVP---NVSLEK-VLQNYATIAHAKYEDALMCARTLDSAIETL 58
            +T   + F+L +HA+   P   N SL + V+ NY+ +A   Y D+L  AR L S I   
Sbjct: 29  LLTSAVVAFSLQAHAVK-APYKNNESLNREVISNYSDLALLNYNDSLQGARALKSEIAKF 87

Query: 59  VTTPNK------KNLENARLQW-IRARIPYQQSEVYRFGNKIVD---------TWDKKVN 102
           V    K      K  +  +  W + AR+PY QSE++RF N  +D         T+ + +N
Sbjct: 88  VKLAKKGSKLASKQYDIVKKTWSLEARMPYGQSEIFRFYNGPIDFEPIDDGVTTYLESIN 147

Query: 103 ---------AWPLDEGFIDYV--DSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIIS 151
                    AWPLDE +IDYV  DS+ G                   +VN + I L+   
Sbjct: 148 FEGVEGLMNAWPLDEIYIDYVKEDSTAG-------------------LVNNRNIKLT--- 185

Query: 152 PDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRR 211
            D+L  ++   G + NI+TGYH IEFLLWGQD   ++   G RPYTD+  G       RR
Sbjct: 186 KDVLVSMNEREG-EKNISTGYHAIEFLLWGQD--RSIDTAGQRPYTDYVDGGTAKNQDRR 242

Query: 212 RVEYLKVVSKILVSDLEEMMKAW--GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAG 269
           R EYL ++  +L   L  +   W  G     T+ L +D N+ L  I T M S++ +EL  
Sbjct: 243 R-EYLSLLIDLLDDHLSTVTNQWQVGEKNYRTEFLKRDSNSVLTDIFTSMISMAGDELKS 301

Query: 270 ERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEK-IHGASIHDLI 328
           ER+    +L D E+E  CFSD T      + +G+ + Y G+Y+  N  K I+G  I+DL+
Sbjct: 302 ERIENAFLLEDQEEEHSCFSDQTINDIYTNALGVKNIYFGDYVAHNSSKSINGKGINDLV 361

Query: 329 SHNNRNLAQEINDKFSNTMKDFHILKDRAEN-------IES-FDQMISENNPEGNKIVRN 380
           +  N  L Q I  KF +   + +    ++ N       IE+ FD+ ++ N  E    ++N
Sbjct: 362 AFVNPELDQAITKKFDSLFNNINFFYKKSRNGQVQIGSIETPFDRALTTNKVE----IQN 417

Query: 381 LINDLITQTESLRKIRIALDL 401
           +I+DL +  E LR+    L L
Sbjct: 418 IIDDLGSIDELLREAASELGL 438


>gi|88803059|ref|ZP_01118586.1| hypothetical protein PI23P_10715 [Polaribacter irgensii 23-P]
 gi|88781917|gb|EAR13095.1| hypothetical protein PI23P_10715 [Polaribacter irgensii 23-P]
          Length = 413

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 108/342 (31%), Positives = 175/342 (51%), Gaps = 24/342 (7%)

Query: 22  PNVSLE----KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA 77
           P +++E    + + NY  I  A Y DAL     L +A++T V TPN+   + A+  W+ +
Sbjct: 34  PTIAIEVKKKEFVTNYTNIVFASYADALNKLNELKTAVDTFVATPNENTFQTAKDTWLAS 93

Query: 78  RIPYQQSEVYRFGNKIVDTWDKK----VNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
           R PY Q+E YRF +  +D  + +    +NAWPLDE  IDYV +  G +         ++ 
Sbjct: 94  REPYGQTEAYRFYDGPIDGGEGEPEGYINAWPLDEALIDYVTTGTGGQ---------DLS 144

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD-LKTNVREPG 192
            + + I+N KE   S ++ + L++L   +  ++N+T G+H IEFLLWGQD  + + +  G
Sbjct: 145 DDRQNIINNKEKYPS-LTKETLKELSGYDSNESNVTVGFHAIEFLLWGQDNTQPSEKMAG 203

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK-DINAG 251
            R  TDF     T  +  RR EYL  V+ +LV D++ ++  W P    +   +    +  
Sbjct: 204 QRALTDF----TTATNAVRRGEYLVAVTALLVDDVKSVVDQWKPGASYSSSFLAMSSDDA 259

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           +  I+TG   LS  ELAGERM + +   + E E  CFSDNT+     +   I +   G Y
Sbjct: 260 ITKILTGAAKLSKGELAGERMAVAVENQNQEDEHSCFSDNTHRDVYLNAKSIDNIIHGSY 319

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
              +G  + G S+ D+++  N + A  +    S  M    ++
Sbjct: 320 KNTDGSIVSGTSLLDILALVNNDEATALTATASEVMNKVTVI 361


>gi|254785012|ref|YP_003072440.1| peptidase, imelysin family [Teredinibacter turnerae T7901]
 gi|237684511|gb|ACR11775.1| peptidase, imelysin family [Teredinibacter turnerae T7901]
          Length = 484

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 124/417 (29%), Positives = 192/417 (46%), Gaps = 56/417 (13%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           KVL   A IA A Y D++  ++ L +AI T    P + NL+ A++ W+ +R PY Q+EVY
Sbjct: 55  KVLNTNADIAFAAYSDSVDTSKALQTAIATFKAEPTQANLDAAKIAWLVSREPYGQTEVY 114

Query: 88  RFGNKIVDTWDKK--------VNAWPLDEGFIDYV--DSSYGKENEE-NNLYTANIIANS 136
           RF    +D+ D +        +NAWPL E  IDY    S +G +  E ++ Y        
Sbjct: 115 RFRLSPIDSTDYQNEDGPEGDINAWPLGEALIDYTVSGSDFGADQTEVSSAYPTIGYPQE 174

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN--------- 187
            II ++  ID      D L       G +  + +GYH IEF+LWGQDL T+         
Sbjct: 175 NIINSDVAID------DALFAAVADVGDERGVISGYHAIEFMLWGQDLNTDGSADTEDDR 228

Query: 188 --------VREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
                   +   G+RP +DF     T  +  RR+++++VV+  LV+DLE +   W   G 
Sbjct: 229 EMSTGGNILNSGGHRPLSDF----TTDANAARRMQFMEVVAAKLVADLEAVRDGWAV-GS 283

Query: 240 ATKDLMKDINAG------LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTY 293
           + +     +N        +  I+ GM +LS  ELAGERM +       E E  CFSDNT+
Sbjct: 284 SYRTAFTTVNTETQAVNRMAEILFGMGTLSTAELAGERMQIAFSSGSQEDEHSCFSDNTH 343

Query: 294 ASYLNDVIGIISSYTGEYIRMNGE----------KIHGASIHDLISHN-NRNLAQEINDK 342
                D  G+ +SY G Y   + +           ++G  I D ++ + N  L  +++  
Sbjct: 344 RDVWLDAEGVSNSYYGVYAGYDSDLDGTDDVTTRAVNGYGIDDYLNESGNSALDDKVSTA 403

Query: 343 FSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            S T  ++  +   A     FD +I +     +  V   I  L  QT    +I +A+
Sbjct: 404 LSVTATNYEAIDASARAGTPFDNLIMDEARASDNPVAKTILSLTEQTLRFAEIAVAI 460


>gi|110637086|ref|YP_677293.1| imelysin [Cytophaga hutchinsonii ATCC 33406]
 gi|110279767|gb|ABG57953.1| imelysin, Metallo peptidase, MEROPS family M75 [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 410

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 122/378 (32%), Positives = 190/378 (50%), Gaps = 50/378 (13%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           KV++NYA I +A Y+DAL+ A+ L +     V +P++  LE  R  +I +R PY QSE +
Sbjct: 45  KVVENYANIVYATYDDALITAKNLRAKAADFVASPSEAGLEEVRAAYIASRTPYIQSEAF 104

Query: 88  RFGNKIVD-------TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           RF +  +D       T +  +N+WPL+E +IDYV    G  N       A II +   + 
Sbjct: 105 RFYSGPIDQDLGGGLTIESSINSWPLEEVYIDYV---VGDAN-------AGIIND---VA 151

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
           +   ID ++I    L    +    + ++++GYH +EFLLWGQDL      PG+R YTD+ 
Sbjct: 152 HFPTIDKNVI----LENNQKEGAGENSVSSGYHAVEFLLWGQDLSET--GPGDRKYTDYL 205

Query: 201 IG--NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT---KDLMKDINAGLNSI 255
           +   + T  +  RR +YL     +++ +L+ + +AW   G A+      + D    + + 
Sbjct: 206 VNSDDATNLNQARRGQYLLACIDLIIDNLQTLKEAW-KSGNASNYRAGFIADPKGSIGNF 264

Query: 256 ITGMTSLSYNELAGERMNLGLILHD----PEQEIDCFSDNTYASYLNDVI----GIISSY 307
           + G+   + +EL+ ERM + L         EQE  CFSD TY    ND+I    GI + Y
Sbjct: 265 LKGVIGYADDELSVERMQVALDTEGDAERQEQEQSCFSDQTY----NDIILGQKGIKNVY 320

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI 367
            GEY+R++G  + G S+ DL+   +  L   +  K  +T  D  +    A     FD  I
Sbjct: 321 VGEYVRIDGTIVSGMSVSDLVKAADPKLDSTVRAKIYDT--DIKVAAIHA----PFDNEI 374

Query: 368 SENNPEGNKIVRNLINDL 385
              N  G   V+N IN L
Sbjct: 375 LTANTAGTIRVQNAINAL 392


>gi|157737979|ref|YP_001490663.1| hypothetical protein Abu_1746 [Arcobacter butzleri RM4018]
 gi|157699833|gb|ABV67993.1| conserved hypothetical protein [Arcobacter butzleri RM4018]
          Length = 451

 Score =  166 bits (420), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 130/428 (30%), Positives = 202/428 (47%), Gaps = 68/428 (15%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKV--------LQNYATIAHAKYEDALMCARTLDSAIETL 58
           +S+V +L   + +   N  ++KV        L+ YA IA   Y +AL  A+ L  AI+  
Sbjct: 12  VSVVASLALTSYAATNNNEVKKVEVAKQASILEAYANIALDNYTNALKDAKNLKVAIDKF 71

Query: 59  VTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT---W--------DKKVNAWPLD 107
              P ++N + A+  W+ +R  Y  +E++R  N  +D    W        + ++NAWPLD
Sbjct: 72  AKAPTQENFDAAKKAWLDSRESYGSTEIFRLSNGPIDAEEGWIADAYGALEGQINAWPLD 131

Query: 108 EGFIDYVDSSYGKENEENNLYTANIIANSKII----VNEKEIDLSIISPDLLRKLHRANG 163
           E  IDY   + GK      L + NII           + KE+D++ I+ D L  L+  NG
Sbjct: 132 ENMIDYTVDAEGK------LTSGNIIDTVGKFNPGGEDSKEVDVTKITVDALTDLNE-NG 184

Query: 164 IDTNITTGYHVIEFLLWGQD------LKTNVRE----PGNRPYTDFDIGNCTGGHCRRRV 213
            + N++TGYH IEFLLWGQD      +  NV +     G RP TDF     T  + +RR+
Sbjct: 185 GEANVSTGYHAIEFLLWGQDQDYANFMDDNVTKGPMTAGQRPLTDF----TTDKNSQRRL 240

Query: 214 EYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK----------------DINAGLNSIIT 257
            YLK  S+ LV DLE +  AW  + +  + L +                D    L  II 
Sbjct: 241 AYLKASSEKLVKDLETVTSAWKKEVKGNQGLYQAALLGKLKGKDKDKNIDQKEALKQIIA 300

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           GM     +ELA ER+ + ++    E E  CFSDNT+   + +  G  +  T  Y   NG+
Sbjct: 301 GMGVFIKSELANERIAVAVLTPSEEDEHSCFSDNTHRDLVKNYEGFKNVLTATY---NGK 357

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKI 377
           K +G S+ D +   ++   + I    S+  +    +   A+    FD  I  ++ E +K+
Sbjct: 358 K-YGKSLFDAV---DKETKERIEKLMSSIEEKIESVDKIAKTEAHFDYQIRPDH-EQSKV 412

Query: 378 VRNLINDL 385
           +  L N+L
Sbjct: 413 ITKLKNEL 420


>gi|158336553|ref|YP_001517727.1| iron-regulated protein [Acaryochloris marina MBIC11017]
 gi|158306794|gb|ABW28411.1| iron-regulated protein, putative [Acaryochloris marina MBIC11017]
          Length = 405

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 120/387 (31%), Positives = 191/387 (49%), Gaps = 53/387 (13%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
           NV L   ++NYA +    Y+DA   A  +  AI   +  PN+ + + A+  W++AR  Y 
Sbjct: 45  NVDLTPYVENYAEVVFRNYQDARTQAAMMQVAITAFLDNPNETSHKAAQDAWVQARQSYL 104

Query: 83  QSEVYRFGNKIVDTWDKK---------VNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
           Q+E +RF    +D  D K         +NAWP++E FIDYV     KE  ++ L      
Sbjct: 105 QTEAFRFYEGPIDFVDAKTGEEGPEGRINAWPMNEAFIDYV-----KEKPDSGL------ 153

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN 193
                 +N  + ++SI +  ++      +  D  +TTG+H IEFLLWGQD   N   PG 
Sbjct: 154 ------INNPKFEISIAA--IMENDQVTDEAD--VTTGWHAIEFLLWGQDF--NNEGPGQ 201

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ--ATKDLMKDINAG 251
           R + DF I N       RR +YL +V++ LVSDL  +   W P+ +    K L  D  A 
Sbjct: 202 RSFEDF-IPNQNNND--RRRQYLTLVTEQLVSDLTFLETEWKPNAENYRAKFLKGDPKAT 258

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           +  I T + +LS  E+A ERM + L   + E E  CFSD TY  ++ +  GI + Y G+Y
Sbjct: 259 VGKIFTALATLSAFEMASERMTVALDSGNQEDEHSCFSDTTYQDFVFNAKGISNVYFGDY 318

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI-ESFDQMI--S 368
                    G    +L++  N +L Q+I    + T       ++ A  I + FDQ++  +
Sbjct: 319 A-----GYQGKGFDELLAQMNPDLNQKITAALTTT-------EESASQIDQPFDQVLASA 366

Query: 369 ENNPEGNKIVRNLINDLITQTESLRKI 395
           + +P+  + V  ++  L  Q E+ +++
Sbjct: 367 QGSPQRAE-VEAVVTALENQGEAFKEL 392


>gi|315637720|ref|ZP_07892923.1| imelysin superfamily protein [Arcobacter butzleri JV22]
 gi|315477999|gb|EFU68729.1| imelysin superfamily protein [Arcobacter butzleri JV22]
          Length = 451

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 130/429 (30%), Positives = 202/429 (47%), Gaps = 70/429 (16%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKV--------LQNYATIAHAKYEDALMCARTLDSAIETL 58
           +S+V +L   + +   N  ++KV        L+ YA IA   Y +AL  A+ L  AI+  
Sbjct: 12  VSVVASLALTSYAATNNNEVKKVEVAKQASILEAYANIALDNYTNALKDAKNLKVAIDKF 71

Query: 59  VTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT---W--------DKKVNAWPLD 107
              P ++N + A+  W+ +R  Y  +E++R  N  +D    W        + ++NAWPLD
Sbjct: 72  AKAPTQENFDAAKKAWLDSRESYGSTEIFRLSNGPIDAEEGWIADAYGALEGQINAWPLD 131

Query: 108 EGFIDYVDSSYGKENEENNLYTANIIANSKII----VNEKEIDLSIISPDLLRKLHRANG 163
           E  IDY   + GK      L + NII           + KE+D++ I+ D L  L+  NG
Sbjct: 132 ENMIDYTVDAEGK------LTSGNIIDTVGKFNPGGEDSKEVDVTKITVDALTDLNE-NG 184

Query: 164 IDTNITTGYHVIEFLLWGQD------LKTNVRE----PGNRPYTDFDIGNCTGGHCRRRV 213
            + N++TGYH IEFLLWGQD      +  NV +     G RP TDF     T  + +RR+
Sbjct: 185 GEANVSTGYHAIEFLLWGQDQDYANFMDDNVTKGPMTAGQRPLTDF----TTDKNSQRRL 240

Query: 214 EYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK----------------DINAGLNSIIT 257
            YLK  S+ LV DLE +  AW  + +  + L +                D    L  II 
Sbjct: 241 AYLKASSEKLVKDLETVTSAWKKEIKGNQGLYQAALLGKLKGKDKDKNIDQKEALKQIIA 300

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           GM     +ELA ER+ + ++    E E  CFSDNT+   + +  G  +  T  Y   NG+
Sbjct: 301 GMGVFIKSELANERIAVAVLTPSEEDEHSCFSDNTHRDLVKNYEGFKNVLTATY---NGK 357

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES-FDQMISENNPEGNK 376
           K +G S+ D +    +   +++       ++      DR    E+ FD  I  ++ E +K
Sbjct: 358 K-YGKSLFDAVDKETKERIEKLMSSIEEKIESV----DRIAKTEAHFDYQIRPDH-EQSK 411

Query: 377 IVRNLINDL 385
           ++  L N+L
Sbjct: 412 VLIKLKNEL 420


>gi|153823899|ref|ZP_01976566.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae B33]
 gi|126518577|gb|EAZ75800.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae B33]
          Length = 186

 Score =  162 bits (410), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 78/179 (43%), Positives = 114/179 (63%), Gaps = 7/179 (3%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           TI++ +    S + +  P  +  +V+++YA IA+A Y D+ + A+ L   I+  +  P  
Sbjct: 10  TILASLTLTTSASFAAAPTQA--QVVEHYADIAYAVYADSRVTAQQLQKTIDRFLQAPTA 67

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE--N 122
           + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E  N
Sbjct: 68  QGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHELGN 127

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
           E  N   ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 128 EGAN---ANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183


>gi|296271911|ref|YP_003654542.1| Peptidase M75, Imelysin [Arcobacter nitrofigilis DSM 7299]
 gi|296096086|gb|ADG92036.1| Peptidase M75, Imelysin [Arcobacter nitrofigilis DSM 7299]
          Length = 451

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 127/426 (29%), Positives = 197/426 (46%), Gaps = 68/426 (15%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEK---VLQNYATIAHAKYEDALMCARTLDSAIET 57
           +  +T I++         +  PN  + K   +L+ YA IA   Y +AL  A+ L+ AI  
Sbjct: 11  LSVVTAIALTGCATGTNAASTPNKEVVKSNTILEAYANIALDSYTNALNDAKALEKAINK 70

Query: 58  LVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT---W--------DKKVNAWPL 106
               P +K L+ A+  W+ +R  Y Q+E +R  N  +D    W        + ++NAWPL
Sbjct: 71  FAANPTEKTLQEAKDAWLTSRETYGQTESFRLSNGPIDAEEGWIAKDYGSLEGQINAWPL 130

Query: 107 DEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDT 166
           DE  IDY   + GK+   N + T           + K +D++ I+P+ + +L+  +G + 
Sbjct: 131 DENMIDYTIDANGKKTSGNIIDTVGKFNPGG--EDAKAVDVTKITPEAISELNE-DGGEA 187

Query: 167 NITTGYHVIEFLLWGQD------LKTNVRE----PGNRPYTDFDIGNCTGGHCRRRVEYL 216
           N+ +GYH +EFLLWGQD      LK ++       G RP +DF     +     RR+EYL
Sbjct: 188 NVASGYHAVEFLLWGQDQDYSNFLKDSITHGPLTAGQRPLSDF----TSSVDAPRRLEYL 243

Query: 217 KVVSKILVSDLEEMMKAWGPDGQATK--------DLMKDINA--------GLNSIITGMT 260
           K  S+ +VSDLE +  AW  +   TK        D +K  NA         L  II GM 
Sbjct: 244 KSASQKIVSDLEIVTSAWAKNLNGTKGLYRAAILDQLKGDNASKNISRNDALKQIIAGMG 303

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNT-------YASYLNDVIGIISSYTGEYIR 313
               +ELA ER+ + ++    E E  CFSDNT       Y S+ N    + S+Y G    
Sbjct: 304 VFMKSELANERIAVAVLTPSEEDEHSCFSDNTHRDIAMNYQSFKNI---LTSTYDG---- 356

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPE 373
               K +G S+ D +  + +    +I    S+  +   ++   A+  E FD  I   +P 
Sbjct: 357 ----KKYGPSLLDKVDGSAK---AKIEKLMSSIEEKIALIDKTAKTKEHFDYQIKPTSPM 409

Query: 374 GNKIVR 379
              IV+
Sbjct: 410 SKVIVK 415


>gi|118602702|ref|YP_903917.1| putative iron-regulated protein A [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
 gi|118567641|gb|ABL02446.1| imelysin, Metallo peptidase, MEROPS family M75 [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 435

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 165/347 (47%), Gaps = 55/347 (15%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +  + +ISI  T  S          +  +L  YA IA A Y DAL  A+TL   ++    
Sbjct: 13  LTVVMVISITSTFLSSE-------EVSPLLITYANIATANYTDALNDAKTLKEKLKYFTN 65

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT---W-------DKKVNAWPLDEGF 110
            P    +ENA+  W+ AR  Y Q E +R  N  +D    W       + ++NAWPLDE  
Sbjct: 66  RPTIVLMENAKAAWLNARESYGQIEAFRLSNGPIDAEEGWHTSYGAPEGQLNAWPLDENM 125

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKII----VNEKEIDLSIISPDLLRKLHRANGIDT 166
           IDY  ++ GK+       T NII    ++     N   ID+S I+P +L  L+  NG D 
Sbjct: 126 IDYTTNAKGKKT------TGNIIDTKGMLNLGGENPLAIDVSTITPSVLAALNE-NGGDA 178

Query: 167 NITTGYHVIEFLLWGQD------LKTNVRE----PGNRPYTDFDIGNCTGGHCRRRVEYL 216
           N+ TGYH IEFLLWGQD      +K  V       G R  +D+ I      +  RR +YL
Sbjct: 179 NVATGYHAIEFLLWGQDQDYTNFMKDGVTNGALVAGQRALSDYTI----NANADRRKQYL 234

Query: 217 KVVSKILVSDLEEMMKAWGPDGQAT----------KDLMKDINA--GLNSIITGMTSLSY 264
              + ++VSDLE M+ AW  DG +T           D+ K+I+    L  I +G+     
Sbjct: 235 NAAASLIVSDLESMVLAWA-DGDSTNYKAALLGKNSDVTKNIDTKVALKQIFSGLGVFIK 293

Query: 265 NELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           +ELA ER+ + ++    E E  CFSDNT+     +  G  +   G Y
Sbjct: 294 SELANERIAVAVLTPSEEDEHSCFSDNTHRDITQNFQGFKNLLFGTY 340


>gi|148244805|ref|YP_001219499.1| hypothetical protein COSY_0663 [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326632|dbj|BAF61775.1| conserved hypothetical protein [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 436

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 167/341 (48%), Gaps = 43/341 (12%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           F+  + IV +  S  LS      +  +L  YA IA   Y DAL  A+ L   ++     P
Sbjct: 12  FVLTVVIVISAASVFLS---GNEINPLLITYANIATINYTDALNDAKKLGIKLKDFTINP 68

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT---W-------DKKVNAWPLDEGFID 112
             + + NA+  W+ AR  Y Q+E +R  N  +D    W       + ++NAWPLDE  ID
Sbjct: 69  TIETMGNAKAAWLNARESYSQTEAFRLSNGPIDAEEGWHTSYGAPEGRLNAWPLDENMID 128

Query: 113 YVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGY 172
           Y  ++ G++   N + T +I        N   ID+SII+ D+L  L+  NG + N+TTGY
Sbjct: 129 YTTNAKGRKTSGNIIDTPDIFNPGG--ENPLVIDVSIITSDVLVALNE-NGGNANVTTGY 185

Query: 173 HVIEFLLWGQD------LKTNVRE----PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKI 222
           HVIEFLLWGQD      +K +V       G RP  D+ I      +  RR +YL   + +
Sbjct: 186 HVIEFLLWGQDQDYTNFIKDSVTHGALLAGQRPLADYTI----NVNADRRKQYLNAAASL 241

Query: 223 LVSDLEEMMKAWGPDGQAT----------KDLMKDIN--AGLNSIITGMTSLSYNELAGE 270
           ++SDLE +  AW  DG +T           D+ K+IN    L  I +G+     +ELA E
Sbjct: 242 IISDLESITSAWA-DGDSTNYKAALLGQNSDVTKNINVKVALKQIFSGLGIFIKSELANE 300

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           R+ + ++    E E  CFSDNT+     +  G  +   G Y
Sbjct: 301 RIAMAVLTPSEEDEHSCFSDNTHRDITQNFQGFKNLLFGTY 341


>gi|257486398|ref|ZP_05640439.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 234

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 104/164 (63%), Gaps = 1/164 (0%)

Query: 36  IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD 95
           +  A ++DA   A+ L + ++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+D
Sbjct: 67  MVSAVFDDAETGAKKLSTVVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTIID 126

Query: 96  TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLL 155
            W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L
Sbjct: 127 DWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKL 185

Query: 156 RKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
             L+   G + N+ TGYH IEFLLWGQDL       G RP +D+
Sbjct: 186 ASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDY 229


>gi|327403671|ref|YP_004344509.1| peptidase M75, Imelysin [Fluviicola taffensis DSM 16823]
 gi|327319179|gb|AEA43671.1| Peptidase M75, Imelysin [Fluviicola taffensis DSM 16823]
          Length = 394

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 110/347 (31%), Positives = 169/347 (48%), Gaps = 40/347 (11%)

Query: 33  YATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNK 92
           YA +A A Y+D+      L +A   L  +P++ NL+ A+  W+ AR  Y  SE++RF + 
Sbjct: 44  YAKMAFAVYKDSYTATVALQTACHALADSPSQANLDAAKDAWLDAREVYGLSEIFRFVDG 103

Query: 93  IVDTWDKK----VNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
            +D  +      +NAWP+DE ++DYV    G  N       + II +   +VN   ID S
Sbjct: 104 PIDNTNDGPEGLINAWPMDENYVDYV---LGDPN-------SGIIND---LVNYPTIDAS 150

Query: 149 IISPDLLRKLHRAN--GIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTG 206
            I         +AN  G +T I++GYH +EFLLWGQDL       G RPYTD+     T 
Sbjct: 151 TIV--------QANEVGGETKISSGYHAVEFLLWGQDLSNT--SAGQRPYTDYLTTGGTA 200

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAWGP--DGQATKDLMK-DINAGLNSIITGMTSLS 263
            +  RR  YLK V  +LVS L+++  AW P   G         D    L  +   M  L+
Sbjct: 201 LNQARRATYLKTVVDLLVSALDQVKDAWDPAITGSYCHTFQGLDNETALRKMFNSMRVLA 260

Query: 264 YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRM--NGEKIHG 321
            +ELAGER+ +       E E  CFSDNT+     + + + + Y G Y     +   ++G
Sbjct: 261 GDELAGERIYVAYENSSQEDEHSCFSDNTHRDIYLNALAVENLYKGTYTSTINSANSVNG 320

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
            ++ DL++  +      + ++F+ TM    ++       + FDQ I+
Sbjct: 321 YALEDLVNAIDAGKNSLLINRFATTMTRISMM------YQPFDQAIT 361


>gi|319778642|ref|YP_004129555.1| Iron-regulated protein A precursor [Taylorella equigenitalis MCE9]
 gi|317108666|gb|ADU91412.1| Iron-regulated protein A precursor [Taylorella equigenitalis MCE9]
          Length = 476

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 116/398 (29%), Positives = 184/398 (46%), Gaps = 59/398 (14%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
            L+NYA IA   Y DAL  A+TL  AI+     P ++ L+ A+  W+ +R  Y  +E  R
Sbjct: 65  ALENYANIAIKYYSDALKDAQTLQKAIKDFTANPTEETLKAAKDAWLMSRETYGLTEALR 124

Query: 89  FGNKIVDT---W--------DKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
             N  +D    W        + ++NAWPLDE  IDY   + G      N  + NII ++ 
Sbjct: 125 LSNGPIDAEEGWVAETYGNLESQINAWPLDEFMIDYTIDAKG------NRTSGNIIDSTG 178

Query: 138 IIV----NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD---------- 183
                  + KE+D++ I+P++L +L+  NG + N+ TGYH IEFLLWGQD          
Sbjct: 179 KFKPTGDDSKEVDITTITPEVLTELNE-NGGEANVATGYHAIEFLLWGQDQDYNSIVEDK 237

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
           + +     G RP TD+           RR +YL  V+  LV+DL+ ++ AW  +    K 
Sbjct: 238 IASGPMTAGQRPLTDY----TEDKFKDRRKDYLNAVTDKLVNDLQVLVNAWSTERDGAKG 293

Query: 244 LMK----------------DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDC 287
           L +                + +  +  I++G+     +ELA ER+ + ++    E E  C
Sbjct: 294 LYRQALLGELKGEEASKNIETDVAIKQILSGLGVFIKSELANERIAVAVLTPSEEDEHSC 353

Query: 288 FSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTM 347
           FSDNT+     +  G +    G+    NG K  G S +D +   N+     I+   ++  
Sbjct: 354 FSDNTHRDIDQNFKGWLDFLKGQ---TNG-KSTGVSFYDSLGKENK---ANIDKLIADVE 406

Query: 348 KDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           K    +   A+    FD  I  +N   NK + ++ N +
Sbjct: 407 KRIADMNAVAQKEMHFDYQILPSNEAYNKNIVSMKNQM 444


>gi|254423159|ref|ZP_05036877.1| hypothetical protein S7335_3313 [Synechococcus sp. PCC 7335]
 gi|196190648|gb|EDX85612.1| hypothetical protein S7335_3313 [Synechococcus sp. PCC 7335]
          Length = 410

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 117/415 (28%), Positives = 183/415 (44%), Gaps = 63/415 (15%)

Query: 8   SIVFTLPSHALSIVPNVS--------LEKVLQNYATIAHAKYEDALMCARTLDSAIETLV 59
           S+    P+ A ++ P           L   +++YA + +  Y  +   A  +  AI T +
Sbjct: 27  SVKAVTPTVAPTVAPAADPLLAQAGDLTPYIESYAELVYRTYRSSKADAVMMQRAIATFL 86

Query: 60  TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD---------KKVNAWPLDEGF 110
             PN    + A+  W  AR  Y Q+E +RF    +D  D          ++NAWP++E F
Sbjct: 87  DNPNVDTHQAAKAAWTEARQSYLQTEAFRFYEGPIDFIDLETGEEGPEGRINAWPMNEAF 146

Query: 111 IDYVD--SSYGKENEEN-NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTN 167
           IDYV   +  G  N+ +  + TAN++ N ++                          + +
Sbjct: 147 IDYVQGKADSGVINDPSFEISTANVLENDQV------------------------SDEAD 182

Query: 168 ITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDL 227
           +TTG+H IEFLLWGQD   N   PG R Y DF  G    G+  RR EYL +V+  L+ DL
Sbjct: 183 VTTGWHAIEFLLWGQDF--NADGPGQRSYEDFVAGK---GNNDRRREYLNLVTDQLIEDL 237

Query: 228 EEMMKAWGP--DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEI 285
             +   W P  D    + + +D    L  ++T + +LS  E+A ERM + L   D E E 
Sbjct: 238 TFLETEWQPGSDNYRAEFVAQDPQETLGKVLTSLATLSAFEMASERMAVSLDSGDQEDEH 297

Query: 286 DCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSN 345
            CFSD TY  ++ +  GI + Y  +Y         G  + +L++     L Q++      
Sbjct: 298 SCFSDTTYQDFVFNAAGIRNVYFADY-----GDYQGIGLDELLASVAPELNQQMIAALDQ 352

Query: 346 TMKDFHILKDRAENIESFDQ-MISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
           T          A+    FDQ ++S    E   +V + I  L  Q E + ++  AL
Sbjct: 353 TQTTI------AQISTPFDQVLVSPPGSEERAVVESAIVALEDQAELIVEVGSAL 401


>gi|126725744|ref|ZP_01741586.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2150]
 gi|126704948|gb|EBA04039.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2150]
          Length = 171

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 100/155 (64%), Gaps = 4/155 (2%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           +++   +I   L + AL+    V    VL  YA IA A Y D+L+ A+ L +A+  LV  
Sbjct: 3   HYLLTTAIAVGLATPALA----VETTDVLDTYADIAAANYGDSLITAQRLQTAVNALVAD 58

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ +NL  AR  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  
Sbjct: 59  PSAENLTAARAAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGP 118

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR 156
           ++EN     N+IAN    ++ ++ID + I+P LL 
Sbjct: 119 SDENAFAALNVIANPTFTLSGQDIDATSITPALLE 153


>gi|257486397|ref|ZP_05640438.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 212

 Score =  132 bits (333), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 113/205 (55%), Gaps = 5/205 (2%)

Query: 205 TGGHCRRRVEYLKVVSKILVSDLEEMMKAW----GPDGQATKDLMKDINAGLNSIITGMT 260
           TGGH  RR  YLK V+ +LVSDLEEM   W      + +AT +  +   +GL  ++ GM 
Sbjct: 1   TGGHNDRRRAYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLE-AESGESGLRKMLFGMG 59

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
           SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ 
Sbjct: 60  SLSLGELAGERMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVS 119

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
           G S+  L++  +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+
Sbjct: 120 GPSLSSLVAKVDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRD 179

Query: 381 LINDLITQTESLRKIRIALDLIEPN 405
            I  L+ QT ++ +    L + + N
Sbjct: 180 AIAALVKQTGAIEQAAGKLGITDLN 204


>gi|330721294|gb|EGG99379.1| Iron-regulated protein A precursor [gamma proteobacterium IMCC2047]
          Length = 161

 Score =  109 bits (272), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 95/155 (61%), Gaps = 4/155 (2%)

Query: 255 IITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRM 314
           ++ GM SL+  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y G Y R+
Sbjct: 1   MLFGMGSLALGELAGERMKVALEANSAEDEHDCFSDNTHFSHFYNAQGIRNVYFGSYSRV 60

Query: 315 NGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE--NIESFDQMISENNP 372
           +G ++ G S+ +L++  +++ A +    F  T     ++ DRAE  N   FDQMI+E N 
Sbjct: 61  DGSELTGPSLAELVAAKSKDAAAQAQAAFDKTSTSLQVMVDRAEAKNGMKFDQMIAEGNA 120

Query: 373 EGNKIVRNLINDLITQTESLRKIRIALDL--IEPN 405
           EG +I+RN I  L+ +T+++ ++   +D+  ++P+
Sbjct: 121 EGEEIIRNAIVALVEETQAIERVAQVIDVSNLQPD 155


>gi|153824178|ref|ZP_01976845.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae B33]
 gi|126518300|gb|EAZ75525.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae B33]
          Length = 193

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 101/187 (54%), Gaps = 6/187 (3%)

Query: 225 SDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDP 281
           +DLE M K W     D    + L +    GL  ++ GM SLS  ELAGERM + L  +  
Sbjct: 1   TDLEWMEKQWASGEKDNYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANST 60

Query: 282 EQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEIND 341
           E E DCFSDNT+ S+  +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  
Sbjct: 61  EDEHDCFSDNTHNSHYYNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQ 120

Query: 342 KFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IA 398
           +F         L   AE N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    I 
Sbjct: 121 QFEAARTQVGELVTAAEKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIG 180

Query: 399 LDLIEPN 405
           +D + P+
Sbjct: 181 IDNLNPD 187


>gi|313106900|ref|ZP_07793103.1| Insulin-cleaving metalloproteinase outer membrane [Pseudomonas
           aeruginosa 39016]
 gi|310879605|gb|EFQ38199.1| Insulin-cleaving metalloproteinase outer membrane [Pseudomonas
           aeruginosa 39016]
          Length = 188

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 89/161 (55%), Gaps = 3/161 (1%)

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSY 307
           ++ GL  +  GM SLS  ELAGERM + L  +  E E DCFSD+T+ +   +   I + Y
Sbjct: 22  VDTGLRKMFFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDDTHHTLFFNGKSIRNIY 81

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQM 366
            GEY R++G  + G S+ DL++  +      +    ++T      + D AE +   FDQM
Sbjct: 82  LGEYKRIDGSVVKGPSLADLVAKADAAANDTLKADLADTEAKLQAIVDSAEKDGVHFDQM 141

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKI--RIALDLIEPN 405
           I+ +N +G + +R+ I  L+ QT ++ +   ++ +  ++P+
Sbjct: 142 IAPDNKDGQQKIRDAIAALVKQTGAIEQAAGKLGIQDLKPD 182


>gi|289677764|ref|ZP_06498654.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae FF5]
          Length = 148

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 75/140 (53%)

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+ 
Sbjct: 1   ERAGERMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLS 60

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
            L++  +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L
Sbjct: 61  SLVAKADPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAAL 120

Query: 386 ITQTESLRKIRIALDLIEPN 405
           + QT ++ +    L + + N
Sbjct: 121 VKQTGAIEQAAGKLGITDLN 140


>gi|24216168|ref|NP_713649.1| hypothetical protein LA_3469 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|24197416|gb|AAN50667.1| putative lipoprotein [Leptospira interrogans serovar Lai str.
           56601]
          Length = 440

 Score = 87.8 bits (216), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 125/311 (40%), Gaps = 42/311 (13%)

Query: 22  PNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ--WIRARI 79
           P  +  +V+  Y  + +  Y+ +   A    +A+       N    ++  L+  ++ AR 
Sbjct: 43  PTATRAQVVDRYLQLGYESYDQSYKDAVAFQTAVTAFAANNNPTAADHINLKNLYVVARA 102

Query: 80  PYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFIDYVDSSYGKEN 122
            Y  +E +RF +  +D  D                   +N WPLDE  ID    +Y   N
Sbjct: 103 SYLTTEAFRFSSGPIDNVDILGCGSNADGSGDEECEGLINGWPLDESAID----NYINNN 158

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
               +  AN+              L++            +  +T +T G+H IE++LWGQ
Sbjct: 159 NAAQMTYANV--------------LAVNGNAGANGGANDDDDETALTVGWHAIEYILWGQ 204

Query: 183 DL-KTNVRE-PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           DL    V +  G R   D      T GH RR   Y+K V+  LV  L+ +   +    + 
Sbjct: 205 DLFNGGVNQISGQRTVADLSGAAGTDGHKRR--TYMKAVTDGLVLQLKLIRDQFEDGARY 262

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
           +  L  + +A +  I  G+      E  GER+  G      E+E  CFSD T A +  + 
Sbjct: 263 SDGLKSNPDAAVTYIFQGLGKFIAGEWGGERLT-GTFGGQQEEEHSCFSDTTKADFYYNA 321

Query: 301 IGIISSYTGEY 311
             +++ + G Y
Sbjct: 322 QSVLNIWNGSY 332


>gi|45656611|ref|YP_000697.1| putative lipoprotein [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
 gi|45599846|gb|AAS69334.1| putative lipoprotein [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
          Length = 440

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/312 (23%), Positives = 128/312 (41%), Gaps = 44/312 (14%)

Query: 22  PNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ--WIRARI 79
           P  +  +V+  Y  + +  Y+ +   A    +A+       N    ++  L+  ++ AR 
Sbjct: 43  PTATRAQVVDRYLQLGYESYDQSYKDAVAFQTAVTAFAANNNPTAADHINLKNLYVVARA 102

Query: 80  PYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFID-YVDSSYGKE 121
            Y  +E +RF +  +D  D                   +N WPLDE  ID Y++++  ++
Sbjct: 103 SYLTTEAFRFSSGPIDNVDILGCGSNADGSGDEECEGLINGWPLDESAIDNYINNNAAQQ 162

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
                +  AN  A +   V++ +                    +T +T G+H IE++LWG
Sbjct: 163 PTYAAILAANGDAGANNAVDQDD--------------------ETALTVGWHAIEYILWG 202

Query: 182 QDLKTNV--REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           QDL      +  G R   D   G   G    RR  Y+K V+  LV  L+ +   +    +
Sbjct: 203 QDLFNGGINQISGQRNIADL-TGASPGTVGGRRRTYMKAVTDGLVLQLKLIRDQFEDGAR 261

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
            +  L  + +A +  I  G+      E  GER+  G      E+E  CFSD T A +  +
Sbjct: 262 YSDGLKSNPDAAVTYIFQGLGKFIAGEWGGERLT-GTFGGQQEEEHSCFSDTTKADFYYN 320

Query: 300 VIGIISSYTGEY 311
              +++ + G Y
Sbjct: 321 AQSVLNIWNGSY 332


>gi|62184293|gb|AAW65730.1| LruB [Leptospira interrogans serovar Pomona]
          Length = 439

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 123/311 (39%), Gaps = 43/311 (13%)

Query: 22  PNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ--WIRARI 79
           P  +  +V+  Y  + +  Y+ +   A    +A+       N    ++  L+  ++ AR 
Sbjct: 43  PTATRAQVVDRYLQLGYESYDQSYKDAVAFQTAVTAFAANNNPTAADHINLKNLYVVARA 102

Query: 80  PYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFIDYVDSSYGKEN 122
            Y  +E +RF +  +D  D                   +N WPLDE  ID   ++ G   
Sbjct: 103 SYLTTEAFRFSSGPIDNVDILGCGSNADGSGDEECEGLINGWPLDESAIDNYIANAGNAT 162

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
               +   N  AN+    ++ +                    +T +T G+H IE++LWGQ
Sbjct: 163 TYAAILATNGDANANNADDQDD--------------------ETALTVGWHAIEYILWGQ 202

Query: 183 DLKTNV--REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           DL      +  G R   D   G   G    RR  Y+K V+  LV  L+ +   +    + 
Sbjct: 203 DLFNGGINQISGQRNIADL-TGASPGTVGGRRRAYMKAVTDGLVLQLKLIRDQFEDGARY 261

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
           +  L  + +A +  I  G+      E  GER+  G      E+E  CFSD T A +  + 
Sbjct: 262 SDGLKSNPDAAVTYIFQGLGKFIAGEWGGERLT-GTFGGQQEEEHSCFSDTTKADFYYNA 320

Query: 301 IGIISSYTGEY 311
             +++ + G Y
Sbjct: 321 QSVLNIWNGSY 331


>gi|116331852|ref|YP_801570.1| Iron-regulated lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116125541|gb|ABJ76812.1| Iron-regulated lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 438

 Score = 83.2 bits (204), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 85/317 (26%), Positives = 135/317 (42%), Gaps = 46/317 (14%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ--W 74
           A+ + P  +  +V+  Y  + +  Y+ +   A  L +A+       N    ++A L+  +
Sbjct: 38  AVGLQPTATKAQVVDRYLRLGYESYDQSYKDAVNLQTAVTAFAANANPSAADHANLKNLY 97

Query: 75  IRARIPYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFIDYVDSS 117
           I AR  Y  +E +RF +  +D  D                   +N+WPLDE  ID   ++
Sbjct: 98  IIARASYLVTEAFRFSSGPIDNVDVLGCGSNADGSGEEECEGLINSWPLDESAIDNYVAA 157

Query: 118 YGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEF 177
            G +      Y A + AN     N   ID                  +T IT G+H IE+
Sbjct: 158 AGAQTT----YAAILAANGNAEANNGAID---------------GDDETAITVGWHAIEY 198

Query: 178 LLWGQDLKT-NVRE-PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG 235
           +LWGQDL    V E  G R   +    N    +  RR  Y+K V+  LV  L  +++   
Sbjct: 199 ILWGQDLSNGGVNEIAGQRTANELANANA---NGARRRAYMKAVTDGLVLQL-GLIRDQF 254

Query: 236 PDGQATKDLMK-DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYA 294
            DG    D +K + NA + +I  G+      E  GER+  G      E+E  CFSD T A
Sbjct: 255 ADGSRYSDALKSNPNAAITAIFQGLGKFIAGEWGGERLT-GTFDGQQEEEHSCFSDTTKA 313

Query: 295 SYLNDVIGIISSYTGEY 311
            +  +   +++ ++G Y
Sbjct: 314 DFYYNAQSVLNIWSGSY 330


>gi|116327535|ref|YP_797255.1| Iron-regulated lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116120279|gb|ABJ78322.1| Iron-regulated lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 438

 Score = 83.2 bits (204), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 86/317 (27%), Positives = 136/317 (42%), Gaps = 46/317 (14%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ--W 74
           A+ + P  +  +V+  Y  + +  Y+ +   A  L +A+       N    ++A L+  +
Sbjct: 38  AVGLQPTATKAQVVDRYLRLGYESYDQSYKDAVNLQTAVTAFAANANPSAADHANLKNLY 97

Query: 75  IRARIPYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFIDYVDSS 117
           I AR  Y  +E +RF +  +D  D                   +N+WPLDE  ID   ++
Sbjct: 98  IIARASYLVTEAFRFSSGPIDNVDVLGCGSNADGSGEEECEGLINSWPLDESAIDNYVAA 157

Query: 118 YGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEF 177
            G +      Y A + AN     N   ID                  +T IT G+H IE+
Sbjct: 158 AGAQTT----YAAILAANGNAEANNGAID---------------GDDETAITVGWHAIEY 198

Query: 178 LLWGQDLKT-NVRE-PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG 235
           +LWGQDL    V E  G R   +F   N    +  RR  Y+K V+  LV  L  +++   
Sbjct: 199 ILWGQDLSNGGVNEIAGQRTANEFANANA---NGARRRAYMKAVTDGLVLQL-GLIRDQF 254

Query: 236 PDGQATKDLMK-DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYA 294
            DG    D +K + NA + +I  G+      E  GER+  G      E+E  CFSD T A
Sbjct: 255 ADGSRYSDALKSNPNAAITAIFQGLGKFIAGEWGGERLT-GTFDGQQEEEHSCFSDTTKA 313

Query: 295 SYLNDVIGIISSYTGEY 311
            +  +   +++ ++G Y
Sbjct: 314 DFYYNAQSVLNIWSGSY 330


>gi|113953796|ref|YP_730707.1| Iron-regulated protein A precursor [Synechococcus sp. CC9311]
 gi|113881147|gb|ABI46105.1| Iron-regulated protein A precursor, putative [Synechococcus sp.
           CC9311]
          Length = 335

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 72/322 (22%), Positives = 138/322 (42%), Gaps = 64/322 (19%)

Query: 41  YEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKK 100
           Y+  +   + L+ A++ LV  PN  NL+ AR +W ++R  ++ +E + +G    + +D K
Sbjct: 50  YKKLVSGTKKLNQALQVLVKDPNPANLKLARDEWKKSRNTWEVTETWAYGPAETEDFDPK 109

Query: 101 VNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHR 160
           ++ WP                                  V++KE+  ++   D  +   +
Sbjct: 110 LDDWP----------------------------------VSDKELAEALSEKDFTK--EK 133

Query: 161 ANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVS 220
            N +DT    G+H IE++++G          G+ P    D+         +++ YL++  
Sbjct: 134 FNALDT-TGRGFHGIEYVIFGN---------GDTPVEASDL-------TTQQLAYLRIAG 176

Query: 221 KILVSDLEEMMKAW-GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILH 279
           + L S+ ++++ AW GP+G    D+  D    +N I+ GM     +E++  ++   L   
Sbjct: 177 ENLKSNAKQLLAAWSGPEGFGKADVEADPAKTVNDILEGMAGC-LDEVSNTKLGEALASG 235

Query: 280 DPEQEIDCFSDNTYASYLNDVIGII----SSYTGEYIRMNGEKIHGASIHDLIS--HNNR 333
             E E   FS NT A  L+++ G+      S   EY +    ++      +L +     +
Sbjct: 236 KGELE-STFSGNTGADVLSNLQGVQLAWEKSKIQEYAKTKDAELSNQLTVELQTALAQAK 294

Query: 334 NLAQEINDKFSN--TMKDFHIL 353
            L   +NDK  N  T K   +L
Sbjct: 295 ELPTRLNDKLDNGDTQKQVKML 316


>gi|115380169|ref|ZP_01467199.1| iron-regulated protein A [Stigmatella aurantiaca DW4/3-1]
 gi|310820630|ref|YP_003952988.1| iron-regulated protein a [Stigmatella aurantiaca DW4/3-1]
 gi|115362826|gb|EAU62031.1| iron-regulated protein A [Stigmatella aurantiaca DW4/3-1]
 gi|309393702|gb|ADO71161.1| Iron-regulated protein A [Stigmatella aurantiaca DW4/3-1]
          Length = 366

 Score = 70.5 bits (171), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 71/322 (22%), Positives = 126/322 (39%), Gaps = 77/322 (23%)

Query: 46  MCAR--TLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNA 103
           + AR   LD+A   L  +P+ + L  AR  W  AR+P++QSE + FG      +D  +++
Sbjct: 55  LAARLEALDTASNALAASPSAERLTAARDAWFAARVPWEQSEGFLFGPVDSFGYDPAMDS 114

Query: 104 WPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANG 163
           WP++   +D V +        N  +T   + N +  +                       
Sbjct: 115 WPVNRSDLDAVLAG-------NAPFTPEYVGNLEETLK---------------------- 145

Query: 164 IDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKIL 223
                  G+H +E+LL+ +D  T       +   DF           R  EYLK ++  L
Sbjct: 146 -------GFHTVEYLLFARDPSTGAE----KTVQDF---------TPREFEYLKAITLQL 185

Query: 224 VSDLEEMMKAWGP--DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLI---- 277
            +    +  AW    DG+      +++ AG     +G TS    + AGE M  G++    
Sbjct: 186 KNIGAALSNAWTQTVDGRPP---YRNVFAGAGD--SGNTSYPSVQTAGEEMVGGIVNILD 240

Query: 278 ------------LHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
                         DPE     F+ N+ + + N++  + ++Y G    + G    G S+ 
Sbjct: 241 EVANGKIADPYDAKDPELVESQFAYNSLSDFSNNIRSVQNAYLG---HLPGATAKGPSLA 297

Query: 326 DLISHNNRNLAQEINDKFSNTM 347
           D +   N  L   I  + ++ +
Sbjct: 298 DFVKDANPELDTRIRQELTDAI 319


>gi|42522171|ref|NP_967551.1| Iron-regulated protein A precursor [Bdellovibrio bacteriovorus
           HD100]
 gi|39574702|emb|CAE78544.1| Iron-regulated protein A precursor [Bdellovibrio bacteriovorus
           HD100]
          Length = 361

 Score = 69.7 bits (169), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 126/302 (41%), Gaps = 72/302 (23%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A Y D       L +A++ L  + N++NL+ A+  W  ARIP++ SE + FG       D
Sbjct: 37  ATYNDLATKTAELSAAVDALAASTNQENLDKAQAAWRAARIPWESSESFLFGPVDSLGID 96

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
             ++ WPL++  +D V SS                 N KI V            DL+R L
Sbjct: 97  PLLDTWPLNKLDLDSVMSS-----------------NRKITV------------DLVRAL 127

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKV 218
                  TN+  G+H +E+LL+G    +N +   +                 +++EYLK 
Sbjct: 128 ------GTNL-QGFHTLEYLLFGDGKVSNTKPAASL--------------TAKQLEYLKA 166

Query: 219 VSKILVSDLEEMMKAWG----PDGQATKDLMKDINA-GLNS------------IITGMTS 261
            +++L     E+  AW     P+  A    +K I+  GLN+             + GM  
Sbjct: 167 SAQLLAEHTAELAHAWTTNYDPENPAAPGYVKVISTPGLNNEFYSSERAVMEEFVQGMMG 226

Query: 262 LSYNELAGERMN--LGLILHDPEQEI--DCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           +  +E+A  +M+  +G  +      +    F+ N+   + +++  + S YTG Y    G 
Sbjct: 227 I-VDEVANGKMSDPMGADIGSANMALVESPFAWNSLKDFQHNIRSVYSIYTGHYKNNKGP 285

Query: 318 KI 319
            +
Sbjct: 286 GV 287


>gi|94499739|ref|ZP_01306275.1| hypothetical protein RED65_14497 [Oceanobacter sp. RED65]
 gi|94427940|gb|EAT12914.1| hypothetical protein RED65_14497 [Oceanobacter sp. RED65]
          Length = 433

 Score = 63.5 bits (153), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 118/289 (40%), Gaps = 82/289 (28%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA------ 77
           V+ E++L       + +  DAL  A+TLDS I +L+  PN  +LE ++  W +A      
Sbjct: 42  VNSEQLLSAMNLYVYTQLSDALNKAQTLDSEITSLLHHPNPVSLEQSQNAWQQAYEGYVK 101

Query: 78  -----RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
                R+P  +   Y   N+  D   +++++WP++ G+IDY+                  
Sbjct: 102 VSFLHRVPRFEKPQYYENNRTYDDIRQRIDSWPIEPGYIDYL------------------ 143

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTN-------ITTGYHVIEFLLWGQDLK 185
                      +  LS I  DL  K+   N +D +        + G+H +EFLL+ ++ +
Sbjct: 144 ----------PQYPLSGIVNDLTLKISLDNLVDQHGFSDPRYASIGFHPLEFLLFAENSE 193

Query: 186 TNVR--------------EP----------GNRPYTDFDIG---------NCTGGHCRRR 212
            + +              EP           +  + D DI          N    H RRR
Sbjct: 194 RSAKDFIPQENSMEVVATEPEIQAETQAINSDAEHVDSDIKDIRHAQPVINGPQNHNRRR 253

Query: 213 VEYLKVVSKILVSDLEEMMKAWGP-DGQATKDLMK-DINAGLNSIITGM 259
            +YL+++S  LV  L+ +   W P +G   K   + D  A + S+  G+
Sbjct: 254 -DYLRILSADLVKQLQALTDRWDPANGYYAKQWRQPDHAANVASLYQGL 301


>gi|297567103|ref|YP_003686075.1| peptidase M75, Imelysin [Meiothermus silvanus DSM 9946]
 gi|296851552|gb|ADH64567.1| Peptidase M75, Imelysin [Meiothermus silvanus DSM 9946]
          Length = 425

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 111/273 (40%), Gaps = 60/273 (21%)

Query: 41  YEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKK 100
           Y + L   + L+ A  +L   P   NLE AR  W  ARIPY+++E + FG   +  +D  
Sbjct: 35  YTELLARLKGLEGAARSLKAKPTPANLEAARTAWRAARIPYERAEGFAFGP--IGDYDPL 92

Query: 101 VNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHR 160
           ++ WP+D            +E  E  L  +  ++ +       E+               
Sbjct: 93  LDTWPID------------REGLEALLKGSQPLSAADFAKLPSEV--------------- 125

Query: 161 ANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVS 220
                     G+H +E+LLWG  LK   +    RP               R ++Y+++ S
Sbjct: 126 ---------RGFHAVEYLLWG--LKGQKKAAQLRP---------------RELQYIELAS 159

Query: 221 KILVSDLEEMMKAW--GPDGQATK--DLMKDINAGLNSIITGMTSLSYNELAGERMNLGL 276
             +V   +  + AW  G   + T+  DL K   A L+ II G+  +   E+A E++   L
Sbjct: 160 ADMVRQAKANLTAWQQGFYARFTRPSDLYKSEAAALDEIIGGLVGI-IAEIADEKLGNPL 218

Query: 277 ILHDPEQEIDCFSDNTYASYLNDVIGIISSYTG 309
             +DP      FS N+   Y  D+ G    Y G
Sbjct: 219 QANDPLVAESPFSGNSLEDYRQDLEGARRYYLG 251


>gi|127511610|ref|YP_001092807.1| putative lipoprotein [Shewanella loihica PV-4]
 gi|126636905|gb|ABO22548.1| putative lipoprotein [Shewanella loihica PV-4]
          Length = 382

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 87/402 (21%), Positives = 154/402 (38%), Gaps = 87/402 (21%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
           F+  + AL  + N+S E +++ Y+T+A             L  A +TLV TP + NLE A
Sbjct: 37  FSFDADAL--IVNLSDEVIVKGYSTLADR--------GEALLQATQTLVATPTQANLEAA 86

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           +  W  AR P++Q E + FG       D  +++WPL                        
Sbjct: 87  QSAWKAARQPWEQGESHIFGPVDSLGIDPHLDSWPL------------------------ 122

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
           N      +++N    D   I            G + ++  G+H +EFLL+G  +  NV++
Sbjct: 123 NTTDLKTVLINSSGFDAETI-----------KGWNDDV-QGFHTMEFLLFGDGMDDNVKQ 170

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-----GPDGQATKDLM 245
                     I   T        +YL  ++++     +++  AW     G  G+A  +L+
Sbjct: 171 ----------IDELTA----NERDYLMGLAEVFRDYTKQLADAWLVSHDGQSGKAYGELL 216

Query: 246 KDINAGLNS-----------IITGMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDN 291
           K      N+           +I GM  +     N    +     L   D  +    +S N
Sbjct: 217 KSPGVDGNTFYSSQVGVLEELIKGMIGIVDEVGNGKIADPFGGSLASADTSKVESQYSWN 276

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH 351
           +   + +++IG+ + Y GE+    GE      I D +   +  LA  I  +    +   H
Sbjct: 277 SLTDFSDNIIGVRNVYQGEF---TGEA-DKQGIIDFVRAADSELASRIAAEIDAAILQIH 332

Query: 352 ILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR 393
            ++    +   F Q I +    G   ++  ++ L T   SL 
Sbjct: 333 AIE--GTDKMPFRQAIKDE--AGRARIQKAVDALATLQASLE 370


>gi|86607223|ref|YP_475986.1| iron-regulated protein A [Synechococcus sp. JA-3-3Ab]
 gi|86555765|gb|ABD00723.1| putative iron-regulated protein A [Synechococcus sp. JA-3-3Ab]
          Length = 410

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 89/222 (40%), Gaps = 54/222 (24%)

Query: 14  PSHALSIVPNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           P+  LS        ++L ++A  +    YE  +   + L  AI+  V  PN + L+ AR 
Sbjct: 76  PAVVLSPEQRFQDRQILLDFADQVVIPAYEQLVADTQALSQAIQAFVQDPNAQTLQAARQ 135

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W  ARI +++SE + FG       D  ++ WPL+E  ++ ++                 
Sbjct: 136 AWSVARITWEESEAFAFGPAAYLGLDADLDEWPLNE--VEVLE----------------- 176

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
                 ++N  +     ++P+ + +L            G+H + FLL+G D         
Sbjct: 177 ------VLNSGD----PLTPETVAELESGQ-------KGFHAVAFLLFGVD--------N 211

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW 234
           N+   DF           R  EYL  +  +L     +++K+W
Sbjct: 212 NKSLQDF---------TERDREYLAALGPVLADTAAKLLKSW 244


>gi|86609711|ref|YP_478473.1| iron-regulated protein A [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558253|gb|ABD03210.1| putative iron-regulated protein A [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 410

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 89/222 (40%), Gaps = 54/222 (24%)

Query: 14  PSHALSIVPNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           P+  LS        ++L ++A  +    YE  +   + L  AI+  V  PN + L+ AR 
Sbjct: 76  PAVVLSPEQRFQDRQILLDFADQVVIPAYEQLVADTQALSQAIQAFVQDPNAQTLQAARQ 135

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W  ARI +++SE + FG       D  ++ WPL+E  ++ ++                 
Sbjct: 136 AWSVARITWEESEAFAFGPAAYLGLDADLDEWPLNE--VEVLE----------------- 176

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
                 ++N  +     ++P+ + +L            G+H + FLL+G D         
Sbjct: 177 ------VLNSGD----PLTPETVAELESGQ-------KGFHAVAFLLFGVD--------N 211

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW 234
           N+   DF           R  EYL  +  +L     +++K+W
Sbjct: 212 NKSLQDF---------TERDREYLAALGPVLADTAAKLLKSW 244


>gi|121729966|ref|ZP_01682385.1| iron-regulated protein A, putative [Vibrio cholerae V52]
 gi|121628287|gb|EAX60798.1| iron-regulated protein A, putative [Vibrio cholerae V52]
          Length = 109

 Score = 56.6 bits (135), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 33/102 (32%), Positives = 55/102 (53%), Gaps = 3/102 (2%)

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQ 365
           YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   AE N + FDQ
Sbjct: 2   YTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAEKNNQHFDQ 61

Query: 366 MISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPN 405
           +I+ +N  G+ I+   I  L+ QT S+ +    I +D + P+
Sbjct: 62  LIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPD 103


>gi|262384087|ref|ZP_06077223.1| iron-regulated protein A [Bacteroides sp. 2_1_33B]
 gi|262294985|gb|EEY82917.1| iron-regulated protein A [Bacteroides sp. 2_1_33B]
          Length = 392

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 85/201 (42%), Gaps = 50/201 (24%)

Query: 36  IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD 95
           +A   Y+D L       +A++  + + +K +L +A   W   R+P++QSE + FG   + 
Sbjct: 54  VALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADACDAWRAVRVPWEQSEAFLFGVADLA 113

Query: 96  TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI--IVNEKEIDLSIISPD 153
             D  +++WPLD+  I+ +            + T      SKI   V+E   D     P 
Sbjct: 114 QLDPSLDSWPLDKNGIEEI------------IATGEF---SKISGAVDEDAED----GPQ 154

Query: 154 LLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRV 213
            LR              G+H  E +L+   L    R+    P+             +  +
Sbjct: 155 NLR--------------GFHTAEKMLF---LDGEPRDLETSPF------------AKNEL 185

Query: 214 EYLKVVSKILVSDLEEMMKAW 234
           EYLK+VS+ ++SD +++   W
Sbjct: 186 EYLKLVSERMLSDTQDLYNGW 206


>gi|150009201|ref|YP_001303944.1| putative iron-regulated protein A [Parabacteroides distasonis ATCC
           8503]
 gi|298377011|ref|ZP_06986965.1| imelysin superfamily protein [Bacteroides sp. 3_1_19]
 gi|149937625|gb|ABR44322.1| putative iron-regulated protein A precursor [Parabacteroides
           distasonis ATCC 8503]
 gi|298265995|gb|EFI07654.1| imelysin superfamily protein [Bacteroides sp. 3_1_19]
          Length = 403

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 85/201 (42%), Gaps = 50/201 (24%)

Query: 36  IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD 95
           +A   Y+D L       +A++  + + +K +L +A   W   R+P++QSE + FG   + 
Sbjct: 65  VALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADACDAWRAVRVPWEQSEAFLFGVADLA 124

Query: 96  TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI--IVNEKEIDLSIISPD 153
             D  +++WPLD+  I+ +            + T      SKI   V+E   D     P 
Sbjct: 125 QLDPSLDSWPLDKNGIEEI------------IATGEF---SKISGAVDEDAED----GPQ 165

Query: 154 LLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRV 213
            LR              G+H  E +L+   L    R+    P+             +  +
Sbjct: 166 NLR--------------GFHTAEKMLF---LDGEPRDLETSPF------------AKNEL 196

Query: 214 EYLKVVSKILVSDLEEMMKAW 234
           EYLK+VS+ ++SD +++   W
Sbjct: 197 EYLKLVSERMLSDTQDLYNGW 217


>gi|301310995|ref|ZP_07216924.1| imelysin superfamily [Bacteroides sp. 20_3]
 gi|300831058|gb|EFK61699.1| imelysin superfamily [Bacteroides sp. 20_3]
          Length = 403

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 85/201 (42%), Gaps = 50/201 (24%)

Query: 36  IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD 95
           +A   Y+D L       +A++  + + +K +L +A   W   R+P++QSE + FG   + 
Sbjct: 65  VALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADACDAWRAVRVPWEQSEAFLFGVADLA 124

Query: 96  TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI--IVNEKEIDLSIISPD 153
             D  +++WPLD+  I+ +            + T      SKI   V+E   D     P 
Sbjct: 125 QLDPSLDSWPLDKNGIEEI------------IATGEF---SKISGAVDEDAED----GPQ 165

Query: 154 LLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRV 213
            LR              G+H  E +L+   L    R+    P+             +  +
Sbjct: 166 NLR--------------GFHTAEKMLF---LDGEPRDLETSPF------------AKNEL 196

Query: 214 EYLKVVSKILVSDLEEMMKAW 234
           EYLK+VS+ ++SD +++   W
Sbjct: 197 EYLKLVSERMLSDTQDLYNGW 217


>gi|256841757|ref|ZP_05547263.1| iron-regulated protein A [Parabacteroides sp. D13]
 gi|256736651|gb|EEU49979.1| iron-regulated protein A [Parabacteroides sp. D13]
          Length = 403

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 85/204 (41%), Gaps = 56/204 (27%)

Query: 36  IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD 95
           +A   Y+D L       +A++  + + +K +L +A   W   R+P++QSE + FG   + 
Sbjct: 65  VALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADACDAWRAVRVPWEQSEAFLFGVADLA 124

Query: 96  TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN---SKI--IVNEKEIDLSII 150
             D  +++WPLD+  I+                   IIA    SKI   V+E   D    
Sbjct: 125 QLDPSLDSWPLDKNGIE------------------EIIATGEFSKISGAVDEDAED---- 162

Query: 151 SPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCR 210
            P  LR              G+H  E +L+   L    R+    P+             +
Sbjct: 163 GPQNLR--------------GFHTAEKMLF---LDGEPRDLETSPF------------AK 193

Query: 211 RRVEYLKVVSKILVSDLEEMMKAW 234
             +EYLK+VS+ ++SD +++   W
Sbjct: 194 NELEYLKLVSERMLSDTQDLYNGW 217


>gi|255015808|ref|ZP_05287934.1| putative iron-regulated protein A precursor [Bacteroides sp. 2_1_7]
          Length = 395

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 85/204 (41%), Gaps = 56/204 (27%)

Query: 36  IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD 95
           +A   Y+D L       +A++  + + +K +L +A   W   R+P++QSE + FG   + 
Sbjct: 57  VALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADACDAWRAVRVPWEQSEAFLFGVADLA 116

Query: 96  TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN---SKI--IVNEKEIDLSII 150
             D  +++WPLD+  I+                   IIA    SKI   V+E   D    
Sbjct: 117 QLDPSLDSWPLDKNGIE------------------EIIATGEFSKISGAVDEDAED---- 154

Query: 151 SPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCR 210
            P  LR              G+H  E +L+   L    R+    P+             +
Sbjct: 155 GPQNLR--------------GFHTAEKMLF---LDGEPRDLETSPF------------AK 185

Query: 211 RRVEYLKVVSKILVSDLEEMMKAW 234
             +EYLK+VS+ ++SD +++   W
Sbjct: 186 NELEYLKLVSERMLSDTQDLYNGW 209


>gi|212636778|ref|YP_002313303.1| iron-regulated protein A [Shewanella piezotolerans WP3]
 gi|212558262|gb|ACJ30716.1| Iron-regulated protein A precursor [Shewanella piezotolerans WP3]
          Length = 382

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 85/394 (21%), Positives = 147/394 (37%), Gaps = 110/394 (27%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A Y D       +  A +TLV TP + NLE A+  W  AR P++Q E + FG       D
Sbjct: 55  AGYNDLADEGEAMLLATQTLVATPTQANLEAAQDAWKAARQPWEQGESHIFGPVDSMGID 114

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
             +++WPL+                                     IDL+ +       L
Sbjct: 115 PHLDSWPLN------------------------------------TIDLTTV-------L 131

Query: 159 HRANGIDTNI-------TTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRR 211
               G D            G+H +E+LL+G  +  N +           I   T      
Sbjct: 132 STTTGFDAETIKSWNDDVQGFHTMEYLLFGDGVADNTKA----------IAELTA----N 177

Query: 212 RVEYLKVVSKILVSDLEEMMKAW-----GPDGQATKDLMKDINAGLNSIITGMTSLSYNE 266
             +YL  ++++     +++  AW        G+A  +L+K  N G +    G T  S N 
Sbjct: 178 ERDYLMGLAEVFRDYTKDLDDAWVVSHDASSGKAYGELLK--NPGSD----GNTFYSSNV 231

Query: 267 LAGERMNLGLI----------LHDPEQEIDCFSD----------NTYASYLNDVIGIISS 306
              E +  G+I          + DP  E    +D          N+   + N++IG+ + 
Sbjct: 232 GVVEELINGMIGIVDEVGNGKIADPFGESVSSADTSKVESQYSWNSLTDFSNNIIGVRNV 291

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
           Y GE      ++     I D ++  +++LA  +  +  N +     ++    N   F Q 
Sbjct: 292 YQGELTGAADKQ----GIVDFVAAADKDLATRVGTEIDNAILTIQAIE--GSNDMPFRQA 345

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
           IS+   EG K ++       T  ++L K++ +L+
Sbjct: 346 ISDT--EGRKRIQ-------TAVDALSKLQTSLE 370


>gi|157376924|ref|YP_001475524.1| putative lipoprotein [Shewanella sediminis HAW-EB3]
 gi|157319298|gb|ABV38396.1| putative lipoprotein [Shewanella sediminis HAW-EB3]
          Length = 384

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 81/397 (20%), Positives = 151/397 (38%), Gaps = 85/397 (21%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           A  ++ N++ + ++  YAT+A        M   +L  A +TLV TP + NL  A+  W  
Sbjct: 43  ATEMITNLTDDVIVSGYATLA--------MKGESLLLATQTLVNTPTQANLLAAQEAWKA 94

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR P++Q E + FG       D  +++WPL                        N    +
Sbjct: 95  ARQPWEQGESHIFGPVDSLGIDPHLDSWPL------------------------NTTDLT 130

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
            ++ N    D   I            G + ++  G+H +E+LL+G  +  N +       
Sbjct: 131 TVLANNSGFDAETI-----------KGWNDDV-QGFHTMEYLLFGDGIADNEKA------ 172

Query: 197 TDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-----GPDGQATKDLMKDINAG 251
               I + T        EYL  ++++     + +  AW     G  G+A  +L+K   + 
Sbjct: 173 ----IADLTTAEN----EYLMGLAEVFRDYTKVLDDAWQVSHDGQSGKAYGELVKSPGSD 224

Query: 252 LNS-----------IITGMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
            N+           ++ GM  +     N    +   + L   D  +    +S N+   + 
Sbjct: 225 GNTFYSSQVGVIQELVNGMIGIVDEVGNGKIADPFGVSLETADTSKVESQYSWNSLTDFS 284

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
           ++++G+ + Y GE    + ++     I D +   +  LA  +  +  + +     +    
Sbjct: 285 DNIVGVRNVYQGELTGASDKQ----GIVDFVKAADATLAARVGSEIDDAIIKIQAIS--G 338

Query: 358 ENIESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
            N   F Q IS+   EG   V+  I+ L     SL  
Sbjct: 339 TNNMPFRQAISD--VEGRARVQTAIDALSKLQTSLES 373


>gi|218462994|ref|ZP_03503085.1| hypothetical protein RetlK5_27718 [Rhizobium etli Kim 5]
          Length = 66

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 34/46 (73%)

Query: 356 RAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           R E +E +DQMI+E N EGN +V+  I+ LI QT+S++++  ALDL
Sbjct: 2   RGETVEKYDQMIAEGNKEGNAVVQAAIDGLIDQTKSIQRVIAALDL 47


>gi|270294384|ref|ZP_06200586.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270275851|gb|EFA21711.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 383

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 68/162 (41%), Gaps = 30/162 (18%)

Query: 19  SIVPNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA 77
           +I  N +L+ +++NY   +    Y+D      TL  A+  L   P+    E A   WI A
Sbjct: 241 TINSNEALDPIVENYVNVVVLPTYKDLKEKNSTLYDAVVALANNPSNSAFETACNAWITA 300

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R P+++SE + FG       D  +++WPLD+  I                         +
Sbjct: 301 REPWEESEAFLFGPVDELGLDPNMDSWPLDQNAI------------------------VQ 336

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
           I+ ++K  DL     D   K+  A  +      G+H +EFLL
Sbjct: 337 ILNSQKWGDLEWSEGDDDAKVESAQNV-----RGFHTLEFLL 373


>gi|160891081|ref|ZP_02072084.1| hypothetical protein BACUNI_03528 [Bacteroides uniformis ATCC 8492]
 gi|317480991|ref|ZP_07940071.1| iron-regulated protein A [Bacteroides sp. 4_1_36]
 gi|156859302|gb|EDO52733.1| hypothetical protein BACUNI_03528 [Bacteroides uniformis ATCC 8492]
 gi|316902884|gb|EFV24758.1| iron-regulated protein A [Bacteroides sp. 4_1_36]
          Length = 383

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 68/162 (41%), Gaps = 30/162 (18%)

Query: 19  SIVPNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA 77
           +I  N +L+ +++NY   +    Y+D      TL  A+  L   P+    E A   WI A
Sbjct: 241 TINSNEALDPIVENYVNVVVLPTYKDLKEKNSTLYDAVVALANNPSNSAFETACNAWITA 300

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R P+++SE + FG       D  +++WPLD+  I                         +
Sbjct: 301 REPWEESEAFLFGPVDELGLDPNMDSWPLDQNAI------------------------VQ 336

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
           I+ ++K  DL     D   K+  A  +      G+H +EFLL
Sbjct: 337 ILNSQKWGDLEWSEGDDDAKVESAQNV-----RGFHTLEFLL 373


>gi|29347889|ref|NP_811392.1| iron-regulated protein A [Bacteroides thetaiotaomicron VPI-5482]
 gi|253572478|ref|ZP_04849880.1| iron-regulated protein A [Bacteroides sp. 1_1_6]
 gi|255690044|ref|ZP_05413719.1| iron-regulated protein A [Bacteroides finegoldii DSM 17565]
 gi|29339791|gb|AAO77586.1| iron-regulated protein A precursor [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|251837893|gb|EES65982.1| iron-regulated protein A [Bacteroides sp. 1_1_6]
 gi|260624652|gb|EEX47523.1| iron-regulated protein A [Bacteroides finegoldii DSM 17565]
          Length = 372

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%)

Query: 41  YEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKK 100
           Y D     + L  A+ET  T+P+  N +     W+ AR P++ SE + FG       D  
Sbjct: 251 YSDLKAGNQALFDAVETFRTSPSNANFKACATAWLAARTPWETSEAFLFGPVADKGLDPN 310

Query: 101 VNAWPLDE 108
           +++WPLD+
Sbjct: 311 MDSWPLDQ 318


>gi|189467159|ref|ZP_03015944.1| hypothetical protein BACINT_03543 [Bacteroides intestinalis DSM
           17393]
 gi|224537965|ref|ZP_03678504.1| hypothetical protein BACCELL_02854 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|189435423|gb|EDV04408.1| hypothetical protein BACINT_03543 [Bacteroides intestinalis DSM
           17393]
 gi|224520426|gb|EEF89531.1| hypothetical protein BACCELL_02854 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 372

 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%)

Query: 41  YEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKK 100
           Y D     + L  A+ET  T+P+  N +     W+ AR P++ SE + FG       D  
Sbjct: 251 YSDLKAGNQALFDAVETFRTSPSNANFKACATAWLAARTPWETSEAFLFGPVADKGLDPN 310

Query: 101 VNAWPLDE 108
           +++WPLD+
Sbjct: 311 MDSWPLDQ 318


>gi|167625435|ref|YP_001675729.1| putative lipoprotein [Shewanella halifaxensis HAW-EB4]
 gi|167355457|gb|ABZ78070.1| putative lipoprotein [Shewanella halifaxensis HAW-EB4]
          Length = 382

 Score = 49.7 bits (117), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 74/352 (21%), Positives = 137/352 (38%), Gaps = 75/352 (21%)

Query: 39  AKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           A Y +  +    +  A +TLV TP + NL  A+  W  AR P++Q E + FG       D
Sbjct: 55  AGYSNLALRGAAMLQATQTLVATPTQANLLAAQEAWKAARQPWEQGESHIFGPVDSLGID 114

Query: 99  KKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKL 158
             +++WPL                        N    + ++ N    D   I        
Sbjct: 115 PHLDSWPL------------------------NTTDLTTVLANNTGFDADTI-------- 142

Query: 159 HRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKV 218
               G + ++  G+H +E+LL+G  +  N +           I   T        +YL  
Sbjct: 143 ---KGWNDDV-QGFHTMEYLLFGDGVADNTKT----------ISELT----TNERDYLMG 184

Query: 219 VSKILVSDLEEMMKAW-----GPDGQATKDLMKDINAGLNSIIT---GMTSLSYNELAG- 269
           ++++     + +  AW     G  G+A  +L+K+  A  N+  +   G+     N + G 
Sbjct: 185 LAEVFRDYTKTLDDAWLISHDGQSGKAYGELLKNSGADGNTFYSSEVGVVEELVNGMIGI 244

Query: 270 -ERMNLGLILHDPEQEID---------CFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            + +  G I     + ID          +S N+   + +++IG+ + Y GE +  N +K 
Sbjct: 245 VDEVGNGKIADPFGESIDKADTSKVESQYSWNSLTDFSDNIIGVRNVYLGE-LEGNADK- 302

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENN 371
               I D ++  N  LA  +  +  + +   + +     N   F Q IS+++
Sbjct: 303 --QGIIDFVNAANPALATRVKTEIDDAITKINAIA--GANNMPFRQAISDSD 350


>gi|332881676|ref|ZP_08449324.1| hypothetical protein HMPREF9074_05114 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332680315|gb|EGJ53264.1| hypothetical protein HMPREF9074_05114 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 410

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%)

Query: 41  YEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKK 100
           Y+D       L +A+E    TP+    E A   W+ AR+P++QSE + FG   +   D  
Sbjct: 289 YKDLKEKNTALLAAVEDFYNTPSDDTFEAACEAWLVARMPWEQSEAFLFGPVDILGLDPN 348

Query: 101 VNAWPLDE 108
           +++WPLD+
Sbjct: 349 MDSWPLDQ 356


>gi|329965221|ref|ZP_08302151.1| Imelysin [Bacteroides fluxus YIT 12057]
 gi|328523241|gb|EGF50341.1| Imelysin [Bacteroides fluxus YIT 12057]
          Length = 383

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 66/162 (40%), Gaps = 30/162 (18%)

Query: 19  SIVPNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA 77
           +I  N +L+ ++ NY   +    Y+D       L  A+  L   P+    E A   WI A
Sbjct: 241 TINSNEALDPIVGNYVEVVVLPTYKDLKKKNNMLYDAVVALANNPSNSAFETACNAWITA 300

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R P+++SE + FG       D  +++WPLD+  I                         +
Sbjct: 301 REPWEESEAFLFGPVDELGLDPNMDSWPLDQNAI------------------------VQ 336

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
           I+ ++K  DL     D   K+  A  +      G+H +EFLL
Sbjct: 337 ILNSQKWSDLEWSEGDDDAKVESAQNV-----RGFHTLEFLL 373


>gi|56750104|ref|YP_170805.1| Iron-regulated protein A [Synechococcus elongatus PCC 6301]
 gi|81300271|ref|YP_400479.1| imelysin [Synechococcus elongatus PCC 7942]
 gi|124907|sp|P12608|IRPA_SYNE7 RecName: Full=Iron-regulated protein A; Flags: Precursor
 gi|280209|pir||A43648 iron-regulated protein A - Synechococcus sp
 gi|154525|gb|AAA27316.1| iron-regulated protein [Synechococcus sp.]
 gi|56685063|dbj|BAD78285.1| Iron-regulated protein A precursor [Synechococcus elongatus PCC
           6301]
 gi|81169152|gb|ABB57492.1| imelysin. Metallo peptidase. MEROPS family M75 [Synechococcus
           elongatus PCC 7942]
          Length = 356

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 52/106 (49%), Gaps = 13/106 (12%)

Query: 7   ISIVFTLPSHALSIVPNVSLEK-----VLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           ++ +F+      +++ N +++      V+ +Y ++A          A  L+ A++T    
Sbjct: 32  VATLFSACGQTQALITNQTIQGFVDQVVVPSYVSVAAG--------ATQLEQALQTYQQA 83

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLD 107
           P   NLE AR  W  AR  ++Q+E + FG    + +D  ++ WP+D
Sbjct: 84  PTAANLEAARQAWRVARDRWEQTECFAFGPADSEGFDGAMDTWPID 129


>gi|157960499|ref|YP_001500533.1| putative lipoprotein [Shewanella pealeana ATCC 700345]
 gi|157845499|gb|ABV85998.1| putative lipoprotein [Shewanella pealeana ATCC 700345]
          Length = 383

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 75/372 (20%), Positives = 143/372 (38%), Gaps = 83/372 (22%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           A  +V N++ + ++  Y+ +A        +    +  A +TLV TP + NLE A+  W  
Sbjct: 42  ATDMVANLTDDVIVAGYSNLA--------VRGEAMLQATQTLVATPTQANLEAAQAAWKA 93

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR P++Q E + FG       D  +++WPL                        N    +
Sbjct: 94  ARQPWEQGESHIFGPVDSLGIDPHLDSWPL------------------------NTTDLT 129

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
            ++ N    D   I            G + ++  G+H +E+LL+G  +  N +       
Sbjct: 130 TVLANNAGFDAETI-----------KGWNDDV-QGFHTMEYLLFGDGVADNTKTISELTV 177

Query: 197 TDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-----GPDGQATKDLMKDINAG 251
            + D              YL  ++++     + +  AW     G +G+A  +L+K+  A 
Sbjct: 178 NERD--------------YLMGLAEVFRDYTKTLDDAWLISHDGQNGKAYGELLKNSGAD 223

Query: 252 LNS-----------IITGMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
            N+           ++ GM  +     N    +     L   D  +    +S N+   + 
Sbjct: 224 GNTFYSSEVGVVEELVNGMIGIVDEVGNGKIADPFGESLAKADTSKVESQYSWNSLTDFS 283

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
           ++++G+ + Y GE +  N +K     I D +   N  LA  + D+  + +     +    
Sbjct: 284 DNIVGVRNVYLGE-LEGNADK---QGIIDFVDAANPELATRVKDEIDDAISKIEAIA--G 337

Query: 358 ENIESFDQMISE 369
           +N   F Q IS+
Sbjct: 338 DNNMPFRQAISD 349


>gi|198276853|ref|ZP_03209384.1| hypothetical protein BACPLE_03058 [Bacteroides plebeius DSM 17135]
 gi|198270378|gb|EDY94648.1| hypothetical protein BACPLE_03058 [Bacteroides plebeius DSM 17135]
          Length = 394

 Score = 46.2 bits (108), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%)

Query: 50  TLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEG 109
           TL   + TL   P  +  ++A   WI AR P+++SE + FG       D  +++WPLD+ 
Sbjct: 282 TLYDKVNTLAANPTNQAFKDACDAWITAREPWEKSEAFLFGPVADQGLDPNMDSWPLDQA 341

Query: 110 FI 111
            I
Sbjct: 342 AI 343


>gi|330998011|ref|ZP_08321842.1| hypothetical protein HMPREF9442_02945 [Paraprevotella xylaniphila
           YIT 11841]
 gi|329569312|gb|EGG51092.1| hypothetical protein HMPREF9442_02945 [Paraprevotella xylaniphila
           YIT 11841]
          Length = 397

 Score = 46.2 bits (108), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 15  SHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ 73
           ++A   + +  ++ V+  +   +    Y+D       L +A++     P+    E A   
Sbjct: 249 AYANGTITDAEMDSVVNGFVNKVVLPTYKDLKEKNTALCAAVQNFYNNPSDATFETACDA 308

Query: 74  WIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDE 108
           W+ AR P++QSE + FG   +   D  +++WPLD+
Sbjct: 309 WLVARTPWEQSEAFLFGPVDILGLDPNMDSWPLDQ 343


>gi|261879091|ref|ZP_06005518.1| iron-regulated protein A [Prevotella bergensis DSM 17361]
 gi|270334271|gb|EFA45057.1| iron-regulated protein A [Prevotella bergensis DSM 17361]
          Length = 424

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 60/139 (43%), Gaps = 10/139 (7%)

Query: 41  YEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKK 100
           Y D     + L   I      P+ +  +     WI+AR P++ SE Y FG       D  
Sbjct: 286 YSDLKKYNKELYQKILAFQAKPSNEGFKACCEAWIKARQPWESSEAYLFGPVADKGLDPN 345

Query: 101 VNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHR 160
           ++ WPLD   ID +++    E+     ++ + + +      E +   S +SP+  +K   
Sbjct: 346 MDTWPLD---IDGIENILKSEDWNKLNWSGDFVEDE-----EGDNGSSQLSPEEKKKAEA 397

Query: 161 ANGIDTNITTGYHVIEFLL 179
            +   +    GYH IEFL+
Sbjct: 398 ISSAQS--LRGYHTIEFLI 414


>gi|317475284|ref|ZP_07934550.1| iron-regulated protein A [Bacteroides eggerthii 1_2_48FAA]
 gi|316908538|gb|EFV30226.1| iron-regulated protein A [Bacteroides eggerthii 1_2_48FAA]
          Length = 397

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 55  IETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFI 111
           + TL   P   N + A  QWI AR P++ SE + FG       D  +++WPLD   I
Sbjct: 283 VSTLQKNPTDANFKAAAAQWIVARRPWETSEAFLFGPVADKGLDPNMDSWPLDADAI 339


>gi|218129315|ref|ZP_03458119.1| hypothetical protein BACEGG_00892 [Bacteroides eggerthii DSM 20697]
 gi|217988492|gb|EEC54813.1| hypothetical protein BACEGG_00892 [Bacteroides eggerthii DSM 20697]
          Length = 410

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 55  IETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFI 111
           + TL   P   N + A  QWI AR P++ SE + FG       D  +++WPLD   I
Sbjct: 296 VSTLQKNPTDANFKAAAAQWIVARRPWETSEAFLFGPVADKGLDPNMDSWPLDADAI 352


>gi|170725155|ref|YP_001759181.1| putative lipoprotein [Shewanella woodyi ATCC 51908]
 gi|169810502|gb|ACA85086.1| putative lipoprotein [Shewanella woodyi ATCC 51908]
          Length = 381

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 52/92 (56%), Gaps = 12/92 (13%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           A  ++ N++ + ++  YA++A  K E+ L+       A +TLV+   + NL  A+  W  
Sbjct: 41  ATEMITNLTDDVIVSGYASLA-TKGEEMLL-------ATQTLVSNKTQANLLAAQEAWKA 92

Query: 77  ARIPYQQSEVYRFGNKIVDTW--DKKVNAWPL 106
           AR+P++Q E + FG   VD+   D  +++WPL
Sbjct: 93  ARLPWEQGESHIFGP--VDSLGIDPHLDSWPL 122


>gi|91792084|ref|YP_561735.1| putative lipoprotein [Shewanella denitrificans OS217]
 gi|91714086|gb|ABE54012.1| imelysin. Metallo peptidase. MEROPS family M75 [Shewanella
           denitrificans OS217]
          Length = 387

 Score = 45.1 bits (105), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 80/412 (19%), Positives = 153/412 (37%), Gaps = 103/412 (25%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           A +++ N++ E ++  YA +A    E  L        A + L+ + ++ +L  A+  W  
Sbjct: 43  ATAMITNLTQEVIVTGYADLAAKGSELVL--------ATQKLINSTSQADLVAAQDAWKA 94

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR P++Q E + FG     + D  +++WPL+                             
Sbjct: 95  ARQPWEQGESHIFGPVDSLSIDPHLDSWPLN----------------------------- 125

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNI-------TTGYHVIEFLLWGQDLKTNVR 189
                         + DL  +L  A G D            G+H +E+LL+G  +  N +
Sbjct: 126 --------------TTDLSTQLTTAAGFDAETIKSWNDDVQGFHTMEYLLFGDGVADNTK 171

Query: 190 EPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW----GPDGQATKDLM 245
                     DI   T    + R EYL  ++++     + +  AW     PD    K   
Sbjct: 172 ----------DISELT---VKER-EYLIALAQVFRDHAKTLDDAWQINHKPDDANAKPYA 217

Query: 246 KDIN--------------AGLNSIITGMTSLSYNELAGERMN--LG--LILHDPEQEIDC 287
           + ++              A +  +I GM  +  +E+   +++   G  +   D  +    
Sbjct: 218 ELLSQPGVDGNTVYSSELAVIEELINGMIGI-VDEVGNGKISDPFGDSITSADTSKVESQ 276

Query: 288 FSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTM 347
           +S N+   + N++ G+ + Y GE+     ++     + D +S  + NLA  +  +  + +
Sbjct: 277 YSWNSLTDFANNIQGVRNVYQGEFTGNTDKQ----GVKDFVSAADANLAVRVASEIDDAI 332

Query: 348 KDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
                +     N   F Q I + N  G   ++  I+ L     SL    I L
Sbjct: 333 IKIQAIS--GSNSMPFRQAIKDAN--GRVRIQTAIDALTKLKTSLESDVIPL 380


>gi|329957155|ref|ZP_08297722.1| conserved domain protein [Bacteroides clarus YIT 12056]
 gi|328523423|gb|EGF50522.1| conserved domain protein [Bacteroides clarus YIT 12056]
          Length = 410

 Score = 44.3 bits (103), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%)

Query: 55  IETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFI 111
           +  L   P   N + A  QWI AR P++ SE + FG       D  +++WPLD   I
Sbjct: 296 VSALQKNPTDANFKAAAAQWIVARKPWETSEAFLFGPVADKGLDPNMDSWPLDADAI 352


>gi|319901230|ref|YP_004160958.1| Peptidase M75, Imelysin [Bacteroides helcogenes P 36-108]
 gi|319416261|gb|ADV43372.1| Peptidase M75, Imelysin [Bacteroides helcogenes P 36-108]
          Length = 388

 Score = 43.5 bits (101), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%)

Query: 50  TLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEG 109
            L +A +   +TP+  N E     W+ AR P++ SE + FG       D  +++WPLD+ 
Sbjct: 215 ALYTAAQKFNSTPSNANFEAVCEAWLEARQPWETSEAFLFGPVDALGLDPNMDSWPLDQS 274

Query: 110 FI 111
            I
Sbjct: 275 AI 276


>gi|294139363|ref|YP_003555341.1| hypothetical protein SVI_0592 [Shewanella violacea DSS12]
 gi|293325832|dbj|BAJ00563.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 339

 Score = 43.1 bits (100), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 75/399 (18%), Positives = 157/399 (39%), Gaps = 85/399 (21%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
           ++ N++ + ++  Y+T+A  K E+  + +       +TLV    + NL  A+  W  AR 
Sbjct: 1   MITNLTDDVIISGYSTLA-IKGEEMFLAS-------QTLVANKTQANLLAAQEAWKAARQ 52

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKII 139
           P++Q E + FG       D  +++WPL+   +  V +       +N+ ++A+ I      
Sbjct: 53  PWEQGESHIFGPVDSLGIDPHLDSWPLNTTDLKTVLT-------DNSGFSADTI------ 99

Query: 140 VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
                                  G + ++  G+H +E+LL+G  +  N +          
Sbjct: 100 ----------------------KGWNDDV-QGFHTMEYLLFGDGVADNQK---------- 126

Query: 200 DIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-----GPDGQATKDLMKDINAGLNS 254
           D+ + T        EYL  +S++     + +  +W     G  G+A  +L+K+     N+
Sbjct: 127 DVADLT----MSEAEYLMGLSEVFRDYTKTLDDSWLISHDGQTGKAYGELVKNPGTADNT 182

Query: 255 -----------IITGMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
                      ++ GM  +     N    +         D  +    +S N+   + +++
Sbjct: 183 FYASQVGVIQELVNGMIGIVDEVGNGKIADPFGTSAATADTSKVESQYSWNSLTDFSDNI 242

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           IG+ + Y GE    + ++     I D +   +  LA  ++ +  + +     +K    N 
Sbjct: 243 IGVRNVYQGELTGASDKQ----GIIDFVKAGDEALALRVSSEIDDAIIKIQAIK--GSNN 296

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
             F Q I++   EG   ++  ++ L     SL    + L
Sbjct: 297 MPFRQAIAD--AEGRVRIQTAVDALSKLQASLESDVVPL 333


>gi|237713613|ref|ZP_04544094.1| iron-regulated protein A [Bacteroides sp. D1]
 gi|262406288|ref|ZP_06082837.1| iron-regulated protein A [Bacteroides sp. 2_1_22]
 gi|229446335|gb|EEO52126.1| iron-regulated protein A [Bacteroides sp. D1]
 gi|262354991|gb|EEZ04082.1| iron-regulated protein A [Bacteroides sp. 2_1_22]
          Length = 382

 Score = 43.1 bits (100), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 87/215 (40%), Gaps = 50/215 (23%)

Query: 41  YEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKK 100
           Y+D       L++A++ L T+ +  ++ NA   W+ AR P+++SE + +G   ++  D  
Sbjct: 58  YQDMYNKVTALNTAVQKLSTSSSDNDVANAADAWVAARKPWEKSEAFLYGPADLNKLDPS 117

Query: 101 VNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHR 160
           +++WPLD+G ID +  S   E+           A +    N             LR    
Sbjct: 118 LDSWPLDKGGIDAILQSGNWEDAVGGDVDDGDDAPADAPQN-------------LR---- 160

Query: 161 ANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN-RPYTDFDIGNCTGGHCRRRVEYLKVV 219
                     G+H  E+LL+         E G  +  TD D           ++ YLK V
Sbjct: 161 ----------GFHTAEYLLF---------EDGEAKKITDLDA---------NKIGYLKAV 192

Query: 220 SKILVSDLEEMMKAWGP----DGQATKDLMKDINA 250
              +  D E ++K W      +  A KD MK  N 
Sbjct: 193 VGRMSKDTELLLKGWTEGKNLENGAYKDAMKAPNG 227


>gi|294643044|ref|ZP_06720884.1| imelysin [Bacteroides ovatus SD CC 2a]
 gi|294810068|ref|ZP_06768739.1| imelysin [Bacteroides xylanisolvens SD CC 1b]
 gi|298482803|ref|ZP_07000986.1| iron-regulated protein A [Bacteroides sp. D22]
 gi|292641601|gb|EFF59779.1| imelysin [Bacteroides ovatus SD CC 2a]
 gi|294442672|gb|EFG11468.1| imelysin [Bacteroides xylanisolvens SD CC 1b]
 gi|298271003|gb|EFI12581.1| iron-regulated protein A [Bacteroides sp. D22]
          Length = 391

 Score = 42.7 bits (99), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 87/215 (40%), Gaps = 50/215 (23%)

Query: 41  YEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKK 100
           Y+D       L++A++ L T+ +  ++ NA   W+ AR P+++SE + +G   ++  D  
Sbjct: 67  YQDMYNKVTALNTAVQKLSTSSSDNDVANAADAWVAARKPWEKSEAFLYGPADLNKLDPS 126

Query: 101 VNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHR 160
           +++WPLD+G ID +  S   E+           A +    N             LR    
Sbjct: 127 LDSWPLDKGGIDAILQSGNWEDAVGGDVDDGDDAPADAPQN-------------LR---- 169

Query: 161 ANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN-RPYTDFDIGNCTGGHCRRRVEYLKVV 219
                     G+H  E+LL+         E G  +  TD D           ++ YLK V
Sbjct: 170 ----------GFHTAEYLLF---------EDGEAKKITDLD---------ANKIGYLKAV 201

Query: 220 SKILVSDLEEMMKAWGP----DGQATKDLMKDINA 250
              +  D E ++K W      +  A KD MK  N 
Sbjct: 202 VGRMSKDTELLLKGWTEGKNLENGAYKDAMKAPNG 236


>gi|237719361|ref|ZP_04549842.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|229451221|gb|EEO57012.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
          Length = 384

 Score = 41.6 bits (96), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%)

Query: 50  TLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEG 109
            L +A+  L   P+    E A   WI AR P+++SE + FG       D  +++WPLD+ 
Sbjct: 274 ALYNAVIALADNPSNSAFETACDAWITAREPWEKSEAFLFGPVDEMGLDPNMDSWPLDQN 333

Query: 110 FI 111
            I
Sbjct: 334 AI 335


>gi|260175325|ref|ZP_05761737.1| iron-regulated protein A precursor [Bacteroides sp. D2]
 gi|299149248|ref|ZP_07042308.1| iron-regulated protein A [Bacteroides sp. 3_1_23]
 gi|315923558|ref|ZP_07919798.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|298512682|gb|EFI36571.1| iron-regulated protein A [Bacteroides sp. 3_1_23]
 gi|313697433|gb|EFS34268.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 384

 Score = 41.6 bits (96), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%)

Query: 50  TLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEG 109
            L +A+  L   P+    E A   WI AR P+++SE + FG       D  +++WPLD+ 
Sbjct: 274 ALYNAVIALADNPSNSAFETACDAWITAREPWEKSEAFLFGPVDEMGLDPNMDSWPLDQN 333

Query: 110 FI 111
            I
Sbjct: 334 AI 335


>gi|301598665|pdb|3N8U|A Chain A, Crystal Structure Of An Imelysin Peptidase (Bacova_03801)
           From Bacteroides Ovatus At 1.44 A Resolution
 gi|301598666|pdb|3N8U|B Chain B, Crystal Structure Of An Imelysin Peptidase (Bacova_03801)
           From Bacteroides Ovatus At 1.44 A Resolution
 gi|309320705|pdb|3OYV|A Chain A, Crystal Structure Of An Imelysin Peptidase (Bacova_03801)
           From Bacteroides Ovatus Atcc 8483 At 1.25 A Resolution
          Length = 361

 Score = 41.2 bits (95), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%)

Query: 50  TLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEG 109
            L +A+  L   P+    E A   WI AR P+++SE + FG       D   ++WPLD+ 
Sbjct: 251 ALYNAVIVLADNPSNSAFETACDAWITAREPWEKSEAFLFGPVDEXGLDPNXDSWPLDQN 310

Query: 110 FI 111
            I
Sbjct: 311 AI 312


>gi|293373325|ref|ZP_06619683.1| imelysin [Bacteroides ovatus SD CMC 3f]
 gi|292631721|gb|EFF50341.1| imelysin [Bacteroides ovatus SD CMC 3f]
          Length = 384

 Score = 41.2 bits (95), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%)

Query: 50  TLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEG 109
            L +A+  L   P+    E A   WI AR P+++SE + FG       D  +++WPLD+ 
Sbjct: 274 ALYNAVIVLADNPSNSAFETACDAWITAREPWEKSEAFLFGPVDEMGLDPNMDSWPLDQN 333

Query: 110 FI 111
            I
Sbjct: 334 AI 335


>gi|160885797|ref|ZP_02066800.1| hypothetical protein BACOVA_03801 [Bacteroides ovatus ATCC 8483]
 gi|156108610|gb|EDO10355.1| hypothetical protein BACOVA_03801 [Bacteroides ovatus ATCC 8483]
          Length = 384

 Score = 41.2 bits (95), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%)

Query: 50  TLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEG 109
            L +A+  L   P+    E A   WI AR P+++SE + FG       D  +++WPLD+ 
Sbjct: 274 ALYNAVIVLADNPSNSAFETACDAWITAREPWEKSEAFLFGPVDEMGLDPNMDSWPLDQN 333

Query: 110 FI 111
            I
Sbjct: 334 AI 335


>gi|317504859|ref|ZP_07962815.1| conserved hypothetical protein [Prevotella salivae DSM 15606]
 gi|315664043|gb|EFV03754.1| conserved hypothetical protein [Prevotella salivae DSM 15606]
          Length = 368

 Score = 41.2 bits (95), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 24  VSLEKVLQN-YATIAHAKYEDALMCARTLDSAIETLVT-TPNKKNLENARLQWIRARIPY 81
           +SLE+V+ N    +  A+Y+       T   A+  L T T  ++ LE     +++AR  Y
Sbjct: 37  LSLEQVITNDIDGVIRAQYKVLATNTSTFYEALSALETSTMTQEQLEKVCQLFLKARGDY 96

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLD 107
           ++SE + FG     T D  +N+WPLD
Sbjct: 97  EKSEAFFFGANAHFTVDADINSWPLD 122


>gi|186473973|ref|YP_001861315.1| multi-sensor hybrid histidine kinase [Burkholderia phymatum STM815]
 gi|184196305|gb|ACC74269.1| multi-sensor hybrid histidine kinase [Burkholderia phymatum STM815]
          Length = 939

 Score = 40.8 bits (94), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 10/120 (8%)

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPE--QEIDCFSDNTYASYLN 298
            +D +K++NAGL + +   T+     LAG+   +    H  E  +E + F  N+    + 
Sbjct: 277 AEDALKELNAGLEARVAQRTAELTAALAGQAAEIAERQHAEEAVRESEHFL-NSIIENIP 335

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNL-AQEINDKFSNTMKDFHILKDRA 357
           D++ +  + T  ++R N       +  DL+ +    L  Q ++D F     DF  LKDRA
Sbjct: 336 DMVFVKEAATLRFVRFN------KAAEDLLGYRREELIGQSVHDLFPADEADFFALKDRA 389


>gi|90019994|ref|YP_525821.1| imelysin [Saccharophagus degradans 2-40]
 gi|89949594|gb|ABD79609.1| imelysin. Metallo peptidase. MEROPS family M75 [Saccharophagus
           degradans 2-40]
          Length = 359

 Score = 40.8 bits (94), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 65/148 (43%), Gaps = 32/148 (21%)

Query: 43  DALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR--------FGNKIV 94
            +L   + L+SAI TL+ TP++  L  A+  W  A I YQ+  V+           N + 
Sbjct: 62  QSLSATQALNSAITTLLNTPSEDALLQAQKAWATAAITYQEFNVFAQLQPQNSVLFNTVA 121

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEI-DLSIISPD 153
           D    ++ A P+  G++D    S+G       ++  ++  N   ++N+  + DL+     
Sbjct: 122 DN-HYRIAAHPIQPGYLD----SFGDYQYSGIVHDISMPLNKATLLNQHGMTDLA----- 171

Query: 154 LLRKLHRANGIDTNITTGYHVIEFLLWG 181
                        +   G++ IE++L+G
Sbjct: 172 -------------DAALGFYAIEYMLFG 186


>gi|332828530|gb|EGK01230.1| hypothetical protein HMPREF9455_02422 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 386

 Score = 40.8 bits (94), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 2/76 (2%)

Query: 41  YEDALMCARTLDSAIETLVTTPNK--KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           Y D    A TL  A++T  T+  +   NL      W   RIP++QSE   +G       D
Sbjct: 55  YADMKNKAWTLYDAVQTFSTSTGRTQANLNAVCAAWRATRIPWEQSESCLYGPADRLGLD 114

Query: 99  KKVNAWPLDEGFIDYV 114
             +++WPL +G ID +
Sbjct: 115 PSLDSWPLKKGDIDKI 130


>gi|189463604|ref|ZP_03012389.1| hypothetical protein BACCOP_04328 [Bacteroides coprocola DSM 17136]
 gi|189429707|gb|EDU98691.1| hypothetical protein BACCOP_04328 [Bacteroides coprocola DSM 17136]
          Length = 411

 Score = 40.4 bits (93), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 73/178 (41%), Gaps = 38/178 (21%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLE---NARLQWI 75
           +IVP V    V+  Y  +A    ++A++ +     A E  ++    K  E    A   W 
Sbjct: 47  AIVPYVD-NTVIPTYTAMA----DEAILMSDACTKAKEAYLSGDKAKATEYVAEACEHWT 101

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            +R  ++ SE + FG       D  +++WPLD+  +D                  N++ N
Sbjct: 102 ESRKAWELSEAFLFGAAADYNIDPHIDSWPLDQVALD------------------NLLNN 143

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN 193
            K++    E D   I+ +L   L            GYH +E++L+ Q    + REP N
Sbjct: 144 QKMMDAIGEGDFDYITTNLGYGL-----------LGYHALEYILF-QLTDDSHREPRN 189


>gi|295083856|emb|CBK65379.1| Imelysin. [Bacteroides xylanisolvens XB1A]
          Length = 399

 Score = 40.0 bits (92), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%)

Query: 50  TLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEG 109
            L +A+  L   P+    + A   WI AR P+++SE + FG       D  +++WPLD+ 
Sbjct: 289 ALYNAVIALADNPSNSAFDKACEAWITAREPWEKSEAFLFGPVDEMGLDPNMDSWPLDQN 348

Query: 110 FI 111
            I
Sbjct: 349 AI 350


>gi|262197053|ref|YP_003268262.1| peptidase M75, Imelysin [Haliangium ochraceum DSM 14365]
 gi|262080400|gb|ACY16369.1| Peptidase M75, Imelysin [Haliangium ochraceum DSM 14365]
          Length = 391

 Score = 40.0 bits (92), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 1/88 (1%)

Query: 26  LEKVLQNYATIA-HAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
           ++ VL++ A +     Y+D    A  L++A  +L   P+   L   R QW   R  ++++
Sbjct: 44  VQDVLRDLANVVIVPAYDDFRASAEQLEAATRSLCAAPDAAQLTALRGQWRDTRALWKRA 103

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFID 112
           E + FG       D  V+ WP+    +D
Sbjct: 104 EAHEFGPAADLRIDTAVDFWPVRASSVD 131


>gi|154493920|ref|ZP_02033240.1| hypothetical protein PARMER_03264 [Parabacteroides merdae ATCC
           43184]
 gi|154086180|gb|EDN85225.1| hypothetical protein PARMER_03264 [Parabacteroides merdae ATCC
           43184]
          Length = 421

 Score = 39.7 bits (91), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%)

Query: 41  YEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKK 100
           Y+D     + L  A+      P+  N E A   WI AR P+++SE +  G       D  
Sbjct: 297 YKDLQEKNKLLLDAVNQFRQNPSNDNFEKACNLWITAREPWEKSEAFLIGPVANLGLDPN 356

Query: 101 VNAWPLDEGFI 111
           +++WPLD+  I
Sbjct: 357 MDSWPLDQNGI 367


>gi|218258041|ref|ZP_03474474.1| hypothetical protein PRABACTJOHN_00127 [Parabacteroides johnsonii
           DSM 18315]
 gi|218225805|gb|EEC98455.1| hypothetical protein PRABACTJOHN_00127 [Parabacteroides johnsonii
           DSM 18315]
          Length = 421

 Score = 39.7 bits (91), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%)

Query: 41  YEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKK 100
           Y+D     + L  A+      P+  N E A   WI AR P+++SE +  G       D  
Sbjct: 297 YKDLQEKNKLLLDAVNQFRQNPSNDNFEKACNLWITAREPWEKSEAFLIGPVANLGLDPN 356

Query: 101 VNAWPLDEGFI 111
           +++WPLD+  I
Sbjct: 357 MDSWPLDQNGI 367


>gi|88803064|ref|ZP_01118591.1| putative lipoprotein [Polaribacter irgensii 23-P]
 gi|88781922|gb|EAR13100.1| putative lipoprotein [Polaribacter irgensii 23-P]
          Length = 366

 Score = 39.7 bits (91), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 3/93 (3%)

Query: 1  MYFITIISIVFTLPSHALSIVPNVSLEK--VLQNYA-TIAHAKYEDALMCARTLDSAIET 57
          + F+  I+I     S  +S +   S ++  +L+N A  I    YED  +    L S  E 
Sbjct: 7  LLFVAAIAINACSSSEEMSPIITDSFDRSALLENIADNIMIPAYEDFSVEMSALKSQGEV 66

Query: 58 LVTTPNKKNLENARLQWIRARIPYQQSEVYRFG 90
            TTPN+ NLE  R+ W  A   +Q  E++  G
Sbjct: 67 FTTTPNQMNLEALRVSWFAAYKSWQYIEMFDIG 99


>gi|118349287|ref|XP_001033520.1| hypothetical protein TTHERM_00313390 [Tetrahymena thermophila]
 gi|89287869|gb|EAR85857.1| hypothetical protein TTHERM_00313390 [Tetrahymena thermophila
           SB210]
          Length = 1643

 Score = 39.3 bits (90), Expect = 1.1,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 50/111 (45%), Gaps = 7/111 (6%)

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
           NL N +  W++  IP+  S            W+ +      DE  I Y+++ Y   N  N
Sbjct: 58  NLSNPQNYWVKKPIPFSDSVQLSVQCVKNRDWNPEFLILQKDETLIKYLNTHY-YSNSTN 116

Query: 126 NLYTANIIANSKII---VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYH 173
           +     +I N+KI+   V +K+  L + S D+++K+    G D+     YH
Sbjct: 117 HF---QMIINAKILLIDVTQKDFTLQVKSGDIIKKISNLIGSDSQYCYEYH 164


>gi|1585259|prf||2124370K traJ gene
          Length = 737

 Score = 39.3 bits (90), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 71/162 (43%), Gaps = 18/162 (11%)

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEID--CFSDNTYASYLNDVIGIIS 305
           + AG+    +G ++L   ELAG  +       DP  +ID  CF++N    +L  V  IIS
Sbjct: 397 VKAGIMG--SGKSTLVQTELAGAVL-------DPLVDIDVFCFAENNDYEWLRPVASIIS 447

Query: 306 -SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQ-EINDKFSNTMKDFHILKDRAENIESF 363
              T E ++   + IH  ++HD ++   R L +  I+       +    L+ R   I+  
Sbjct: 448 MGDTAENVQACMDHIH--ALHDSLAERGRLLREYGISAVTREAAEKDDRLRPRIVVIDEC 505

Query: 364 DQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
                ++ PE  + V NL+    +   + RK  I L+   P 
Sbjct: 506 QSFFRQDKPEDRREVVNLVVRFFS---AARKYGIVLNFATPT 544


>gi|187736416|ref|YP_001878528.1| hypothetical protein Amuc_1934 [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187426468|gb|ACD05747.1| conserved hypothetical protein [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 368

 Score = 39.3 bits (90), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 54/137 (39%), Gaps = 33/137 (24%)

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P    +  A    +  R+P++ SE + FG       D K+++WPLD   +D V  +    
Sbjct: 75  PTDAKVAEAGKLLLETRVPWELSESFLFGPAAFANLDPKLDSWPLDTTNLDAVAKN---- 130

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW- 180
                       A+SK +     ID + +   L        G +T    G+H  E+LL+ 
Sbjct: 131 ------------ADSKSVT----IDAAYVRNSL--------GAETR---GFHAAEYLLFR 163

Query: 181 -GQDLKTNVREPGNRPY 196
            GQ  K     PG   Y
Sbjct: 164 DGQPRKAADLTPGQLSY 180


>gi|254439368|ref|ZP_05052862.1| hypothetical protein OA307_4238 [Octadecabacter antarcticus 307]
 gi|198254814|gb|EDY79128.1| hypothetical protein OA307_4238 [Octadecabacter antarcticus 307]
          Length = 37

 Score = 38.5 bits (88), Expect = 2.2,   Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 194 RPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLE 228
           RP+TD+ +G  CT  +C RR E L   + +L+SDLE
Sbjct: 2   RPWTDYAMGYECTNANCDRRGELLTAATDLLMSDLE 37


>gi|218883423|ref|YP_002427805.1| ABC transporter related [Desulfurococcus kamchatkensis 1221n]
 gi|218765039|gb|ACL10438.1| ABC transporter related [Desulfurococcus kamchatkensis 1221n]
          Length = 467

 Score = 38.1 bits (87), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 73/178 (41%), Gaps = 25/178 (14%)

Query: 218 VVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI----------ITGMTSLSYNEL 267
           V SK+ +S+ E  + A GP G      +  I   L             I G+  LSYN+ 
Sbjct: 28  VESKVEISNGEAGLIA-GPSGSGKTVFLLSITGVLKHFFNGVVEGRVDIGGLNPLSYNDY 86

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS--YTGEYIRMNGEKI-HGASI 324
                 LG ++ DPE++I       Y + L++V+ ++ +  Y+ E  R     I     +
Sbjct: 87  ISLPGKLGFLMQDPERQI------IYPTPLDEVVALLEARGYSYEEARRKASNILESMGL 140

Query: 325 HDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
            D  + +  NL+     + + T+   H        I   D+  +  +PEG   +R LI
Sbjct: 141 LDKANEHVENLSGGEKKRLAITLSIVH-----DPGIILLDEPSASLDPEGINFIRKLI 193


>gi|163749167|ref|ZP_02156417.1| putative lipoprotein [Shewanella benthica KT99]
 gi|161331237|gb|EDQ02126.1| putative lipoprotein [Shewanella benthica KT99]
          Length = 388

 Score = 37.7 bits (86), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 90/225 (40%), Gaps = 59/225 (26%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           A  ++ N++ + ++  Y+ +A        +    L  A +TLV    ++NL   +  W  
Sbjct: 45  ATEMITNLTDDVIVSGYSALA--------IKGDELLQATQTLVNNKTQENLLAVQDAWKA 96

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR P++Q E + FG     + D  +++WPL                  N +   +++AN 
Sbjct: 97  ARQPWEQGESHIFGPVDSLSIDPHLDSWPL------------------NTVDLISVLAN- 137

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
               N    D   I            G + +I  G+H +E+LL+G  +  N +   +   
Sbjct: 138 ----NTGGFDADTI-----------KGWNDDI-QGFHTMEYLLFGDGVADNEKIVADLTT 181

Query: 197 TDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQ 239
           T+               EYL  ++++ +S  + +  AW    DGQ
Sbjct: 182 TE--------------TEYLMGLAEVFLSYTKTLDDAWQISHDGQ 212


>gi|226698191|sp|B0W517|WDR12_CULQU RecName: Full=Ribosome biogenesis protein WDR12 homolog
          Length = 425

 Score = 37.4 bits (85), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 82/203 (40%), Gaps = 39/203 (19%)

Query: 161 ANGIDTNITTGYHVIEFLLWGQDLKTNV--REPGNRPYTDFDIGNCT------GGH--CR 210
           ANG  T + TG       +W  D+++     EP        D G+         GH  C 
Sbjct: 204 ANGSKTKMATGSWDTMLKIWSTDVRSGGGDSEPSTSKRQKLDQGSARTPLMTLAGHRECI 263

Query: 211 RRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTS---LSYNEL 267
             V+++   + ++ S  +  +K W        DL  +   G+ S I+G  S   LSY++L
Sbjct: 264 SGVQWIDD-NTLVTSSWDHTIKIW--------DLALN---GIKSEISGNKSFFDLSYSKL 311

Query: 268 AG----ERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE------ 317
            G       +  L L+DP+        NTY  +   V  +  S T EY+ ++G       
Sbjct: 312 NGLIITASPDKNLRLYDPKSNQGTLVKNTYLGHTQWVQSVRWSTTNEYLFVSGAYDNHVK 371

Query: 318 ----KIHGASIHDLISHNNRNLA 336
               +   A I +LI H ++ LA
Sbjct: 372 LWDYRSPKAPIFELIGHEDKVLA 394


>gi|91217748|ref|ZP_01254704.1| putative lipoprotein [Psychroflexus torquis ATCC 700755]
 gi|91184086|gb|EAS70473.1| putative lipoprotein [Psychroflexus torquis ATCC 700755]
          Length = 379

 Score = 37.0 bits (84), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 1/92 (1%)

Query: 22  PNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           P      +L N+A  I    + D       L+ A +T V  P   NLE+ +  W  A I 
Sbjct: 38  PTFDRGVMLTNWADNIIIPSFTDFGTKTSALEVATQTFVDDPTTVNLESLQSSWFNAYIS 97

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFID 112
           +Q+  ++  G      +  ++NA+P +   ID
Sbjct: 98  FQEVSLFEIGKAEEINYRIRLNAYPTNVSKID 129


>gi|160874091|ref|YP_001553407.1| putative lipoprotein [Shewanella baltica OS195]
 gi|160859613|gb|ABX48147.1| putative lipoprotein [Shewanella baltica OS195]
 gi|315266324|gb|ADT93177.1| Peptidase M75, Imelysin [Shewanella baltica OS678]
          Length = 386

 Score = 37.0 bits (84), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 64/324 (19%), Positives = 119/324 (36%), Gaps = 97/324 (29%)

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R+P++Q E + FG     + D  +++WPL+                              
Sbjct: 96  RLPWEQGESHIFGPVDSLSIDPHLDSWPLN------------------------------ 125

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNI-------TTGYHVIEFLLWGQDLKTNVRE 190
                        + DL  +L+  +G D            G+H IEFLL+G  +  N   
Sbjct: 126 -------------TTDLQTQLNTNSGFDAETIKGWNDDVQGFHTIEFLLFGDGVNGNT-- 170

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW----GPDGQATK---D 243
              +P +             +  EYL  ++++     +++  AW     P   A K   +
Sbjct: 171 ---KPISQL---------TAKEREYLIALAEVFRDYTKQLDDAWQINHNPQDAAAKPYAE 218

Query: 244 LMKDINAGLNSI-----------ITGMTSL---SYNELAGERMNLGLILHDPEQEIDCFS 289
           L+K+     N+I           I GM ++     N    +     L   D  +    +S
Sbjct: 219 LLKNPGVAGNTIYSSQLAVVEELINGMIAIVDEVGNGKIADPFGDSLATADTSKVESQYS 278

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
            N+   + N++IG+ + Y GE+   +  +     I + ++  + NLA  ++ +      D
Sbjct: 279 WNSLDDFANNIIGVRNVYQGEFTGNSDRQ----GIINFVAAADANLATRVSSEI-----D 329

Query: 350 FHILKDRA---ENIESFDQMISEN 370
             I+K RA    N + F Q I ++
Sbjct: 330 DAIIKIRAIAGSNQQPFRQAIKDD 353


>gi|170682431|ref|YP_001744323.1| hypothetical protein EcSMS35_2276 [Escherichia coli SMS-3-5]
 gi|170520149|gb|ACB18327.1| conserved hypothetical protein [Escherichia coli SMS-3-5]
          Length = 521

 Score = 37.0 bits (84), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 57/134 (42%), Gaps = 18/134 (13%)

Query: 282 EQEIDCFSDNTYASYLNDVIGIISSYTG---EYIRMNGEKIHGASIHDLISHNNRNLAQE 338
           +Q   CF + ++ S + D +           + IRM     H AS HDL   +  N++  
Sbjct: 282 QQCATCFHEKSFGSQIRDSLRASRERRAKGEQRIRMTLS--HAAS-HDLEIFHEENMSAV 338

Query: 339 INDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLIND-----------LIT 387
             +    T +D  I++ R + +     +  ENNP G  I R  IN            LI+
Sbjct: 339 RQNPRMTTFEDI-IVRKREQAVRIAALLELENNPHGTVITRESINSAIYLVDFYFQHLIS 397

Query: 388 QTESLRKIRIALDL 401
           + ESLR+I  A  L
Sbjct: 398 KLESLREISPAEKL 411


>gi|300823910|ref|ZP_07104033.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|300523542|gb|EFK44611.1| conserved hypothetical protein [Escherichia coli MS 119-7]
          Length = 521

 Score = 37.0 bits (84), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 57/136 (41%), Gaps = 22/136 (16%)

Query: 282 EQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEK-----IHGASIHDLISHNNRNLA 336
           +Q   CF + ++ S + D     S       R  GE+     +  A+ HDL   +  N++
Sbjct: 282 QQCATCFHEKSFGSQIRD-----SLRASRERRAKGEQRIRMTLSHAASHDLEIFHEENMS 336

Query: 337 QEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLIND-----------L 385
               +    T +D  I++ R + +     +  ENNP G  I R  IN            L
Sbjct: 337 AVRQNPRMTTFEDI-IVRKREQAVRIAALLELENNPHGTVITRESINSAIYLVDFYFQHL 395

Query: 386 ITQTESLRKIRIALDL 401
           I++ ESLR+I  A  L
Sbjct: 396 ISKLESLREISPAEKL 411


>gi|255954569|ref|XP_002568037.1| Pc21g10020 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211589748|emb|CAP95899.1| Pc21g10020 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 605

 Score = 37.0 bits (84), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 47/103 (45%), Gaps = 14/103 (13%)

Query: 236 PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYAS 295
           PD    + L+ DI A L+S+I G+T ++ N +   R  +       E+ + CF D  +A 
Sbjct: 90  PDALGVQSLVSDIRARLSSVIFGLTEVNLNMMMSSRKII-------ERALRCFIDEIHAK 142

Query: 296 YLNDVI--GIISSYT-----GEYIRMNGEKIHGASIHDLISHN 331
               ++    +  Y+     G + R+ GE +      DL++ N
Sbjct: 143 KREALVVSDALKDYSRLEEDGVWARLQGELVTAGIASDLLTLN 185


>gi|152999473|ref|YP_001365154.1| putative lipoprotein [Shewanella baltica OS185]
 gi|151364091|gb|ABS07091.1| putative lipoprotein [Shewanella baltica OS185]
          Length = 386

 Score = 37.0 bits (84), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 64/324 (19%), Positives = 119/324 (36%), Gaps = 97/324 (29%)

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R+P++Q E + FG     + D  +++WPL+                              
Sbjct: 96  RLPWEQGESHIFGPVDSLSIDPHLDSWPLN------------------------------ 125

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNI-------TTGYHVIEFLLWGQDLKTNVRE 190
                        + DL  +L+  +G D            G+H IEFLL+G  +  N   
Sbjct: 126 -------------TTDLQTQLNTNSGFDAETIKGWNDDVQGFHTIEFLLFGDGVNGNT-- 170

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW----GPDGQATK---D 243
              +P +             +  EYL  ++++     +++  AW     P   A K   +
Sbjct: 171 ---KPISQL---------TAKEREYLIALAEVFRDYTKQLDDAWQINHNPQDTAAKPYAE 218

Query: 244 LMKDINAGLNSI-----------ITGMTSL---SYNELAGERMNLGLILHDPEQEIDCFS 289
           L+K+     N+I           I GM ++     N    +     L   D  +    +S
Sbjct: 219 LLKNPGVAGNTIYSSQLAVVEELINGMIAIVDEVGNGKIADPFGDSLATADTSKVESQYS 278

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
            N+   + N++IG+ + Y GE+   +  +     I + ++  + NLA  ++ +      D
Sbjct: 279 WNSLDDFANNIIGVRNVYQGEFTGNSDRQ----GIINFVAAADANLATRVSSEI-----D 329

Query: 350 FHILKDRA---ENIESFDQMISEN 370
             I+K RA    N + F Q I ++
Sbjct: 330 DAIIKIRAIAGSNQQPFRQAIKDD 353


>gi|170031859|ref|XP_001843801.1| WD repeat protein 12 [Culex quinquefasciatus]
 gi|167871200|gb|EDS34583.1| WD repeat protein 12 [Culex quinquefasciatus]
          Length = 405

 Score = 37.0 bits (84), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 82/203 (40%), Gaps = 39/203 (19%)

Query: 161 ANGIDTNITTGYHVIEFLLWGQDLKTNV--REPGNRPYTDFDIGNCT------GGH--CR 210
           ANG  T + TG       +W  D+++     EP        D G+         GH  C 
Sbjct: 184 ANGSKTKMATGSWDTMLKIWSTDVRSGGGDSEPSTSKRQKLDQGSARTPLMTLAGHRECI 243

Query: 211 RRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTS---LSYNEL 267
             V+++   + ++ S  +  +K W        DL  +   G+ S I+G  S   LSY++L
Sbjct: 244 SGVQWIDD-NTLVTSSWDHTIKIW--------DLALN---GIKSEISGNKSFFDLSYSKL 291

Query: 268 AG----ERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE------ 317
            G       +  L L+DP+        NTY  +   V  +  S T EY+ ++G       
Sbjct: 292 NGLIITASPDKNLRLYDPKSNQGTLVKNTYLGHTQWVQSVRWSTTNEYLFVSGAYDNHVK 351

Query: 318 ----KIHGASIHDLISHNNRNLA 336
               +   A I +LI H ++ LA
Sbjct: 352 LWDYRSPKAPIFELIGHEDKVLA 374


Searching..................................................done


Results from round 2




>gi|254780635|ref|YP_003065048.1| hypothetical protein CLIBASIA_02610 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040312|gb|ACT57108.1| hypothetical protein CLIBASIA_02610 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 412

 Score =  596 bits (1536), Expect = e-168,   Method: Composition-based stats.
 Identities = 412/412 (100%), Positives = 412/412 (100%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT
Sbjct: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
           TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK
Sbjct: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
           ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW
Sbjct: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA
Sbjct: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
           TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV
Sbjct: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI
Sbjct: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP 412
           ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP
Sbjct: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP 412


>gi|222147269|ref|YP_002548226.1| hypothetical protein Avi_0335 [Agrobacterium vitis S4]
 gi|221734259|gb|ACM35222.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 425

 Score =  573 bits (1476), Expect = e-161,   Method: Composition-based stats.
 Identities = 215/398 (54%), Positives = 290/398 (72%), Gaps = 1/398 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           +++     S A         + VL++YA +A AKY+D+L  A+TLD+A++ L+  P+K  
Sbjct: 11  LALFIASTSFAAPAAKAPEADAVLKHYAELAEAKYQDSLTTAKTLDAAVDALLAKPSKST 70

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  WI+AR+PYQQSEVYRFGNKIVD W+ KVNAWPLDEG IDYVD SYG E++ N 
Sbjct: 71  LNKARSAWIKARVPYQQSEVYRFGNKIVDDWEGKVNAWPLDEGLIDYVDKSYGTESDTNA 130

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLK 185
           LYTAN+IAN+KI +N +E+D + ++PD L  KL  A G++ N+ TGYH IEFLLWGQDL 
Sbjct: 131 LYTANVIANTKIKINGEEVDATNLTPDFLANKLQEAGGVEANVATGYHAIEFLLWGQDLN 190

Query: 186 TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM 245
                 GNRP+TD+D+ NCTGGHC RR +YLK  S +LVSDL+EM+ AW P+G+ATK L+
Sbjct: 191 GTGPGAGNRPFTDYDLKNCTGGHCDRRAQYLKSASTLLVSDLQEMVDAWKPEGEATKTLL 250

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
            D  +GL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D +GI S
Sbjct: 251 ADPTSGLKAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTHNSHYYDALGIRS 310

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQ 365
           +YTG+Y R++G K+ G S+ DL++  ++ L +E+  K + TMK    L  RA+++E +DQ
Sbjct: 311 AYTGKYTRIDGTKMTGPSLSDLVAAKDKALDKEMKSKLNTTMKAMTALVKRAKSVEHYDQ 370

Query: 366 MISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           MI+ENN +GN  V+  I+ LI QT+S++++  ALDL E
Sbjct: 371 MIAENNKDGNATVQAGIDGLIDQTKSIQRVVAALDLGE 408


>gi|187479059|ref|YP_787084.1| hypothetical protein BAV2579 [Bordetella avium 197N]
 gi|115423646|emb|CAJ50191.1| putative exported protein [Bordetella avium 197N]
          Length = 430

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 197/392 (50%), Positives = 264/392 (67%), Gaps = 13/392 (3%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
             + V++ Y+ IA A Y+DAL  A+TL  AI+ L+  P++  L+ AR  WI AR PYQQ+
Sbjct: 24  EPKAVVKTYSDIAAAGYQDALTSAKTLQQAIDALIAQPSEATLKAAREAWIVARAPYQQT 83

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EV+RFGN +VD W+ +VNAWPLDEG IDYVD+ YG E+++N  Y  N+IANSKI V  K 
Sbjct: 84  EVFRFGNPVVDDWEGRVNAWPLDEGLIDYVDAGYGTESDDNAFYAVNVIANSKISVGGKT 143

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE------------P 191
           ID   ++P+LL + LH A+G + N+ TGYH IEFLLWGQDL                   
Sbjct: 144 IDAGKLTPELLAEVLHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPKDRKGTPQERHA 203

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
           GNRP+TDFD  +CTGG+C RRV YLKVV+++LV DL+EM   W  DG A K + +D  AG
Sbjct: 204 GNRPHTDFDPKHCTGGNCERRVAYLKVVTQLLVDDLKEMAGQWQDDGDARKVVQEDPKAG 263

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L +++TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  + IGI + Y G Y
Sbjct: 264 LVAMLTGMGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYNQIGIRNVYLGAY 323

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENN 371
            R +G+++ GAS+ DL+   +  L  E+  K + T+     ++DRAE +E++DQMI+E N
Sbjct: 324 TRPDGKQVSGASLSDLVKEKDPKLDTEVRAKLNATVAAMQAMRDRAEKVETYDQMIAEGN 383

Query: 372 PEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
            EGN IV+  I+ LI QT S  ++   LDL +
Sbjct: 384 KEGNAIVQAAIDRLIDQTRSFERVIALLDLGD 415


>gi|311107741|ref|YP_003980594.1| imelysin [Achromobacter xylosoxidans A8]
 gi|310762430|gb|ADP17879.1| imelysin family protein 2 [Achromobacter xylosoxidans A8]
          Length = 432

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 200/398 (50%), Positives = 267/398 (67%), Gaps = 13/398 (3%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           +    V  + V+  Y+ +A A YED+L  A+TL +AI+ L+  P+ + L+ AR  W+ AR
Sbjct: 18  TAQAAVEPKAVVATYSDLALAGYEDSLTSAKTLRTAIDALIAKPSAETLKAAREAWLAAR 77

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
           +PYQQ+E YRFGN IVD W+ +VNAWPLDEG IDYVD+SYG EN+EN  Y  N+IANSKI
Sbjct: 78  VPYQQTEAYRFGNPIVDDWEGRVNAWPLDEGLIDYVDASYGTENDENAYYAVNVIANSKI 137

Query: 139 IVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE------- 190
            V  K +D+S I+P LL + LH A+G + N+ TGYH IEFLLWGQDL             
Sbjct: 138 SVGGKTVDVSKITPKLLSEILHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPADRKGT 197

Query: 191 -----PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM 245
                 GNRP+TDFD   CTGGHC RRVE+LK V+ +LV+DLEEM+  W  DG A K + 
Sbjct: 198 PQERHAGNRPHTDFDTKQCTGGHCERRVEFLKAVTDLLVTDLEEMVGNWKKDGAARKAVE 257

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
           +D  AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D IGI +
Sbjct: 258 EDPKAGLIAMLTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYDQIGIRN 317

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQ 365
            Y G Y R++G+ + GAS+ +L+   +  L  E+  K   T+     +K RAE +E++DQ
Sbjct: 318 VYLGAYTRIDGKTVKGASLSELVKARDPKLDAEVRAKLDATVAAMQAMKTRAETVETYDQ 377

Query: 366 MISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           MIS+ N EGN +V+  I+ L+ QT SL ++   LDL +
Sbjct: 378 MISDGNKEGNAVVQAAIDRLVDQTRSLERVIALLDLGK 415


>gi|33596872|ref|NP_884515.1| hypothetical protein BPP2269 [Bordetella parapertussis 12822]
 gi|33573573|emb|CAE37567.1| putative exported protein [Bordetella parapertussis]
          Length = 434

 Score =  564 bits (1453), Expect = e-158,   Method: Composition-based stats.
 Identities = 192/418 (45%), Positives = 268/418 (64%), Gaps = 13/418 (3%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +    +   L       V     + V+Q Y+ IA A Y+DAL  A+ L +AI+ L+  
Sbjct: 3   KLLRKTVLALALGMTTPLAVAAAQPKAVVQTYSDIALAGYQDALASAQALRTAIDALIAA 62

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ + L+ AR  W+ AR+PYQQ+E +RFGN +VD W+ +VNAWPLDEG IDYVD++YG E
Sbjct: 63  PSAQTLQAARQAWLAARVPYQQTEAFRFGNPVVDDWEGRVNAWPLDEGLIDYVDAAYGTE 122

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
           ++ N  YT N+IAN++I V  K ID S I+P LL + LH A+G + N+ TGYH IEFLLW
Sbjct: 123 SDANAFYTVNVIANARISVGGKTIDASKITPQLLSEVLHEADGNEANVATGYHAIEFLLW 182

Query: 181 GQDLKTNVRE------------PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLE 228
           GQDL                   G+RP+TDFD   CTGG+C RRV+YLK V+ +LV DL+
Sbjct: 183 GQDLNGTGPAPKDRTGTPQERHAGDRPHTDFDPRQCTGGNCERRVQYLKAVTDLLVDDLQ 242

Query: 229 EMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCF 288
           EM+  W   G A K + +D  AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCF
Sbjct: 243 EMVDNWKAGGAARKVVEEDPKAGLIAMMTGLGSLSYGELAGERMKLGLMLHDPEEEHDCF 302

Query: 289 SDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMK 348
           SDNT+ S+  + IGI + Y G Y R++G+ + GAS+ DL+   +  L  E+  K   T++
Sbjct: 303 SDNTHNSHYYNQIGIRNVYLGNYARIDGKTVSGASLSDLVKAKDAKLDAEVRAKLDATVQ 362

Query: 349 DFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
               +K RAE +E++DQMI++ N EGN +V+  I+ L+ QT SL ++  AL+L +   
Sbjct: 363 AMEAMKQRAETVETYDQMIAQGNKEGNAVVQAAIDRLVDQTRSLERVIAALELGDIEL 420


>gi|159184243|ref|NP_353318.2| hypothetical protein Atu0288 [Agrobacterium tumefaciens str. C58]
 gi|159139571|gb|AAK86103.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 425

 Score =  564 bits (1453), Expect = e-158,   Method: Composition-based stats.
 Identities = 212/403 (52%), Positives = 287/403 (71%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
            + + +  +    AL          V+++YA +AHAKYED+L  A+ LD AI+ L+ TP+
Sbjct: 9   ASFVLLAASAAFTALPAQAATDAAAVIKHYADVAHAKYEDSLTTAKALDKAIDALIATPS 68

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           ++ L+ AR  WI+AR+PYQQSEVYRFGN +VD W+ KVNAWPLDEG IDYVD+SYG E++
Sbjct: 69  EETLKAAREAWIKARVPYQQSEVYRFGNPLVDAWEGKVNAWPLDEGLIDYVDASYGTESD 128

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
           EN LY ANIIAN KI ++ +E+D S I+P+L+  LH A  ++ N+TTGYH IEFLLWGQD
Sbjct: 129 ENELYVANIIANPKIKISGEEVDASKITPELIESLHEAGDVEANVTTGYHAIEFLLWGQD 188

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
           L       GNRPYTD+D   CT G+C RR +YLK  S +LV DL+EM+ AW P+G+ATK 
Sbjct: 189 LNGTGPGAGNRPYTDYDKAKCTNGNCDRRADYLKSASSLLVKDLQEMVDAWAPEGEATKT 248

Query: 244 LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           +  D  AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI
Sbjct: 249 VEADPKAGLTAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGI 308

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESF 363
            S+YTG+Y R++G K+ GAS+ +L+   ++ L  E+  K + T+   H ++ RA+ +E++
Sbjct: 309 ASAYTGDYTRVDGTKMTGASLAELVGAKDKALNDEMTAKLNKTLNAMHAMEKRAQTVEAY 368

Query: 364 DQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           DQMI E N EGN +V+  I+ LI QT+++ ++  ALDL +   
Sbjct: 369 DQMIGEGNKEGNAVVQAAIDGLIDQTKTVERVIAALDLGKIEL 411


>gi|325291722|ref|YP_004277586.1| iron-regulated protein [Agrobacterium sp. H13-3]
 gi|325059575|gb|ADY63266.1| putative iron-regulated protein [Agrobacterium sp. H13-3]
          Length = 425

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 211/391 (53%), Positives = 282/391 (72%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            AL          V+++YA +AHAKYED+L  A+ LD AI+ L+ TP++  L+ AR  WI
Sbjct: 21  TALPASAATDAADVVKHYADVAHAKYEDSLTTAKALDKAIDALIATPSEGTLKAAREAWI 80

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
           +AR+PYQQSEVYRFGN +VD W+ KVNAWPLDEG IDYVD SYG E++EN LY ANIIAN
Sbjct: 81  KARVPYQQSEVYRFGNPVVDAWEGKVNAWPLDEGLIDYVDGSYGTESDENELYVANIIAN 140

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
            KI ++ +++D S I+P+L+  LH A  ++ N+TTGYH IEFLLWGQDL       GNRP
Sbjct: 141 PKIKISGEDVDTSKITPELIESLHEAGDVEANVTTGYHAIEFLLWGQDLNGTGPGAGNRP 200

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI 255
           YTD+D  NCT G+C RR +YLK  S +L+ DL+EM+ AW P+G+ATK +  D  AGL +I
Sbjct: 201 YTDYDKKNCTNGNCDRRGDYLKSASTLLIKDLQEMVDAWAPEGEATKTVEADPKAGLTAI 260

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           +TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI S+YTGEY R++
Sbjct: 261 LTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIASAYTGEYTRVD 320

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGN 375
           G K+ GAS+ +L+   ++ L  E+  K + T+   H ++ RA+ +E++DQMI E N EGN
Sbjct: 321 GTKMTGASLSELVGAKDKALNDEMTAKLNKTLDAMHAMEKRAQTVEAYDQMIGEGNKEGN 380

Query: 376 KIVRNLINDLITQTESLRKIRIALDLIEPNR 406
            +V+  I+ L+ QT+++ ++  ALDL +   
Sbjct: 381 AVVQAAIDGLLDQTKTVERVIAALDLGKIEL 411


>gi|33592652|ref|NP_880296.1| hypothetical protein BP1561 [Bordetella pertussis Tohama I]
 gi|33572298|emb|CAE41851.1| putative exported protein [Bordetella pertussis Tohama I]
 gi|332382069|gb|AEE66916.1| hypothetical protein BPTD_1544 [Bordetella pertussis CS]
          Length = 436

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 192/418 (45%), Positives = 268/418 (64%), Gaps = 13/418 (3%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +    +   L       V     + V+Q Y+ IA A Y+DAL  A+ L +AI+ L+  
Sbjct: 5   KLLRKTVLALALGVATPLAVAAAQPKAVVQTYSDIALAGYQDALASAQALRTAIDALIAA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ + L+ AR  W+ AR+PYQQ+E +RFGN +VD W+ +VNAWPLDEG IDYVD++YG E
Sbjct: 65  PSAQTLQAARQAWLAARVPYQQTEAFRFGNPVVDDWEGRVNAWPLDEGLIDYVDAAYGTE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
           ++ N  YT N+IAN++I V  K ID S I+P LL + LH A+G + N+ TGYH IEFLLW
Sbjct: 125 SDANAFYTVNVIANARISVGGKTIDASKITPQLLSEVLHEADGNEANVATGYHAIEFLLW 184

Query: 181 GQDLKTNVRE------------PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLE 228
           GQDL                   G+RP+TDFD   CTGG+C RRV+YLK V+ +LV DL+
Sbjct: 185 GQDLNGTGPAPKDRTGTPQERHAGDRPHTDFDPRQCTGGNCERRVQYLKAVTDLLVDDLQ 244

Query: 229 EMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCF 288
           EM+  W   G A K + +D  AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCF
Sbjct: 245 EMVDNWKAGGAARKVVEEDPKAGLIAMMTGLGSLSYGELAGERMKLGLMLHDPEEEHDCF 304

Query: 289 SDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMK 348
           SDNT+ S+  + IGI + Y G Y R++G+ + GAS+ DL+   +  L  E+  K   T++
Sbjct: 305 SDNTHNSHYYNQIGIRNVYLGNYARIDGKTVSGASLSDLVKARDAKLDAEVRAKLDATVQ 364

Query: 349 DFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
               +K RAE +E++DQMI++ N EGN +V+  I+ L+ QT SL ++  AL+L +   
Sbjct: 365 AMEAMKQRAETVETYDQMIAQGNKEGNAVVQVAIDRLVDQTRSLERVIAALELGDIEL 422


>gi|293606599|ref|ZP_06688955.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292814984|gb|EFF74109.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 432

 Score =  563 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 197/398 (49%), Positives = 266/398 (66%), Gaps = 13/398 (3%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           +    V    V+  Y+ +A A YED+L  A+TL +AI  LV  P+   L+ AR  W+ AR
Sbjct: 18  TAHAAVEPRAVVATYSDLALAGYEDSLAAAKTLRTAINALVAKPSPDTLQAARQAWLAAR 77

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
           +PYQQ+E YRFGN IVD W+ +VNAWPLDEG IDYVD+SYG +N+EN  Y+ N+IANSKI
Sbjct: 78  VPYQQTEAYRFGNPIVDDWEGRVNAWPLDEGLIDYVDASYGTDNDENAYYSVNVIANSKI 137

Query: 139 IVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE------- 190
            V  K +D+S I+P LL + LH A+G + N+ TGYH IEFLLWGQDL             
Sbjct: 138 SVGGKTVDVSKITPQLLSEVLHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPADRKGT 197

Query: 191 -----PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM 245
                 GNRP+TDFD   CTGGHC RR+E+LK V+ +LV+DLEEM+  W  DG A K + 
Sbjct: 198 PQERHAGNRPHTDFDTKQCTGGHCERRIEFLKAVTDLLVTDLEEMVGNWKKDGAARKAVE 257

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
           +D  AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D IGI +
Sbjct: 258 EDPKAGLIAMLTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYDQIGIRN 317

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQ 365
            Y G Y R++G+++ GAS+ +L+   +  L  E+  K   T+     +K RAE +E++DQ
Sbjct: 318 VYLGTYTRIDGKQVTGASLSELVKARDPKLDAEVRAKLDATVAAMQAMKTRAETVETYDQ 377

Query: 366 MISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           MI++ N EGN +V+  I+ L+ QT SL ++   L+L +
Sbjct: 378 MIADGNKEGNAVVQAGIDRLVDQTRSLERVITLLELGK 415


>gi|33600706|ref|NP_888266.1| hypothetical protein BB1721 [Bordetella bronchiseptica RB50]
 gi|33568306|emb|CAE32218.1| putative exported protein [Bordetella bronchiseptica RB50]
          Length = 434

 Score =  563 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 192/418 (45%), Positives = 268/418 (64%), Gaps = 13/418 (3%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +    +   L       V     + V+Q Y+ IA A Y+DAL  A+ L +AI+ L+  
Sbjct: 3   KLLRKTVLALALGMATPLAVAAAQPKAVVQTYSDIALAGYQDALASAQALRTAIDALIAA 62

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ + L+ AR  W+ AR+PYQQ+E +RFGN +VD W+ +VNAWPLDEG IDYVD++YG E
Sbjct: 63  PSAQTLQAARQAWLAARVPYQQTEAFRFGNPVVDDWEGRVNAWPLDEGLIDYVDAAYGTE 122

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
           ++ N  YT N+IAN++I V  K ID S I+P LL + LH A+G + N+ TGYH IEFLLW
Sbjct: 123 SDANAFYTVNVIANARISVGGKTIDASKITPQLLSEVLHEADGNEANVATGYHAIEFLLW 182

Query: 181 GQDLKTNVRE------------PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLE 228
           GQDL                   G+RP+TDFD   CTGG+C RRV+YLK V+ +LV DL+
Sbjct: 183 GQDLNGTGPAPKDRTGTPQERHAGDRPHTDFDPRQCTGGNCERRVQYLKAVTDLLVDDLQ 242

Query: 229 EMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCF 288
           EM+  W   G A K + +D  AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCF
Sbjct: 243 EMVDNWKAGGAARKVVEEDPKAGLIAMMTGLGSLSYGELAGERMKLGLMLHDPEEEHDCF 302

Query: 289 SDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMK 348
           SDNT+ S+  + IGI + Y G Y R++G+ + GAS+ DL+   +  L  E+  K   T++
Sbjct: 303 SDNTHNSHYYNQIGIRNVYLGNYARIDGKTVSGASLSDLVKAKDAKLDAEVRAKLDATVQ 362

Query: 349 DFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
               +K RAE +E++DQMI++ N EGN +V+  I+ L+ QT SL ++  AL+L +   
Sbjct: 363 AMEAMKQRAETVETYDQMIAQGNKEGNAVVQAAIDRLVDQTRSLERVIAALELGDIEL 420


>gi|317404824|gb|EFV85200.1| exported protein [Achromobacter xylosoxidans C54]
          Length = 432

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 197/398 (49%), Positives = 267/398 (67%), Gaps = 13/398 (3%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           ++      + V+ NY+ +A A YEDAL  A+TL  AI  LV  P+   L+ AR  W+ AR
Sbjct: 18  TVHAATQPKAVVTNYSDLALAGYEDALTSAKTLREAINALVAKPSADTLKAARQAWLDAR 77

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
           +PYQQ+E +RFGN IVD W+ +VNAWPLDEG IDYVD+SYG EN+EN  Y  N+IANSKI
Sbjct: 78  VPYQQTEAFRFGNPIVDDWEGRVNAWPLDEGLIDYVDASYGTENDENAYYAVNVIANSKI 137

Query: 139 IVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP------ 191
            V  K +D+S I+P LL + LH A+G + N+ TGYH IEFLLWGQDL      P      
Sbjct: 138 SVGGKTVDVSEITPKLLSEVLHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPADRKGT 197

Query: 192 ------GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM 245
                 GNRP+TD+D+  CTGG+C RR+ YLK V+ +LV+DLEEM+  W  DG A K + 
Sbjct: 198 PQERHSGNRPHTDYDVKQCTGGNCERRIAYLKAVTDLLVTDLEEMVGNWQKDGAARKAVE 257

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
           +D  AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  + IGI +
Sbjct: 258 EDPKAGLVAMLTGVGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHFYNQIGIRN 317

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQ 365
            Y G Y R++G+++ GAS+ +L+   +  L  E+  K   T+     +K RAE +E++DQ
Sbjct: 318 VYLGAYTRVDGKQVSGASLSELVKARDPKLDAEVRAKLDATVAAMQAMKTRAETVETYDQ 377

Query: 366 MISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           MI++ N EGN +V+  I+ L+ QT SL ++   LDL +
Sbjct: 378 MIADGNKEGNAVVQAAIDRLVDQTRSLERVIALLDLGK 415


>gi|222084586|ref|YP_002543115.1| hypothetical protein Arad_0521 [Agrobacterium radiobacter K84]
 gi|221722034|gb|ACM25190.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 425

 Score =  554 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 204/390 (52%), Positives = 276/390 (70%), Gaps = 1/390 (0%)

Query: 14  PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ 73
            S    +        ++++YA +AHAKYED+L+ A+ LD AI+ L+  P+ K L+ A+  
Sbjct: 17  TSAVPVLAKAPEPAAIIKHYAEVAHAKYEDSLITAKALDKAIDALLANPSDKTLKAAQAA 76

Query: 74  WIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
           WI+AR+PYQQSEVYRFGN IVD W+ KVN+WPLDEG IDYVD+SYG E++EN+LY AN+I
Sbjct: 77  WIKARVPYQQSEVYRFGNPIVDDWEGKVNSWPLDEGLIDYVDASYGTESDENSLYVANVI 136

Query: 134 ANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           AN  I +N K++D S ++P+ L   LH+A G++ N+ TGYH IEFLLWGQDL       G
Sbjct: 137 ANKTIKINGKDVDTSHLTPEFLSGTLHQAGGVEANVATGYHAIEFLLWGQDLHGTGPGAG 196

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGL 252
            RP TD+D+ NCT G+C RR EYLK  S +LVSDL+EM + W PDG+ATK +  D  AGL
Sbjct: 197 ERPATDYDLKNCTHGNCDRRAEYLKSASTLLVSDLQEMTEKWTPDGEATKHVEADPKAGL 256

Query: 253 NSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYI 312
            +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+ ND IGI ++Y G Y 
Sbjct: 257 AAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHNNDAIGIAAAYNGNYT 316

Query: 313 RMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNP 372
           R++G+K+ G S+HDL++  ++ L +E+  K + T+     +  R E +E +DQMI E N 
Sbjct: 317 RIDGKKLKGPSLHDLVAAKDKALDKEVETKLNATLDAMKAMVHRGETVEKYDQMIGEGNT 376

Query: 373 EGNKIVRNLINDLITQTESLRKIRIALDLI 402
            GN  V+  I+ L+ QT+S++++  ALDL 
Sbjct: 377 VGNATVQKAIDGLLDQTKSIQRVVAALDLG 406


>gi|218673655|ref|ZP_03523324.1| putative iron-regulated protein [Rhizobium etli GR56]
          Length = 429

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 202/370 (54%), Positives = 268/370 (72%), Gaps = 1/370 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  +  P+   L+ AR  WI+AR+PYQQ+EVYR
Sbjct: 60  VVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPSDATLKAAREAWIKARVPYQQTEVYR 119

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN +VD W+ KVNAWPLDEG IDYVD SYG E++EN+LY AN+IAN  I ++ K++D S
Sbjct: 120 FGNPVVDEWEGKVNAWPLDEGLIDYVDPSYGTESDENSLYVANVIANKTIKIDGKDVDAS 179

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+ NCT G
Sbjct: 180 KLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDLKNCTHG 239

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 240 NCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGSLSYGEL 299

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G S+HDL
Sbjct: 300 AGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLTGPSLHDL 359

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L  E+  K + T+   + +  R E +E +DQMI E N EGN +V+  I+ LI 
Sbjct: 360 VAAKDKALDAEMEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAAIDGLID 419

Query: 388 QTESLRKIRI 397
           QT+S++++  
Sbjct: 420 QTKSIQRVIA 429


>gi|163738590|ref|ZP_02146004.1| lipoprotein, putative [Phaeobacter gallaeciensis BS107]
 gi|163743022|ref|ZP_02150405.1| lipoprotein, putative [Phaeobacter gallaeciensis 2.10]
 gi|161383705|gb|EDQ08091.1| lipoprotein, putative [Phaeobacter gallaeciensis 2.10]
 gi|161387918|gb|EDQ12273.1| lipoprotein, putative [Phaeobacter gallaeciensis BS107]
          Length = 422

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 190/376 (50%), Positives = 256/376 (68%), Gaps = 2/376 (0%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +VL  YA IAHAKY+D+L  A+TL +A+++L+  P+ + LE AR  W+ AR+PYQQSEV+
Sbjct: 28  EVLTTYANIAHAKYQDSLETAKTLQTAVDSLIAEPSAEALEAARKAWLAARVPYQQSEVF 87

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   +EN L   NI+AN    ++ K ID 
Sbjct: 88  RFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPTDENTLAALNIVANPSFELSGKSIDA 147

Query: 148 SIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCT 205
           S I+P+LL   LH A+G++ N+ TGYH IEFLLWGQDL       G+R +TD+  G +CT
Sbjct: 148 SAITPELLETTLHEADGVEANVATGYHAIEFLLWGQDLNGTDHGAGSRAWTDYAAGEDCT 207

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYN 265
            G+C RR EYLK  + +L+SDLE M   WG +G+A   L+ D NAG+ +++TGM SLSY 
Sbjct: 208 NGNCDRRGEYLKAATDLLISDLEWMAAQWGTEGEARGTLLSDENAGITAMLTGMGSLSYG 267

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G+ + Y GEYIR +G  + GAS+ 
Sbjct: 268 ETAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGVQNVYLGEYIRTDGSMVSGASLS 327

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           DL+   +  L  E+  K S TM+    +K  AE   S+DQM+ + N  G  +V   +N L
Sbjct: 328 DLVQEIDPALDGEMRSKLSTTMRALGQIKTAAEAGFSYDQMLEQGNEAGEALVMGGVNGL 387

Query: 386 ITQTESLRKIRIALDL 401
           + QT S+ ++  ALDL
Sbjct: 388 VDQTRSIERVVTALDL 403


>gi|190889971|ref|YP_001976513.1| hypothetical protein RHECIAT_CH0000341 [Rhizobium etli CIAT 652]
 gi|190695250|gb|ACE89335.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 424

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 205/375 (54%), Positives = 273/375 (72%), Gaps = 1/375 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  +  P  + L+ AR  WI+AR+PYQQ+EVYR
Sbjct: 32  VVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPTDETLKAARDAWIKARVPYQQTEVYR 91

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN +VD W+ KVNAWPLDEG IDYVD SYG E++EN+LY AN+IAN  I ++ K++D S
Sbjct: 92  FGNPVVDEWEGKVNAWPLDEGLIDYVDPSYGSESDENSLYVANVIANKTIKIDGKDVDAS 151

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+ NCT G
Sbjct: 152 KLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDLKNCTHG 211

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 212 NCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGSLSYGEL 271

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G S+HDL
Sbjct: 272 AGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSGPSLHDL 331

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L  E+  K + T+   + +  R E +E +DQMI+E N +GN +V+  I+ LI 
Sbjct: 332 VAAKDKALDAELEGKLNKTLDAMNSMAKRGETVEKYDQMIAEGNKDGNAVVQAAIDGLID 391

Query: 388 QTESLRKIRIALDLI 402
           QT+S++++  ALDL 
Sbjct: 392 QTKSIQRVIAALDLG 406


>gi|116250090|ref|YP_765928.1| iron-regulated protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254738|emb|CAK05812.1| putative iron-regulated protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 424

 Score =  549 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 205/381 (53%), Positives = 272/381 (71%), Gaps = 1/381 (0%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
                 V+++YA +AHAKYED+L  A+ LD+AI+  +  P    L+ AR  WI+AR+PYQ
Sbjct: 26  ETDAAAVVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPTDATLKAAREAWIKARVPYQ 85

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNE 142
           Q+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG E++EN+LY AN+IAN  I ++ 
Sbjct: 86  QTEVYRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGTESDENSLYVANVIANKTIKIDG 145

Query: 143 KEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
           K++D S ++P+ +   L  A GI+ N+ TGYH IEFLLWGQDL       G+RP TD+D+
Sbjct: 146 KDVDASKLTPEFISGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGDRPATDYDL 205

Query: 202 GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTS 261
            NCT G+C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM S
Sbjct: 206 KNCTHGNCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGS 265

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G
Sbjct: 266 LSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSG 325

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
            S+HDL++  ++ L  E+  K + T+   + +  R E +E +DQMI E N EGN +V+  
Sbjct: 326 PSLHDLVAAKDKALDAEVEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAA 385

Query: 382 INDLITQTESLRKIRIALDLI 402
           I+ LI QT+S++++  ALDL 
Sbjct: 386 IDGLIDQTKSVQRVIAALDLG 406


>gi|86355961|ref|YP_467853.1| hypothetical protein RHE_CH00304 [Rhizobium etli CFN 42]
 gi|86280063|gb|ABC89126.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 424

 Score =  548 bits (1413), Expect = e-154,   Method: Composition-based stats.
 Identities = 205/381 (53%), Positives = 274/381 (71%), Gaps = 1/381 (0%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
                 V+++YA +AHAKYED+L  A+ LD+AI+  +  P  + L+ AR  WI+AR+PYQ
Sbjct: 26  ETDAAAVVKHYAEVAHAKYEDSLTTAKALDAAIDAFLKAPTDETLKAARDAWIKARVPYQ 85

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNE 142
           Q+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG E++EN+LY AN+IA+  I ++ 
Sbjct: 86  QTEVYRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGTESDENSLYVANVIASKTIKIDG 145

Query: 143 KEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
           K++D + ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+
Sbjct: 146 KDVDATKLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDL 205

Query: 202 GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTS 261
            NCT G+C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM S
Sbjct: 206 KNCTHGNCDRRAEYLKSASTLLVSDLQEMTDDWKPDGAATKNVEADPKAGLVAILTGMGS 265

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG+Y R++G K+ G
Sbjct: 266 LSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGDYTRVDGTKLGG 325

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
            S+HDL++  ++ L  E+  K + T+   + +  R E +E +DQMI+E N EGN +V+  
Sbjct: 326 PSLHDLVAAKDKALDAEMEGKLNKTLDAMNAMAKRGETVEKYDQMIAEGNKEGNAVVQAA 385

Query: 382 INDLITQTESLRKIRIALDLI 402
           I+ LI QT S++++  ALDL 
Sbjct: 386 IDGLIDQTTSIQRVIAALDLG 406


>gi|241207259|ref|YP_002978355.1| hypothetical protein Rleg_4578 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861149|gb|ACS58816.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 424

 Score =  548 bits (1413), Expect = e-154,   Method: Composition-based stats.
 Identities = 205/379 (54%), Positives = 272/379 (71%), Gaps = 1/379 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
               V+++YA +AHAKYED+L  A+ LD+AI+  +  P    L+ AR  WI+AR+PYQQ+
Sbjct: 28  DAASVVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPTDATLKAAREAWIKARVPYQQT 87

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG E++EN+LY AN+IAN  I ++ K+
Sbjct: 88  EVYRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGTESDENSLYVANVIANKTIKIDGKD 147

Query: 145 IDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           +D S ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       G+RP TD+D+ N
Sbjct: 148 VDASKLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGDRPATDYDLKN 207

Query: 204 CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLS 263
           CT G+C RR EYLK  S +LV+DL+EM   W PDG ATK++  D  AGL +I+TGM SLS
Sbjct: 208 CTHGNCDRRAEYLKSASTLLVTDLQEMTDNWTPDGAATKNVEADPKAGLVAILTGMGSLS 267

Query: 264 YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
           Y ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G S
Sbjct: 268 YGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSGPS 327

Query: 324 IHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLIN 383
           +HDL++  ++ L  E+  K + T+   + +  R E +E +DQMI E N EGN +V+  I+
Sbjct: 328 LHDLVAAKDKALDAEVEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAAID 387

Query: 384 DLITQTESLRKIRIALDLI 402
            LI QT+S++++  ALDL 
Sbjct: 388 GLIDQTKSVQRVIAALDLG 406


>gi|327192006|gb|EGE58987.1| hypothetical protein RHECNPAF_2530063 [Rhizobium etli CNPAF512]
          Length = 424

 Score =  548 bits (1413), Expect = e-154,   Method: Composition-based stats.
 Identities = 204/375 (54%), Positives = 272/375 (72%), Gaps = 1/375 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  +  P  + L+ AR  WI+AR+PYQQ+EVYR
Sbjct: 32  VVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPTDETLKAARDAWIKARVPYQQTEVYR 91

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN +VD W+ KVNAWPLDEG IDYVD SYG E++EN+LY AN+IAN  I ++ K++D S
Sbjct: 92  FGNPVVDEWEGKVNAWPLDEGLIDYVDPSYGSESDENSLYVANVIANKTIKIDGKDVDAS 151

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+ NCT G
Sbjct: 152 KLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDLKNCTHG 211

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 212 NCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGSLSYGEL 271

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNT  S+LND IGI ++YTG Y R++G K+ G S+HDL
Sbjct: 272 AGERMKLGLLLHDPEEEHDCFSDNTDNSHLNDAIGIAAAYTGNYTRVDGTKLSGPSLHDL 331

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L  E+  K + T+   + +  R E +E +DQMI+E N +GN +V+  I+ LI 
Sbjct: 332 VAAKDKALDAELEGKLNKTLDAMNAMAKRGETVEKYDQMIAEGNKDGNAVVQAAIDGLID 391

Query: 388 QTESLRKIRIALDLI 402
           QT+S++++  ALDL 
Sbjct: 392 QTKSIQRVIAALDLG 406


>gi|254475879|ref|ZP_05089265.1| insulin-cleaving metalloproteinase outer membrane protein [Ruegeria
           sp. R11]
 gi|214030122|gb|EEB70957.1| insulin-cleaving metalloproteinase outer membrane protein [Ruegeria
           sp. R11]
          Length = 422

 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 194/379 (51%), Positives = 257/379 (67%), Gaps = 2/379 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
              +VL  YA IA AKYED+L+ A+TL SA++ L+  P+ + LE AR  W+ AR+PYQQS
Sbjct: 25  DKAEVLTTYANIAQAKYEDSLITAKTLQSAVDALIAAPSAEALEAARKAWLAARVPYQQS 84

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN L   N+IAN +  ++ K 
Sbjct: 85  EVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDENTLAALNVIANPQFELSGKA 144

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           ID S I+P LL   LH A+G++ N+ TGYH IEFLLWGQDL       G+RP+TDF  G 
Sbjct: 145 IDASAITPALLENTLHEADGVEANVATGYHAIEFLLWGQDLNGTDHGAGDRPWTDFAAGE 204

Query: 204 -CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSL 262
            CTGGHC RR EYLK  + +LVSDLE M   WG  G+A   LM D +AG+ +++TGM SL
Sbjct: 205 TCTGGHCDRRGEYLKAATDLLVSDLEWMAAQWGDAGEARSTLMADEDAGITAMLTGMGSL 264

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           SY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G+ + Y GEY+R+NGE + GA
Sbjct: 265 SYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGVQNVYLGEYVRVNGELVSGA 324

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+ DL++  +  L  E+  K + TM+    +K  AE   S+DQM+   N  G  +V   +
Sbjct: 325 SLSDLVAEQDSALDSELRGKLAQTMQALGRIKTAAEAGFSYDQMLEAGNEAGEALVMGGV 384

Query: 383 NDLITQTESLRKIRIALDL 401
           N LI QT S+ ++   L++
Sbjct: 385 NGLIDQTRSIERVVSLLNV 403


>gi|15964075|ref|NP_384428.1| putative signal peptide protein [Sinorhizobium meliloti 1021]
 gi|307301219|ref|ZP_07580981.1| Peptidase M75, Imelysin [Sinorhizobium meliloti BL225C]
 gi|307317890|ref|ZP_07597327.1| Peptidase M75, Imelysin [Sinorhizobium meliloti AK83]
 gi|15073251|emb|CAC41759.1| Hypothetical signal peptide protein [Sinorhizobium meliloti 1021]
 gi|306896292|gb|EFN27041.1| Peptidase M75, Imelysin [Sinorhizobium meliloti AK83]
 gi|306903675|gb|EFN34262.1| Peptidase M75, Imelysin [Sinorhizobium meliloti BL225C]
          Length = 426

 Score =  546 bits (1408), Expect = e-153,   Method: Composition-based stats.
 Identities = 208/404 (51%), Positives = 282/404 (69%), Gaps = 4/404 (0%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEK---VLQNYATIAHAKYEDALMCARTLDSAIETLV 59
           FI   ++     + AL++ P  +      V+++YA +AHAKYEDAL  A  L+ A++ L+
Sbjct: 5   FIRAAALALMTATSALALQPANAATDAAAVVKHYAAVAHAKYEDALATAEALEKAVDALI 64

Query: 60  TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYG 119
             P+++ L+ AR  W+RAR PYQ++EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG
Sbjct: 65  AGPSEETLKAAREAWLRARNPYQETEVYRFGNTIVDEWEGKVNAWPLDEGLIDYVDASYG 124

Query: 120 KENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFL 178
            E++EN L+TAN+IAN  I V+ +++D + I+P+LL   L  A GI+ N+ TGYH IEFL
Sbjct: 125 SESDENALFTANVIANKTIKVDGQDVDATNITPELLSGTLQEAGGIEANVATGYHAIEFL 184

Query: 179 LWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           LWGQDL       GNRPYTDFD   CT G+C RR  YLK  + +LVSDLEEM+  W PDG
Sbjct: 185 LWGQDLNGTGPGAGNRPYTDFDTKACTNGNCDRRAAYLKAATSLLVSDLEEMVANWTPDG 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            ATK +  D  AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+L+
Sbjct: 245 AATKAVEADPKAGLVAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTHNSHLH 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D IGI S+Y+GEY R++G K+ G S+ +L++  +  L +E+ D  + T++   ++  RAE
Sbjct: 305 DAIGIQSAYSGEYTRVDGSKLTGPSLSELVAAKDAALDKEMKDGLATTVEKMQVMAKRAE 364

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
             E++DQMI E N EGN  V+  I+ LI Q +++ ++  ALDL 
Sbjct: 365 TGEAYDQMIGEGNAEGNATVQAAIDGLIAQAKTVERVIAALDLG 408


>gi|209551882|ref|YP_002283799.1| hypothetical protein Rleg2_4315 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537638|gb|ACI57573.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 424

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 208/381 (54%), Positives = 272/381 (71%), Gaps = 1/381 (0%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
                 V+++YA +AHAKYED+L  A+ LD+AI+  + TP+   L++AR  WI+AR+PYQ
Sbjct: 26  ETDAAAVVKHYADVAHAKYEDSLTTAKALDAAIDAFLKTPDDATLKSARDAWIKARVPYQ 85

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNE 142
           Q+EVYRFGN IVD W+ KVNAWPLDEG IDYVD SYG EN+EN+LY AN+IAN  I ++ 
Sbjct: 86  QTEVYRFGNPIVDDWEGKVNAWPLDEGLIDYVDPSYGTENDENSLYVANVIANKTIKIDG 145

Query: 143 KEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
           K++D S ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+
Sbjct: 146 KDVDASKLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDL 205

Query: 202 GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTS 261
            NCT G+C RR EYLK  S +LVSDL+EM   W  DG ATK++  D  AGL +I+TGM S
Sbjct: 206 KNCTHGNCDRRAEYLKSASTLLVSDLQEMTDNWKADGAATKNVEADPKAGLVAILTGMGS 265

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G
Sbjct: 266 LSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSG 325

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
            S+HDL++  +  L  E+  K + T+   + +  R E +E +DQMI E N EGN +V+  
Sbjct: 326 PSLHDLVAAKDEALDAEMEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAA 385

Query: 382 INDLITQTESLRKIRIALDLI 402
           I+ LI QT+S++++  ALDL 
Sbjct: 386 IDGLIDQTKSVQRVIAALDLG 406


>gi|114766834|ref|ZP_01445761.1| lipoprotein, putative [Pelagibaca bermudensis HTCC2601]
 gi|114540955|gb|EAU44014.1| lipoprotein, putative [Roseovarius sp. HTCC2601]
          Length = 419

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 185/381 (48%), Positives = 254/381 (66%), Gaps = 2/381 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
               VL  YA IAHA YED+L+ A+ L  A++ L+  P+++ L  AR  W+ +R PYQQ+
Sbjct: 22  EKSAVLDTYADIAHAGYEDSLITAQALQEAVDALIAEPSEETLTAAREAWLASRNPYQQT 81

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EVYRFGN IVD W+ KVNAWPLDEG IDYVD SYG   +EN     NIIAN  + +  +E
Sbjct: 82  EVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDDSYGGATDENEYAALNIIANPSVTLAGQE 141

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           +D S I+P L+   L+ A+GI+TN+  GYH IEFLLWGQDL       G RPYTD+  G 
Sbjct: 142 VDASEITPTLIADTLNEADGIETNVARGYHAIEFLLWGQDLNGTEPGAGERPYTDYVTGE 201

Query: 204 -CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSL 262
            CTGG+C RR +YLK  + +LVSDLEEM+ AWG  G+A + +M+D NAG+ +++TGM SL
Sbjct: 202 ECTGGNCDRRADYLKAATDLLVSDLEEMVAAWGEGGEARETVMEDENAGIVAMLTGMGSL 261

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           SY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D  GI + Y G Y R++G  + GA
Sbjct: 262 SYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGKGIQNVYLGSYTRVDGSTVEGA 321

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+ DL++  +  L +E+  K   TM     +K+ AE   ++DQM++  + +G +++   +
Sbjct: 322 SLSDLVAETDAALDEEMKAKLDTTMAALGAIKEAAEGGFAYDQMLALGDEKGEELIMGGV 381

Query: 383 NDLITQTESLRKIRIALDLIE 403
           N LI QT S+ ++   LDL +
Sbjct: 382 NGLIDQTRSIERVVSTLDLSD 402


>gi|110633000|ref|YP_673208.1| imelysin [Mesorhizobium sp. BNC1]
 gi|110283984|gb|ABG62043.1| imelysin. Metallo peptidase. MEROPS family M75 [Chelativorans sp.
           BNC1]
          Length = 417

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 199/396 (50%), Positives = 263/396 (66%), Gaps = 1/396 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           + +  T  +  +S V       VL  YA IA A YED+L  AR+L SA+  L+ TP++  
Sbjct: 3   VPVAVTAVALGISAVHAEEPSAVLVTYADIAFAGYEDSLESARSLQSAVNALIATPSEDT 62

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  W+ AR+PYQQ+E +RFGN IVD W+ +VNAWPLDEG IDYVD+ YG E++ N 
Sbjct: 63  LVAARQAWLAARVPYQQTEAFRFGNPIVDEWEGRVNAWPLDEGLIDYVDAGYGTESDTNA 122

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
            YT N+IAN K+ V  + ID S I+P+L+R LH A GI++N+ TGYH IEFLLWGQDL  
Sbjct: 123 FYTVNVIANDKVSVGGEIIDTSQITPELIRSLHEAGGIESNVATGYHAIEFLLWGQDLNG 182

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
                G RP+TDFD  NCTGGHC RR +YL   + +LVSDL+EM+  W   G A   L +
Sbjct: 183 TGPGAGIRPHTDFDPANCTGGHCERRGQYLNAATALLVSDLQEMVSNWDAGGAARNALTQ 242

Query: 247 -DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
            D   GL +++TG+ SLSY ELAGERM LGL+L+DPE+E DCFSDNT+ S+  DV GI +
Sbjct: 243 GDPKVGLTALLTGLGSLSYGELAGERMKLGLLLNDPEEEHDCFSDNTHNSHFYDVQGIRN 302

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQ 365
            Y G Y RM GE + G+S+  L+   +  LA E+  K + T +    LK RAE++E++DQ
Sbjct: 303 VYFGRYERMGGEVVEGSSLAALVREKDAALADEMEAKLNATYEAAKNLKARAESVEAYDQ 362

Query: 366 MISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           MI E N EGN  V+ +I+ L+ QT SL ++  ALD+
Sbjct: 363 MIGEGNAEGNATVQAVIDGLVDQTRSLERVIAALDI 398


>gi|315122173|ref|YP_004062662.1| hypothetical protein CKC_02115 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495575|gb|ADR52174.1| hypothetical protein CKC_02115 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 433

 Score =  542 bits (1397), Expect = e-152,   Method: Composition-based stats.
 Identities = 302/407 (74%), Positives = 355/407 (87%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M+F TII+ + T PS+ LS+V +V    VL+NYATIAHAKYEDA++ ARTL+ AIETLV+
Sbjct: 27  MHFFTIITFILTFPSNVLSVVIDVDPIDVLRNYATIAHAKYEDAVISARTLNRAIETLVS 86

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
           +P++KNL+NARLQWI+ARIPYQQSE+YRFG+ IV+ WDKK+NAWP+DEG IDYVD SYGK
Sbjct: 87  SPSQKNLDNARLQWIKARIPYQQSEIYRFGSTIVNAWDKKINAWPIDEGVIDYVDISYGK 146

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
            N+EN LY ANIIAN+KI  + KEID SIISP LLRKLH  NGIDTNITTGYHVIEFLLW
Sbjct: 147 HNDENELYAANIIANTKISFDGKEIDTSIISPKLLRKLHFINGIDTNITTGYHVIEFLLW 206

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           GQDLKTNV   G RPYTDFDI  CTGG+C+RR+EYLKVVSKILVSDLEE+MK W PDG+ 
Sbjct: 207 GQDLKTNVHGSGERPYTDFDIKKCTGGNCQRRIEYLKVVSKILVSDLEELMKVWKPDGEE 266

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
           T ++MKD N GL++IITGMTSLSYNELAGERMNLGLILHDP+QE+DCFSDNTYASYLN+V
Sbjct: 267 TLNIMKDTNLGLDTIITGMTSLSYNELAGERMNLGLILHDPKQELDCFSDNTYASYLNNV 326

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           IGI+SSYTGEY R+NGE+IHG SIHDLI + N+NL+ EI +KF++TMKDF+ L +RAE+I
Sbjct: 327 IGILSSYTGEYTRINGEEIHGPSIHDLIKNKNKNLSAEIKNKFAHTMKDFYALAERAEHI 386

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRV 407
           ES+DQMIS NNPEGNKIV NLI+DLITQT SL+K+RIALDL E N +
Sbjct: 387 ESYDQMISANNPEGNKIVLNLIDDLITQTNSLKKLRIALDLKEINDL 433


>gi|86136374|ref|ZP_01054953.1| lipoprotein, putative [Roseobacter sp. MED193]
 gi|85827248|gb|EAQ47444.1| lipoprotein, putative [Roseobacter sp. MED193]
          Length = 422

 Score =  542 bits (1397), Expect = e-152,   Method: Composition-based stats.
 Identities = 190/403 (47%), Positives = 257/403 (63%), Gaps = 2/403 (0%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M  + + S      +   +        +VL NYA IA AKY+D+L  A TL  A++ L+ 
Sbjct: 1   MKNLFLTSSALAGLALCATPGLATEKAEVLANYANIAQAKYQDSLATAHTLQLAVDALIA 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
           TP+ + L  AR  W+ AR+PYQQSEV+RFGN IVD W+ KVNAWPLDEG IDYVD++YG 
Sbjct: 61  TPSAEALTAARQAWLAARVPYQQSEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDATYGG 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLL 179
            ++EN L   N+IAN    ++ K ID S I+P LL + LH A+G++ N+ TGYH IEFLL
Sbjct: 121 PSDENALAALNVIANPTFDLSGKAIDTSAITPALLSETLHEADGVEANVATGYHAIEFLL 180

Query: 180 WGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           WGQDL       GNR +TD+  G NCT GHC RR +YLK  + +LVSDLE M   W   G
Sbjct: 181 WGQDLNGTDHGAGNRSWTDYASGDNCTNGHCDRRGDYLKAATALLVSDLEWMAAQWDEAG 240

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            A   L+ D  AG+++++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  
Sbjct: 241 DARISLLADEGAGISAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYY 300

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D +G+ + Y GEYIR+NGE I G S+ DL+   +  L  E+  K + TM+    +K  AE
Sbjct: 301 DGLGVQNIYLGEYIRVNGEMISGPSLSDLVVAADPALDSEMRMKLATTMRALGRIKSTAE 360

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
              S+DQM+++ N  G  ++   +N L+ QT S+ ++   L L
Sbjct: 361 AGLSYDQMLAQGNTAGEALIMGGVNGLVDQTRSIERVVTLLSL 403


>gi|28898694|ref|NP_798299.1| putative iron-regulated protein A [Vibrio parahaemolyticus RIMD
           2210633]
 gi|28806912|dbj|BAC60183.1| putative iron-regulated protein A [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 429

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 164/413 (39%), Positives = 243/413 (58%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D+L  A+TL+  I+  +  
Sbjct: 14  TVLVQSIAASLLIASGTTVAAQVTKQQVVEHYADVAHAVFADSLTTAKTLEVKIDEFLKA 73

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P++  LE+ +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 74  PSEAKLEDVKQAWLESRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVAADYQYE 133

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D++ I+P+LL  L+   G + N+ TGYH IEFLLWG
Sbjct: 134 -LGNEGAAANIIANTSLTIGPSKLDVAKITPELLASLNEVGGSEANVATGYHAIEFLLWG 192

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W  D  G
Sbjct: 193 QDLNGTNAGAGKRAYTDFVVGSGCTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADEKG 252

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+      GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 253 NYRQELLTGSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 312

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G  + G SI +L++  ++  A+EI  +F  T      L   A
Sbjct: 313 YNEQGIYNVYTGTYSRQDGTVLTGPSIANLVAQEDKKAAEEIQKQFDATRSQVGELVTSA 372

Query: 358 EN-IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           E   + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +D + P+  
Sbjct: 373 EKHNQHFDQLIAAGNAQGNALVNDTIMALVAQTGAIERAAGIVGIDSLSPDTA 425


>gi|13474605|ref|NP_106174.1| hypothetical protein mlr5523 [Mesorhizobium loti MAFF303099]
 gi|14025359|dbj|BAB51960.1| mlr5523 [Mesorhizobium loti MAFF303099]
          Length = 439

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 197/400 (49%), Positives = 269/400 (67%), Gaps = 7/400 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
             + + VF LP+ A         + V++ Y+ IA AKYED+L  A+ LD A++ L+  P+
Sbjct: 26  ALLTAAVFVLPAKA-----ETDAKAVIRTYSDIALAKYEDSLTTAQALDKAVDALLAKPS 80

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
            + L  AR  W  AR+PYQQ+EVYRFGNKIVD W+ +VN+WPLDEG IDYV  SYG E++
Sbjct: 81  AETLNVARDAWKAARVPYQQTEVYRFGNKIVDDWEGEVNSWPLDEGLIDYVAKSYGTESD 140

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQ 182
            N+LYTAN+IAN +I +N K++D S +SP+ L   L +A G++ N+ TGYH IEFLLWGQ
Sbjct: 141 TNSLYTANVIANKEIEINGKKVDASKLSPEFLSGTLQQAGGVEANVATGYHAIEFLLWGQ 200

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           DL       G RPYTD+D+ NCTGG+C RR EYLK  + +LVSDL++M+  W  DG A K
Sbjct: 201 DLHGTGPGAGERPYTDYDLRNCTGGNCDRRAEYLKSATTLLVSDLQKMVNDWKEDGAARK 260

Query: 243 DLMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
           +L+    N  ++ I TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+L D I
Sbjct: 261 NLVDGEPNTAISVIFTGMGSLSYGELAGERMKLGLMLHDPEEEQDCFSDNTYNSHLYDAI 320

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI ++Y   Y R++G  + G S+HD++   +  + +E++DK   T+     +K RAE  E
Sbjct: 321 GIRAAYLASYTRLDGTVVSGPSVHDMVKAADPAIDKELSDKLDVTVAKMEAIKARAEAGE 380

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           ++DQ I+E N  GN  V+  I+ LI QT+S+ +   +L L
Sbjct: 381 AYDQQIAEGNTAGNATVQAAIDALIDQTKSIERAVGSLKL 420


>gi|126738822|ref|ZP_01754518.1| lipoprotein, putative [Roseobacter sp. SK209-2-6]
 gi|126720003|gb|EBA16710.1| lipoprotein, putative [Roseobacter sp. SK209-2-6]
          Length = 422

 Score =  541 bits (1393), Expect = e-151,   Method: Composition-based stats.
 Identities = 194/401 (48%), Positives = 267/401 (66%), Gaps = 4/401 (0%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           F+T  ++   + + A   V   S   +L NYA IA AKY+D+L  A+ L SA+E L+ +P
Sbjct: 5   FLTGTALAGIIFNAA--PVLAASKADILTNYANIAEAKYQDSLHTAKQLQSAVEALIASP 62

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + + LE AR  WI +R+PYQQSEV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  +
Sbjct: 63  SAEALEAARAAWIASRVPYQQSEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPS 122

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           +EN L   N+IAN    ++ K ID S I+P+LL   LH A+GI+ N+ TGYH IEFLLWG
Sbjct: 123 DENALAALNVIANPSFDLSGKSIDTSKITPELLSDTLHEADGIEANVATGYHAIEFLLWG 182

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDLK      G+RP+TD+  G +CTGGHC RR EYLK  + +LVSDLE M   W   G+A
Sbjct: 183 QDLKGTEHGAGDRPWTDYASGEDCTGGHCDRRGEYLKAATDLLVSDLEWMAAQWSASGEA 242

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              L+ D + G+++++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D 
Sbjct: 243 RGTLLGDEDVGISAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDG 302

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +G+ + Y GEY+R++GE + G S+ DL+S ++ +L  E+  K + TM+    +K  AE  
Sbjct: 303 LGVQNVYLGEYVRVSGELVSGPSLSDLVSASDSSLDSEMRSKLATTMQALGRIKLTAEAG 362

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            S+DQM+   N  G  ++   +N L+ QT S+ ++   L L
Sbjct: 363 TSYDQMLEAGNSAGEALIMGGVNGLVDQTRSIERVVKLLSL 403


>gi|91227199|ref|ZP_01261658.1| putative iron-regulated protein A [Vibrio alginolyticus 12G01]
 gi|91188727|gb|EAS75015.1| putative iron-regulated protein A [Vibrio alginolyticus 12G01]
          Length = 420

 Score =  541 bits (1393), Expect = e-151,   Method: Composition-based stats.
 Identities = 167/413 (40%), Positives = 245/413 (59%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D++  A+ LD  I+  + +
Sbjct: 5   KVLVQSIAASLLIASGSTVAATVTKQQVVEHYADVAHAVFADSVTTAKALDVKIDEFLQS 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ K LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSAKKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAADYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGAAANIIANTSLQIGASKLDVSKITPELLADLNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W  +  G
Sbjct: 184 QDLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKG 243

Query: 239 QATKDLMKDI-NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+ D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYREELLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y  +NG+++ G SI DL++  ++  A EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGTYKGVNGKELSGPSIADLVAQKDKKAATEIQKQFDTTRSQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRI--ALDLIEPNRV 407
           E N + FDQ+I+  N +GN +V + I  L+ QT ++ +      +D + P+  
Sbjct: 364 EKNNQHFDQLIAAGNAQGNALVNDTIMSLVAQTGAIERAASIVGIDSLSPDTA 416


>gi|262393894|ref|YP_003285748.1| iron-regulated protein A [Vibrio sp. Ex25]
 gi|262337488|gb|ACY51283.1| iron-regulated protein A precursor [Vibrio sp. Ex25]
          Length = 420

 Score =  541 bits (1393), Expect = e-151,   Method: Composition-based stats.
 Identities = 168/413 (40%), Positives = 243/413 (58%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D++  A+TLD  I+  + +
Sbjct: 5   TVLVQSIAASLLIASGSTVAAQVTKQQVVEHYADVAHAVFADSVTTAKTLDVKIDEFLKS 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+   LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSADKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVATDYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGAAANIIANTSLQIGASKLDVSNITPELLADLNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W  +  G
Sbjct: 184 QDLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKG 243

Query: 239 QATKDLMKDI-NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              +  + D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRETFLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G  + G SI DL++  ++  A+EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGLYKREDGTLLSGPSIADLVAQKDKQAAKEIQKQFDVTRNQVGKLVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           E N + FDQ+I+  N +GN +V + I  L+ QT S+ +    I +D + P+  
Sbjct: 364 EKNNQHFDQLIAAGNAQGNTLVNDTIMSLVAQTGSIERAAGIIGIDSLSPDTA 416


>gi|269967081|ref|ZP_06181149.1| iron-regulated protein A, putative [Vibrio alginolyticus 40B]
 gi|269828340|gb|EEZ82606.1| iron-regulated protein A, putative [Vibrio alginolyticus 40B]
          Length = 419

 Score =  541 bits (1393), Expect = e-151,   Method: Composition-based stats.
 Identities = 166/413 (40%), Positives = 243/413 (58%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D++  A+ LD  I+  + +
Sbjct: 4   KVLVQSIAASLLIASGSTVAATVTKQQVVEHYADVAHAVFADSVTTAKALDVKIDEFLQS 63

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ K LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 64  PSAKKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAADYQYE 123

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 124 -LGNEGAAANIIANTSLQIGASKLDVSKITPELLADLNEVGGSEANVASGYHAIEFLLWG 182

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W  +  G
Sbjct: 183 QDLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKG 242

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+ +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 243 NYREELLNESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 302

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y  +NG+ + G SI DL++  ++  A EI  +F  T      L   A
Sbjct: 303 YNEQGIYNVYTGTYKGVNGKALSGPSIADLVAQKDKKAATEIQKQFDTTRSQVGELVTSA 362

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRI--ALDLIEPNRV 407
           E N + FDQ+I+  N +GN +V + I  L+ QT ++ +      +D + P+  
Sbjct: 363 EKNNQHFDQLIAAGNAQGNALVNDTIMSLVAQTGAIERAASIVGIDSLSPDTA 415


>gi|269961719|ref|ZP_06176080.1| iron-regulated protein A, putative [Vibrio harveyi 1DA3]
 gi|269833584|gb|EEZ87682.1| iron-regulated protein A, putative [Vibrio harveyi 1DA3]
          Length = 420

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 166/413 (40%), Positives = 246/413 (59%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D++  A+ LD  I+  + +
Sbjct: 5   KVLVQSIAASLLIASGSTVAATVTKQQVVEHYADVAHAVFADSVTTAKALDVKIDEFLKS 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ K LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSAKKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAADYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGAAANIIANTSLQIGASKLDVSKITPELLADLNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W  +  G
Sbjct: 184 QDLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKG 243

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+ +  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYREELLNESADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y  +NG+++ G SI DL++  ++  A EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGTYKGVNGKELSGPSIADLVAQKDKKAATEIQKQFDTTRNQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           E N + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +D + P+  
Sbjct: 364 EKNNQHFDQLIAAGNAQGNALVNDTIMSLVAQTGAIERAANIVGIDSLSPDTA 416


>gi|126460976|ref|YP_001042090.1| putative iron-regulated protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102640|gb|ABN75318.1| imelysin. Metallo peptidase. MEROPS family M75 [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 441

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 177/404 (43%), Positives = 251/404 (62%), Gaps = 6/404 (1%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +  +  ++    LP  AL+    V   +V++ YA IA A Y D+L  AR L +A++ LV 
Sbjct: 24  LLALATVAPCALLPLPALA----VERSEVVETYADIAEATYADSLATARELQTAVKALVD 79

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P++  L  AR  W+ AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD+SYG 
Sbjct: 80  QPSEAALMAARSAWLAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGG 139

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLL 179
             EEN+L   N+IA  K  ++  EID + I+P+L+   LH A+GI+ N+ +GYH IEFLL
Sbjct: 140 ATEENDLAALNVIATPKFTLSGTEIDATEITPELISGTLHEADGIEANVASGYHAIEFLL 199

Query: 180 WGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           WGQDL       G+RP+TD+  G +CTGG+C RR  YL   + +LVSDL+ M   W   G
Sbjct: 200 WGQDLNGTEAGAGDRPFTDYAKGEDCTGGNCDRRAAYLVAATDLLVSDLDYMAAQWADGG 259

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            A   + +D   GL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  
Sbjct: 260 AARVAVTEDPGKGLRAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYY 319

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D +GI + Y G Y R++G  + G S+ DL++  +  L + +  +   T+     L+    
Sbjct: 320 DGLGIRNVYRGHYARVDGSTVEGPSLSDLVAEADPELDKVLTGQLDATVDRLDALRTAVA 379

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
              ++DQM++  N EG  ++   ++ L+TQT S+ +   AL L 
Sbjct: 380 GGMAYDQMLAPGNAEGEALIMGAVDALVTQTASIERATTALGLT 423


>gi|254451478|ref|ZP_05064915.1| insulin-cleaving metalloproteinase outer membrane protein
           [Octadecabacter antarcticus 238]
 gi|198265884|gb|EDY90154.1| insulin-cleaving metalloproteinase outer membrane protein
           [Octadecabacter antarcticus 238]
          Length = 406

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 178/386 (46%), Positives = 247/386 (63%), Gaps = 2/386 (0%)

Query: 18  LSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA 77
            S    +    VL  YA IA AKY D+L+ A+ L +A+  LV  P+ +NL  AR  W+ A
Sbjct: 2   ASPAFAIEKADVLDTYADIAAAKYGDSLIMAQRLQTAVNALVADPSPENLTAARKAWLEA 61

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN     N+IAN+ 
Sbjct: 62  RVPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDENEFAALNVIANAT 121

Query: 138 IIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
             ++  EID + I+PDLL   L  A+G++ N+ TGYH IEFLLWGQDL  +    G RP+
Sbjct: 122 FTLSGTEIDATEITPDLLENTLQEADGVEANVATGYHAIEFLLWGQDLNGHGTGAGQRPW 181

Query: 197 TDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI 255
           TD+ + N CT  +C RR EYL   + +LVSDLE M+  W   G A  ++M + +AGL ++
Sbjct: 182 TDYALANDCTNANCDRRGEYLTAATDLLVSDLEWMVAQWADHGAARAEVMTNKDAGLAAM 241

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           +TGM SLSY E+AGERM LG++L+DPE+E  CF+DNT+  +  D +G+ + Y GEYIR++
Sbjct: 242 LTGMGSLSYGEVAGERMRLGVMLNDPEEEHSCFADNTHNDHFYDGMGVQNIYLGEYIRVD 301

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGN 375
           G  + G S+ DL+S  +  L  E+  K S TM     +K  AE   ++DQM+   N  G 
Sbjct: 302 GTLVSGPSLADLVSETDAALDAEMQSKLSATMMALGRIKTTAEAGFAYDQMLERGNEAGE 361

Query: 376 KIVRNLINDLITQTESLRKIRIALDL 401
            ++   +N  I QT S+ ++  +L L
Sbjct: 362 ALIMGGVNGFIDQTRSIERVVTSLGL 387


>gi|27366244|ref|NP_761772.1| Iron-regulated protein A [Vibrio vulnificus CMCP6]
 gi|27362445|gb|AAO11299.1| Iron-regulated protein A precursor [Vibrio vulnificus CMCP6]
          Length = 427

 Score =  540 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 165/411 (40%), Positives = 249/411 (60%), Gaps = 8/411 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           I+ +    TL +    +  NV+ ++V+++YA +AHA + D+L  A+ L+  +E  ++ P+
Sbjct: 14  ISPVFSSTTLFASGHLLAANVTNQQVVEHYADVAHAVFADSLTTAQQLEKKVEQFLSAPS 73

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
              LE  +  W+ AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E  
Sbjct: 74  AAKLEEVKQAWLDARVPYQQSEVFRFGNTVVDDWEGQLNAWPLDEGLIDYVSTDYQYE-L 132

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
            N    ANI+AN+ + +   ++D+S+I+P+L+ +L+   G + N+ +GYH IEFLLWGQD
Sbjct: 133 GNEGAKANIVANTTLKIGASQLDVSVITPELIAELNEVGGSEANVASGYHAIEFLLWGQD 192

Query: 184 LKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP--DGQA 240
           L       G R YTDF +G  CT GHC RR  YLK  +++LV+DLE M K W     G  
Sbjct: 193 LNGTNAGAGQRAYTDFVVGSQCTNGHCDRRGAYLKAAAQLLVTDLEWMEKQWSAQEKGNY 252

Query: 241 TKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
            ++L+ +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +
Sbjct: 253 RQELLAQSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYN 312

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
             GI + YTG Y R++G  + G S+HDL++  ++N A+EI  +F  T      L   AE 
Sbjct: 313 EQGIYNVYTGIYKRVDGSLLTGPSLHDLVAQQDKNAAKEIQAQFDTTRAQVGKLVTSAEK 372

Query: 360 -IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
             + FDQ+I+  N +GN +V   I  L+ QT ++ +    + +D + P+  
Sbjct: 373 QNQHFDQLIAAGNAQGNALVNETIMSLVAQTSAIERAAKIVGIDSLNPDTA 423


>gi|260462002|ref|ZP_05810247.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032249|gb|EEW33515.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 429

 Score =  540 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 200/400 (50%), Positives = 268/400 (67%), Gaps = 7/400 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
             + + VF LP+ A +       + V+  Y+ IA AKYED+L  A+ LD A++ L+  P+
Sbjct: 16  ALLTAAVFVLPAKAQTDA-----KAVVTTYSDIALAKYEDSLTTAQALDKAVDALLANPS 70

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
              L  AR  W  +R+PYQQ+EVYRFGNKIVD W+ KVN+WPLDEG IDYV  SYG E++
Sbjct: 71  ADTLNAARDAWKASRVPYQQTEVYRFGNKIVDDWEGKVNSWPLDEGLIDYVAKSYGTESD 130

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQ 182
            N+LYTAN+IAN +I +N K++D S +SP+ L   L  A G++ N+ TGYH IEFLLWGQ
Sbjct: 131 ANSLYTANVIANKEIEINGKKVDASKLSPEFLSGTLQEAGGVEANVATGYHAIEFLLWGQ 190

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           DL       G RPYTD+D+ NCTGG+C RR EYLK  S +LVSDL+EM+  W  DG A K
Sbjct: 191 DLHGTGPGAGERPYTDYDLKNCTGGNCDRRAEYLKSASTLLVSDLQEMVDDWKADGAARK 250

Query: 243 DLMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
            L     N  +++I TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND I
Sbjct: 251 ALADGEPNTAISTIFTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAI 310

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI ++Y   Y R++G  + G S+H+++   +  + +E++DK   T+     +K RAE  E
Sbjct: 311 GIRAAYLASYTRLDGTVVSGPSVHEMVKTADPAIDKELSDKLDVTVAKMEAIKARAEAGE 370

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           ++DQ I+E N EGN  V+  I+ LI QT+S+ +   +L L
Sbjct: 371 AYDQQIAEGNTEGNATVQAAIDALIDQTKSIERAVGSLKL 410


>gi|254230285|ref|ZP_04923674.1| hypothetical protein VEx25_B0317 [Vibrio sp. Ex25]
 gi|151937182|gb|EDN56051.1| hypothetical protein VEx25_B0317 [Vibrio sp. Ex25]
          Length = 419

 Score =  540 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 168/413 (40%), Positives = 243/413 (58%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D++  A+TLD  I+  + +
Sbjct: 4   TVLVQSIAASLLIASGSTVAAQVTKQQVVEHYADVAHAVFADSVTTAKTLDVKIDEFLKS 63

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+   LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 64  PSADKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVATDYQYE 123

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 124 -LGNEGAAANIIANTSLQIGASKLDVSNITPELLADLNEVGGSEANVASGYHAIEFLLWG 182

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W  +  G
Sbjct: 183 QDLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKG 242

Query: 239 QATKDLMKDI-NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              +  + D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 243 NYRETFLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 302

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G  + G SI DL++  ++  A+EI  +F  T      L   A
Sbjct: 303 YNEQGIYNVYTGLYKREDGTLLSGPSIADLVAQKDKQAAKEIQKQFDVTRNQVGKLVTSA 362

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           E N + FDQ+I+  N +GN +V + I  L+ QT S+ +    I +D + P+  
Sbjct: 363 EKNNQHFDQLIAAGNAQGNTLVNDTIMSLVAQTGSIERAAGIIGIDSLSPDTA 415


>gi|37680303|ref|NP_934912.1| uncharacterized iron-regulated protein [Vibrio vulnificus YJ016]
 gi|37199050|dbj|BAC94883.1| uncharacterized iron-regulated protein [Vibrio vulnificus YJ016]
          Length = 423

 Score =  540 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 165/413 (39%), Positives = 248/413 (60%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +     V TL +    +  NV+ ++V+++YA +AHA + D+L  A+ L+  +E  ++ 
Sbjct: 8   TLLVQSLAVTTLFASGHLLAANVTNQQVVEHYADVAHAVFADSLTTAQQLEKKVEQFLSA 67

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+   LE  +  W+ AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 68  PSAAKLEEVKQAWLAARVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSTDYQYE 127

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+ + +   ++D+S+I+P+L+ +L+   G + N+ +GYH IEFLLWG
Sbjct: 128 -LGNEGAKANIVANTTLKIGASQLDVSVITPELIAELNEVGGSEANVASGYHAIEFLLWG 186

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP--DG 238
           QDL       G R YTDF +G  CT GHC RR  YLK  +++LV+DLE M K W     G
Sbjct: 187 QDLNGTNAGAGQRAYTDFVVGSQCTNGHCDRRGAYLKAAAQLLVTDLEWMEKQWSAQEKG 246

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+ +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 247 NYRQELLAQSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 306

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R++G  + G S+HDL++  ++N A+EI  +F  T      L   A
Sbjct: 307 YNEQGIYNVYTGIYKRVDGSLLTGPSLHDLVAQQDKNTAKEIQAQFDTTRAQVGKLVTSA 366

Query: 358 EN-IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           E   + FDQ+I+  N +GN +V   I  L+ QT ++ +    + +D + P+  
Sbjct: 367 EKQNQHFDQLIAAGNAQGNALVNETIMSLVAQTSAIERAAKIVGIDSLNPDTA 419


>gi|319779791|ref|YP_004139267.1| peptidase M75, Imelysin [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317165679|gb|ADV09217.1| Peptidase M75, Imelysin [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 429

 Score =  540 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 198/400 (49%), Positives = 268/400 (67%), Gaps = 7/400 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
             + + VF LP+ A        ++ V++ Y+ IA AKYED+L  A+ LD A++ L+ TP+
Sbjct: 16  ALLTAAVFVLPAKA-----ETDVKAVIKTYSDIALAKYEDSLTTAQALDKAVDALLATPS 70

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
            + L  AR  W  +R+PYQQ+EVYRFGNKIVD W+ KVN+WPLDEG IDYV  SYG E++
Sbjct: 71  VETLNAARDAWKASRVPYQQTEVYRFGNKIVDDWEGKVNSWPLDEGLIDYVAKSYGTESD 130

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQ 182
            N LYTAN+IAN +I +N K++D S +SP+ L   L  A GI+ N+ TGYH IEFLLWGQ
Sbjct: 131 ANALYTANVIANKEIEINGKKVDASKLSPEFLSGTLQGAGGIEANVATGYHAIEFLLWGQ 190

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           DL       G RPYTD+D+ NCTGG+C RR EYLK  S +LVSDL+EM+  W  DG A K
Sbjct: 191 DLHGTGPGAGERPYTDYDLKNCTGGNCDRRAEYLKSASDLLVSDLQEMVGNWKEDGAARK 250

Query: 243 DLMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
            L+    +  +++I TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+L D I
Sbjct: 251 ALVDGEPSTAISTIFTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLYDAI 310

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI ++Y   Y R++G  + G S+ D++   +  + +E++DK   ++     +K RA   E
Sbjct: 311 GIRAAYHASYTRLDGTIVSGPSVADMVKAADPAIDKELSDKLDVSVAKMEAIKARALAGE 370

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           ++DQ I+E N EGN  V+  I+ LI QT+S+ +   +L L
Sbjct: 371 AYDQQIAEGNIEGNATVQAAIDALIDQTKSIERAVGSLKL 410


>gi|150398713|ref|YP_001329180.1| putative iron-regulated protein [Sinorhizobium medicae WSM419]
 gi|150030228|gb|ABR62345.1| putative iron-regulated protein [Sinorhizobium medicae WSM419]
          Length = 426

 Score =  539 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 201/404 (49%), Positives = 280/404 (69%), Gaps = 4/404 (0%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEK---VLQNYATIAHAKYEDALMCARTLDSAIETLV 59
           FI   ++     + AL++ P  +      V+++YA +AHAKYEDAL  A  LD A++ L+
Sbjct: 5   FIRTAALALMTATSALALQPANAAPDAAAVVKHYAAVAHAKYEDALTTAEALDKAVDALI 64

Query: 60  TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYG 119
            +P+++ L+ AR  W++AR PYQ++EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG
Sbjct: 65  ASPSEETLKAAREAWLKARNPYQETEVYRFGNTIVDEWEGKVNAWPLDEGLIDYVDASYG 124

Query: 120 KENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFL 178
            E++EN L+TAN+IAN  + ++ +++D + I+P+L+   L  A GI+ N+ TGYH IEFL
Sbjct: 125 TESDENALFTANVIANKVLKIDGQDVDATSITPELISGTLQEAGGIEANVATGYHAIEFL 184

Query: 179 LWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           LWGQDL       GNR YTDFD   CT G+C RR  YLK  + +LV+DL+EM+  W PDG
Sbjct: 185 LWGQDLNGTGPGAGNRSYTDFDTEACTNGNCDRRAAYLKAATSLLVADLKEMVANWTPDG 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            ATK +  D  AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+L+
Sbjct: 245 AATKAVEADPKAGLVAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTHNSHLH 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D IGI S+Y+GEY R++G K+ G S+ +L+   +  L +E+ D    T++    +  RAE
Sbjct: 305 DAIGIQSAYSGEYTRVDGGKLTGPSLSELVGAKDAALDKEMKDNLGATVEKMQAMAKRAE 364

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
            +E++DQMI E N EGN  V+  I+ LI Q +++ ++  AL+L 
Sbjct: 365 TVEAYDQMIGEGNAEGNATVQAAIDGLIAQAKTVERVIAALELG 408


>gi|156974993|ref|YP_001445900.1| hypothetical protein VIBHAR_02715 [Vibrio harveyi ATCC BAA-1116]
 gi|156526587|gb|ABU71673.1| hypothetical protein VIBHAR_02715 [Vibrio harveyi ATCC BAA-1116]
          Length = 423

 Score =  539 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 167/413 (40%), Positives = 248/413 (60%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D+L  A+TLD  I+  + +
Sbjct: 8   TVLVQSIAASLLIASGSTVAATVTKQQVVEHYADVAHAVFADSLTTAQTLDVKIDEFLKS 67

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ K LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 68  PSAKKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGELNAWPLDEGLIDYVAADYQYE 127

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+ + +   ++D+S I+P+L+  L+   G + N+ +GYH IEFLLWG
Sbjct: 128 -LGNEGAAANIVANTSLQIGASKLDVSKITPELIADLNEVGGSEANVASGYHAIEFLLWG 186

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W  D  G
Sbjct: 187 QDLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADVKG 246

Query: 239 QATKDLMKDI-NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+ D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 247 NYREELLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 306

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y  ++G+++ G SI DL++  ++  A+EI  +F  T      L   A
Sbjct: 307 YNEQGIYNVYTGTYKGVSGKELSGPSIADLVAQKDKKAAEEIQKQFDTTRSQVGELVTSA 366

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           E N + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +D + P+  
Sbjct: 367 EKNNQHFDQLIAAGNAQGNALVNDTIMSLVAQTGAIERAANIVGIDSLSPDTA 419


>gi|254507004|ref|ZP_05119142.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus 16]
 gi|219549999|gb|EED26986.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus 16]
          Length = 420

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 167/413 (40%), Positives = 243/413 (58%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        + + +      V+ E+V+++YA IAHA +ED+L  A+ LD +IE+ + T
Sbjct: 5   SLLAQSVAASLVLASSSVFAAKVTKEQVVEHYADIAHAVFEDSLTTAKKLDKSIESFLAT 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+   LE  +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSAAKLEEVKQAWLDSRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSTDYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN ++ +    +D+S ++P  +  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIVANKQLKIGATTMDVSQLTPKAIADLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G RPYTDF +G  CT G+C RR EYLK  +++L+ DLE M K W  D  G
Sbjct: 184 QDLNGTNAGAGQRPYTDFVVGEGCTNGNCERRGEYLKATAQLLIQDLEWMEKQWSADEKG 243

Query: 239 QATKDLMKDI-NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               +L+ D    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRAELLSDSSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G  + G SI+DL++  ++  A+EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGLYKRQDGTLLSGPSINDLVAQKDQQAAKEIQKQFDVTRSQVGQLVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           E N E FDQ+I+  N +GN +V   I  L+ QT S+ +    + ++ + P+  
Sbjct: 364 ENNGEFFDQLIASGNVKGNALVNETIMSLVAQTASIERAAKIVGINSLNPDTA 416


>gi|320156753|ref|YP_004189132.1| iron-regulated protein A [Vibrio vulnificus MO6-24/O]
 gi|319932065|gb|ADV86929.1| iron-regulated protein A precursor [Vibrio vulnificus MO6-24/O]
          Length = 420

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 164/413 (39%), Positives = 248/413 (60%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +     V TL +    +  NV+ ++V+++YA +AHA + D+L  A+ L+  +E  ++ 
Sbjct: 5   TLLVQSLAVTTLFASGHLLAANVTNQQVVEHYADVAHAVFADSLTTAQQLEKKVEQFLSA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+   LE  +  W+ AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSAAKLEEVKQAWLDARVPYQQSEVFRFGNVVVDDWEGQLNAWPLDEGLIDYVSTDYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+ + +   ++D+S+I+P+L+ +L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGAKANIVANTTLKIGASQLDVSVITPELIAELNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP--DG 238
           QDL       G R YTDF +G  CT GHC RR  YLK  +++LV+DLE M K W     G
Sbjct: 184 QDLNGTNAGAGQRAYTDFVVGSQCTNGHCDRRGAYLKAAAQLLVTDLEWMEKQWSAQEKG 243

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+ +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQELLAQSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R++G  + G S+HDL++  ++N A+EI  +F  T      +   A
Sbjct: 304 YNEQGIYNVYTGIYKRVDGSLLTGPSLHDLVAQQDKNAAKEIQAQFDTTRAQVGKIVTSA 363

Query: 358 EN-IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           E   + FDQ+I+  N +GN +V   I  L+ QT ++ +    + +D + P+  
Sbjct: 364 EKQNQHFDQLIAAGNAQGNALVNETIMSLVAQTSAIERAAKIVGIDSLNPDTA 416


>gi|328474741|gb|EGF45546.1| putative iron-regulated protein A [Vibrio parahaemolyticus 10329]
          Length = 420

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 164/413 (39%), Positives = 243/413 (58%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D+L  A+TL+  I+  +  
Sbjct: 5   TVLVQSIAASLLIASGTTVAAQVTKQQVVEHYADVAHAVFADSLTTAKTLEVKIDEFLKA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P++  LE+ +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSEAKLEDVKQAWLESRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVAADYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D++ I+P+LL  L+   G + N+ TGYH IEFLLWG
Sbjct: 125 -LGNEGAAANIIANTSLTIGPSKLDVAKITPELLASLNEVGGSEANVATGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W  D  G
Sbjct: 184 QDLNGTNAGAGQRAYTDFVVGSGCTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADEKG 243

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+      GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQELLTGSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G  + G SI +L++  ++  A+EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGTYSRQDGTVLTGPSIANLVAQEDKKAAEEIQKQFDVTRSQVGELVTSA 363

Query: 358 EN-IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           E   + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +D + P+  
Sbjct: 364 EKHNQHFDQLIAAGNAQGNALVNDTIMALVAQTGAIERAAGIVGIDSLSPDTA 416


>gi|153835282|ref|ZP_01987949.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           harveyi HY01]
 gi|148868218|gb|EDL67364.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           harveyi HY01]
          Length = 420

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 167/413 (40%), Positives = 248/413 (60%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D+L  A+TLD  I+  + +
Sbjct: 5   TVLVQSIAASLLIASGSTVAAIVTKQQVVEHYADVAHAVFADSLTTAQTLDVKIDEFLKS 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ K LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSAKKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAADYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+ + +   ++D+S I+P+L+  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGAAANIVANTSLQIGASKLDVSKITPELIADLNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W  D  G
Sbjct: 184 QDLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADVKG 243

Query: 239 QATKDLMKDI-NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+ D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYREELLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y  ++G+++ G SI DL++  ++  A+EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGTYKGVSGKELSGPSIADLVAQKDKKAAEEIQKQFDTTRSQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           E N + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +D + P+  
Sbjct: 364 EKNNQHFDQLIAAGNAQGNALVNDTIMSLVAQTGAIERAANIVGIDSLSPDTA 416


>gi|163761540|ref|ZP_02168612.1| hypothetical protein HPDFL43_21352 [Hoeflea phototrophica DFL-43]
 gi|162281254|gb|EDQ31553.1| hypothetical protein HPDFL43_21352 [Hoeflea phototrophica DFL-43]
          Length = 427

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 196/408 (48%), Positives = 275/408 (67%), Gaps = 3/408 (0%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           Y  ++++    +   A +   +V+ E V+++YA IA AKYED+L  A  LD+AIE  + +
Sbjct: 6   YTKSLLAASTLMVGFAGTAFADVAPEAVIKHYADIAQAKYEDSLATANALDAAIEAFLAS 65

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS-SYGK 120
           P++  L+  +  W+ AR+PYQQ+EVYRFGN IVD W+ +VNAWPLDEG IDYVD+ +YG 
Sbjct: 66  PSEAGLQAVKEAWLAARVPYQQTEVYRFGNAIVDDWEGRVNAWPLDEGLIDYVDAGAYGD 125

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLL 179
           E++EN LYTAN+IAN  I +N + ID S I+P+L+ + L  A GI+ N+ +GYH IEFLL
Sbjct: 126 ESDENTLYTANVIANPSITINGETIDASKITPELISETLQEAGGIEANVASGYHAIEFLL 185

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           WGQDL  N    GNRPYTDF + NC+  HC RR +YL   S +L++DLEEM   W   G 
Sbjct: 186 WGQDLNGNDAGAGNRPYTDFSLENCSNDHCDRRRQYLSAASDLLIADLEEMAANWQEGGA 245

Query: 240 ATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
           A KDLM K ++ GL +I+TGM SLSY ELAGERM LGL+L DPE+E DCFSDNT+ S+L 
Sbjct: 246 ARKDLMDKGVSGGLVTILTGMGSLSYGELAGERMKLGLLLGDPEEEHDCFSDNTHNSHLY 305

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D +GI ++Y G Y R++G ++ G S+ +L++ +  ++  E+      T++    +  RAE
Sbjct: 306 DAVGIRNAYLGTYDRVDGTQLTGPSLSELVASSAPDVDAELKADLDATVEAMEAMASRAE 365

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
             E++DQMI+  N EGN  V+  I+DL+ QT S+ ++  ALDL     
Sbjct: 366 TTEAYDQMIANGNAEGNATVQAAIDDLVKQTRSIERVIAALDLGSIEL 413


>gi|153839462|ref|ZP_01992129.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AQ3810]
 gi|260363707|ref|ZP_05776491.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus K5030]
 gi|260879726|ref|ZP_05892081.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AN-5034]
 gi|260898800|ref|ZP_05907241.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus Peru-466]
 gi|260901613|ref|ZP_05910008.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AQ4037]
 gi|149747019|gb|EDM58007.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AQ3810]
 gi|308086683|gb|EFO36378.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus Peru-466]
 gi|308093281|gb|EFO42976.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AN-5034]
 gi|308108687|gb|EFO46227.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AQ4037]
 gi|308113404|gb|EFO50944.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus K5030]
          Length = 420

 Score =  538 bits (1386), Expect = e-151,   Method: Composition-based stats.
 Identities = 164/413 (39%), Positives = 243/413 (58%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D+L  A+TL+  I+  +  
Sbjct: 5   TVLVQSIAASLLIASGTTVAAQVTKQQVVEHYADVAHAVFADSLTTAKTLEVKIDEFLKA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P++  LE+ +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSEAKLEDVKQAWLESRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVAADYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D++ I+P+LL  L+   G + N+ TGYH IEFLLWG
Sbjct: 125 -LGNEGAAANIIANTSLTIGPSKLDVAKITPELLASLNEVGGSEANVATGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W  D  G
Sbjct: 184 QDLNGTNAGAGKRAYTDFVVGSGCTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADEKG 243

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+      GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQELLTGSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G  + G SI +L++  ++  A+EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGTYSRQDGTVLTGPSIANLVAQEDKKAAEEIQKQFDATRSQVGELVTSA 363

Query: 358 EN-IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           E   + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +D + P+  
Sbjct: 364 EKHNQHFDQLIAAGNAQGNALVNDTIMALVAQTGAIERAAGIVGIDSLSPDTA 416


>gi|260427865|ref|ZP_05781844.1| hypothetical protein CSE45_1614 [Citreicella sp. SE45]
 gi|260422357|gb|EEX15608.1| hypothetical protein CSE45_1614 [Citreicella sp. SE45]
          Length = 425

 Score =  538 bits (1385), Expect = e-151,   Method: Composition-based stats.
 Identities = 180/379 (47%), Positives = 250/379 (65%), Gaps = 2/379 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
               VL+ YA IA A YED+L  A+ L  A+E L+  P+++ L  AR  W+ +R PYQQ+
Sbjct: 28  DKASVLETYADIALAGYEDSLSTAKALQEAVEALIAEPSEETLAAAREAWLVSRNPYQQT 87

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EV+RFGN IVD W+ KVNAWPLDEG IDYV   Y    +EN     NIIA  +  +  +E
Sbjct: 88  EVFRFGNPIVDDWEGKVNAWPLDEGLIDYVSEEYEGPTDENEYAALNIIATPQATIAGQE 147

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           +D S I+P+L+   L+ A+GI+TN+  GYH IEFLLWGQDL       G RPYTD+  G+
Sbjct: 148 VDASEITPELIADTLNEADGIETNVARGYHAIEFLLWGQDLNGTEPGAGERPYTDYATGD 207

Query: 204 -CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSL 262
            CTGG+C RR +YLK  + +LVSDLEEM+ AWG DG+A   +++D NAG+ +++TGM SL
Sbjct: 208 DCTGGNCDRRADYLKAATTLLVSDLEEMVAAWGADGEARGAVLEDENAGITAMLTGMGSL 267

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           SY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D  GI + Y G Y R++G  + GA
Sbjct: 268 SYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHFYDGKGIQNVYLGSYTRVDGSTVEGA 327

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+ +L++  +  L  E+  K   TM     +K+ AE   ++DQM++  + +G +++   +
Sbjct: 328 SLSELVAATDPALDDEMKTKLDTTMTALGAIKEAAEGGFAYDQMLAIGDEKGEELIMGGV 387

Query: 383 NDLITQTESLRKIRIALDL 401
           N LI QT ++ +I  ALDL
Sbjct: 388 NGLIDQTRTIERIVGALDL 406


>gi|163803517|ref|ZP_02197387.1| putative iron-regulated protein A [Vibrio sp. AND4]
 gi|159172693|gb|EDP57544.1| putative iron-regulated protein A [Vibrio sp. AND4]
          Length = 420

 Score =  538 bits (1385), Expect = e-151,   Method: Composition-based stats.
 Identities = 160/413 (38%), Positives = 248/413 (60%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D+L+ A+ LD+ I+  + +
Sbjct: 5   TVLVQSIAASLLIASGSTVAATVTKQQVVEHYADVAHAVFADSLVTAKALDAKIDEFLKS 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+++ LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSEEKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVATDYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+ + +   ++D+S I+P+L+  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGAAANIVANTSLQIGASKLDVSKITPELIADLNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG--PDG 238
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DL+ M   W     G
Sbjct: 184 QDLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAAVLLVQDLKWMENQWSIETKG 243

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+    ++GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYREELLNGSADSGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y  ++G+++ G S+ DL++  ++  A+EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGTYKGVSGKELSGPSLADLVAQKDKKAAEEIQKQFDTTRSQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           E N + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +D + P+  
Sbjct: 364 EKNNQHFDQLIAAGNAQGNALVNDTIMSLVAQTGAIERAAKIVGIDSLSPDTA 416


>gi|221641041|ref|YP_002527303.1| Imelysin. Metallo peptidase. MEROPS family M75 [Rhodobacter
           sphaeroides KD131]
 gi|221161822|gb|ACM02802.1| Imelysin. Metallo peptidase. MEROPS family M75 precursor
           [Rhodobacter sphaeroides KD131]
          Length = 422

 Score =  536 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 177/404 (43%), Positives = 250/404 (61%), Gaps = 6/404 (1%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +  +  ++    LP  AL+    V   +V++ YA IA A Y D+L  AR L +A++ LV 
Sbjct: 5   LLALATVAPCALLPLPALA----VERSEVVETYADIAEATYADSLATARELQTAVKALVD 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P++  L  AR  W+ AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD+SYG 
Sbjct: 61  QPSEAALMAARSAWLAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGG 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLL 179
             EEN+L   N+IA  K  ++  EID + I+P+L+   LH A+GI+ N+ +GYH IEFLL
Sbjct: 121 VTEENDLAALNVIATPKFTLSGTEIDATEITPELISGTLHEADGIEANVASGYHAIEFLL 180

Query: 180 WGQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           WGQDL       G+RP+TD+  G  CTGG+C RR  YL   + +LVSDL+ M   W   G
Sbjct: 181 WGQDLNGTEAGAGDRPFTDYAKGEACTGGNCDRRAAYLLAATDLLVSDLDYMAAQWADGG 240

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            A   + +D   GL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  
Sbjct: 241 AARVAVTEDPEKGLRAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYY 300

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D +GI + Y G Y R++G  + G S+ DL++  +  L + +  +   T+     L+    
Sbjct: 301 DGLGIRNVYRGHYARVDGSTVEGPSLSDLVAEADPELDKVLTGQLDATVDRLDALRTAVA 360

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
              ++DQM++  N EG  ++   ++ L+TQT S+ +   AL L 
Sbjct: 361 GGMAYDQMLAPGNAEGEALIMGAVDALVTQTASIERATTALGLT 404


>gi|163745379|ref|ZP_02152739.1| lipoprotein, putative [Oceanibulbus indolifex HEL-45]
 gi|161382197|gb|EDQ06606.1| lipoprotein, putative [Oceanibulbus indolifex HEL-45]
          Length = 420

 Score =  536 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 178/402 (44%), Positives = 255/402 (63%), Gaps = 4/402 (0%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M      +I     + A +        +VL  YA IA A YED+L  A+TL  A+  L+ 
Sbjct: 1   MRLKATTAIALITFAAAPAFAQ--DKAEVLGTYADIAQAGYEDSLTTAQTLQKAVNALIE 58

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
           TP+ + L+ A+  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG 
Sbjct: 59  TPSAEALQAAKSAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGG 118

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLL 179
           E +EN L   N+IAN    +  +++D S I+PDLL  +LH A  ++ N+ TGYH IEFLL
Sbjct: 119 ETDENQLAVLNVIANPNFTLGGEKVDASAITPDLLEGQLHEAGAVEANVATGYHAIEFLL 178

Query: 180 WGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           WGQDL       GNRP+TD+  G +CTGG+C RR +YLK  + +LVSDLE M   W   G
Sbjct: 179 WGQDLNGTDHGAGNRPWTDYATGEDCTGGNCDRRGQYLKAATDLLVSDLEWMSGQWAEGG 238

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            A   +++D +AG+N+I+TGM SLSY E AGERM LG++L+DPE+E DCFSDNT+ S+  
Sbjct: 239 DARAAVLEDEDAGINAILTGMGSLSYGEQAGERMKLGVMLNDPEEEHDCFSDNTHNSHYY 298

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D +G+ + Y GEY+R++G  + GAS+ DL++  +  +  ++      +M +   +K  AE
Sbjct: 299 DGLGVRNVYLGEYLRVDGRVVSGASLSDLVASADATVDADLRAGLDASMVELGQIKTAAE 358

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
              S+D M+   N EG  ++ + ++ L+ QT ++ +    L 
Sbjct: 359 AGFSYDMMLERGNAEGEALIMSAVDALVNQTRAIERAVTVLG 400


>gi|262402384|ref|ZP_06078945.1| iron-regulated protein A precursor [Vibrio sp. RC586]
 gi|262351166|gb|EEZ00299.1| iron-regulated protein A precursor [Vibrio sp. RC586]
          Length = 420

 Score =  536 bits (1381), Expect = e-150,   Method: Composition-based stats.
 Identities = 162/409 (39%), Positives = 238/409 (58%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +T   +     + + S     +  +V+++YA IAHA Y D+ + A+ L  +I+  + T
Sbjct: 5   SILTSAILASLTLTASASFAAAPTQAQVVEHYANIAHAVYADSRLTAQQLQKSIDRFLQT 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  K LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAKGLEEVKQAWLAARVPYQQSEVFRFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTSLTIGANKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDG 238
           QDL       G R YTD+  G  CT G+C RR +YLK  +++LV+DLE M K W  G  G
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKECTNGNCDRRAQYLKAAAQLLVTDLEWMEKQWANGEKG 243

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              + L+ +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLTESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + +TG Y R +G ++ G S+++L++  + + A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIFTGTYTRADGSELKGPSLYELVAEKDASAAKEILQQFETARTQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 364 EKNNQHFDQLIAADNTAGHAIINQAIMALVVQTGSIERAAGIIGIDNLN 412


>gi|77462087|ref|YP_351591.1| imelysin [Rhodobacter sphaeroides 2.4.1]
 gi|77386505|gb|ABA77690.1| imelysin. Metallo peptidase. MEROPS family M75 [Rhodobacter
           sphaeroides 2.4.1]
          Length = 422

 Score =  536 bits (1381), Expect = e-150,   Method: Composition-based stats.
 Identities = 177/404 (43%), Positives = 251/404 (62%), Gaps = 6/404 (1%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +  +  ++    LP  AL+    V   +V++ YA IA A Y D+L  AR L +A++ LV 
Sbjct: 5   LLALATVAPCALLPLPALA----VERSEVVETYADIAEATYADSLATARELQTAVKALVD 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P++  L  AR  W+ AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD+SYG 
Sbjct: 61  QPSEAALMAARSAWLAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGG 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLL 179
             EEN+L   N+IA  K  ++  EID + I+P+L+   LH A+GI+ N+ +GYH IEFLL
Sbjct: 121 ATEENDLAALNVIATPKFTLSGTEIDATEITPELISGTLHEADGIEANVASGYHAIEFLL 180

Query: 180 WGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           WGQDL       G+RP+TD+  G +CTGG+C RR  YL   + +LVSDL+ M   W   G
Sbjct: 181 WGQDLNGTEAGAGDRPFTDYAKGEDCTGGNCDRRAAYLVAATDLLVSDLDYMAAQWADGG 240

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            A   + +D   GL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  
Sbjct: 241 AARVAVNEDPGKGLRAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYY 300

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D +GI + Y G Y R++G  + G S+ DL++  +  L + +  +   T+     L+    
Sbjct: 301 DGLGIRNVYRGHYARVDGSTVEGPSLSDLVAEADPELDKVLTGQLDATVDRLDALRTAVA 360

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
              ++DQM++  N EG  ++   ++ L+TQT S+ +   AL L 
Sbjct: 361 GGMAYDQMLAPGNAEGEALIMGAVDALVTQTASIERATTALGLT 404


>gi|332560014|ref|ZP_08414336.1| putative iron-regulated protein [Rhodobacter sphaeroides WS8N]
 gi|332277726|gb|EGJ23041.1| putative iron-regulated protein [Rhodobacter sphaeroides WS8N]
          Length = 422

 Score =  536 bits (1380), Expect = e-150,   Method: Composition-based stats.
 Identities = 177/404 (43%), Positives = 250/404 (61%), Gaps = 6/404 (1%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +  +  ++    LP  AL+    V   +V++ YA IA A Y D+L  AR L +A++ LV 
Sbjct: 5   LLALATVAPCALLPLPALA----VERSEVVETYADIAEATYADSLATARELQTAVKALVD 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P +  L  AR  W+ AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD+SYG 
Sbjct: 61  QPAEAALMAARSAWLAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGG 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLL 179
             EEN+L   N+IA  K  ++  EID + I+P+L+   LH A+GI+ N+ +GYH IEFLL
Sbjct: 121 ATEENDLAALNVIATPKFTLSGTEIDATEITPELISGTLHEADGIEANVASGYHAIEFLL 180

Query: 180 WGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           WGQDL       G+RP+TD+  G +CTGG+C RR  YL   + +LVSDL+ M   W   G
Sbjct: 181 WGQDLNGTEAGAGDRPFTDYVKGEDCTGGNCDRRAAYLVAATDLLVSDLDYMAAQWADGG 240

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            A   + +D   GL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  
Sbjct: 241 AARVAVTEDPEKGLRAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYY 300

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D +GI + Y G Y R++G  + G S+ DL++  +  L + +  +   T+     L+    
Sbjct: 301 DGLGIRNVYRGHYPRVDGSTVEGPSLSDLVAEADPELDKVLTGQLDATVDRLDALRTAVA 360

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
              ++DQM++  N EG  ++   ++ L+TQT S+ +   AL L 
Sbjct: 361 GGMAYDQMLAPGNAEGEALIMGAVDALVTQTASIERATTALGLT 404


>gi|254488016|ref|ZP_05101221.1| insulin-cleaving metalloproteinase outer membrane protein
           [Roseobacter sp. GAI101]
 gi|214044885|gb|EEB85523.1| insulin-cleaving metalloproteinase outer membrane protein
           [Roseobacter sp. GAI101]
          Length = 420

 Score =  535 bits (1378), Expect = e-150,   Method: Composition-based stats.
 Identities = 181/381 (47%), Positives = 249/381 (65%), Gaps = 2/381 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
              +VL  YA IA AKYED+L+ A+ L +A+  LV+ P+   L  AR  W+ AR+PYQQ+
Sbjct: 23  EKAEVLGTYADIAAAKYEDSLITAQRLQTAVAALVSDPSADTLTAARSAWLAARVPYQQT 82

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EVYRFGN IVD W+ KVN+WPLDEG IDYVD+SYG  ++EN L   N+I++    ++  E
Sbjct: 83  EVYRFGNPIVDDWEGKVNSWPLDEGLIDYVDASYGGPSDENELAGLNVISSPTFTLSGTE 142

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           ID S I+P  L   LH A+GI+ N+ TGYH IEFLLWGQDL  +    GNRP+TD+  G+
Sbjct: 143 IDASTITPAFLSDTLHEADGIEANVATGYHAIEFLLWGQDLNGHGDGAGNRPWTDYAKGD 202

Query: 204 -CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSL 262
            CT  +C RR  YL   + +LVSDL  M   W  DG A  +L +D NAGL +I+TGM SL
Sbjct: 203 ACTNANCDRRGAYLTAATDLLVSDLTWMTAQWADDGAARAELTQDTNAGLAAILTGMGSL 262

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           SY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI S+Y GEY+R++G  + G 
Sbjct: 263 SYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIQSAYLGEYVRIDGTMVSGP 322

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+ D+++  + +L  E+  K S TM     +K  AE   ++DQM++  +  G  ++   +
Sbjct: 323 SLADMVAETDADLNTEMQAKLSKTMMALGRIKTAAEAGFAYDQMLARGDAGGEALIMGGV 382

Query: 383 NDLITQTESLRKIRIALDLIE 403
           + LI QT S+ ++   L L +
Sbjct: 383 DALIDQTRSIERVVTTLGLDQ 403


>gi|258624446|ref|ZP_05719393.1| iron-regulated protein A, putative [Vibrio mimicus VM603]
 gi|258583293|gb|EEW08095.1| iron-regulated protein A, putative [Vibrio mimicus VM603]
          Length = 420

 Score =  534 bits (1377), Expect = e-150,   Method: Composition-based stats.
 Identities = 162/409 (39%), Positives = 238/409 (58%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +T   +     S + S     +  +V+++YA IAHA Y D+ + A+ L  +I+  + T
Sbjct: 5   SILTSAILASLTLSASASFAAAPTQAQVVEHYANIAHAVYSDSRLTAQQLQKSIDRFLQT 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  K LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAKGLEEVKQAWLAARVPYQQSEVFRFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIVANTSLTIGANKLDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDG 238
           QDL       G R YTD+  G  CT G+C RR +YLK  +++LV+DLE M K W  G  G
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKECTNGNCDRRAQYLKAAAQLLVTDLEWMEKQWANGEKG 243

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              + L+ +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLNESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + +TG Y R +G ++ G S+++L++  + + A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIFTGTYTRADGSELKGPSLYELVAEKDASAAKEILQQFETARTQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 364 EKNNQHFDQLIAADNTAGHAIINQAIMALVVQTGSIERAAGIIGIDNLN 412


>gi|254503368|ref|ZP_05115519.1| hypothetical protein SADFL11_3407 [Labrenzia alexandrii DFL-11]
 gi|222439439|gb|EEE46118.1| hypothetical protein SADFL11_3407 [Labrenzia alexandrii DFL-11]
          Length = 420

 Score =  534 bits (1377), Expect = e-150,   Method: Composition-based stats.
 Identities = 198/378 (52%), Positives = 257/378 (67%), Gaps = 2/378 (0%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
            VL  Y+ IA+AKY D+L  A+TL SAI+ L+  P   NL  AR  WI AR PYQQ+E Y
Sbjct: 26  DVLGTYSDIAYAKYSDSLETAKTLQSAIDKLIAEPTDTNLAAARKAWIEARNPYQQTEAY 85

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ KVNAWPLDEG IDYVD SYG+++EEN  Y AN+IAN  + V  + ID 
Sbjct: 86  RFGNAIVDDWEGKVNAWPLDEGLIDYVDVSYGEDSEENAFYAANVIANPSLKVGGETIDA 145

Query: 148 SIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTG 206
           S+I+P LL + L  A  ++ N+ TGYH IEFLLWGQDL       GNRP +DFD  NCTG
Sbjct: 146 SVITPALLAESLQEAGEVEANVATGYHAIEFLLWGQDLNGTDAGAGNRPASDFDTANCTG 205

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM-KDINAGLNSIITGMTSLSYN 265
           G+C RR +YL   + +L++DLEEM+ AW P G A ++L  K    GL +I+TGM SLSY 
Sbjct: 206 GNCERRAQYLNSATDLLITDLEEMVAAWAPGGAAREELGGKGEAGGLATILTGMGSLSYG 265

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           ELAGERM LGL+LHDPE+E DCFSDNT+ S+ NDV+GI + Y GEY    G  + GAS+ 
Sbjct: 266 ELAGERMKLGLMLHDPEEEHDCFSDNTHMSHYNDVVGIRNVYFGEYKSPLGNDVKGASLA 325

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           ++++  +  LA+E+  K   T+  F  +K RAE  E++DQMI E N EGN +V+  +N L
Sbjct: 326 EMVAAKDPALAEEMQAKLDATLAAFEAMKARAEAGEAYDQMIGEGNDEGNAVVQAAVNAL 385

Query: 386 ITQTESLRKIRIALDLIE 403
           + QT S+ ++   L+L E
Sbjct: 386 VDQTTSIERVVKVLELDE 403


>gi|148978889|ref|ZP_01815209.1| Uncharacterized iron-regulated protein [Vibrionales bacterium
           SWAT-3]
 gi|145962087|gb|EDK27373.1| Uncharacterized iron-regulated protein [Vibrionales bacterium
           SWAT-3]
          Length = 419

 Score =  534 bits (1377), Expect = e-150,   Method: Composition-based stats.
 Identities = 159/407 (39%), Positives = 242/407 (59%), Gaps = 6/407 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +   ++  +L   + S    V+ ++V+++YA IAHA + D+++ A+ L+S+I+T + +P+
Sbjct: 6   LVTKAVTSSLIFASASSFAAVTQDQVVEHYADIAHAVFADSVITAKALNSSIDTFLASPS 65

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
             N E  +L W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV S Y  E  
Sbjct: 66  AGNFEKVKLAWLESRVPYQQSEVFRFGNVVVDDWEGQLNAWPLDEGLIDYVSSDYQYE-L 124

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
            N   +ANI+AN    + +  +D + I+P+L+ +L+   G + N+ +GYH IEFLLWGQD
Sbjct: 125 GNEGASANIVANKTFQIGQTTVDATNITPELIAELNEIGGSEANVASGYHAIEFLLWGQD 184

Query: 184 LKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQA 240
           +       G R YTDF +G  CT G+C RR  YLK  +++L+ DLE M K W     G  
Sbjct: 185 MNGTNSGAGERAYTDFVVGAECTNGNCDRRGAYLKASAELLIQDLEWMEKQWAEGEKGNY 244

Query: 241 TKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
            ++L+ +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +
Sbjct: 245 RQELLSESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYN 304

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE- 358
             GI + YTG Y R +G  + G S+ DL+   +   A+EI  +F         L   AE 
Sbjct: 305 EQGIYNVYTGLYKREDGTLLSGPSLFDLVEQKDEQAAKEIQKQFDLARAQVGQLVTSAEK 364

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           N + FDQ+I+ +N  GN +V   I  L++QT ++ +    + +   N
Sbjct: 365 NNQHFDQLIAADNAAGNALVNKTIVALVSQTAAIERAAGVIGIDSLN 411


>gi|313497282|gb|ADR58648.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 444

 Score =  534 bits (1376), Expect = e-149,   Method: Composition-based stats.
 Identities = 164/394 (41%), Positives = 233/394 (59%), Gaps = 5/394 (1%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            A   V   + + V+++Y  + +A Y D+L  A+TL +A++  +  PN + L+ A+  W 
Sbjct: 44  VASGAVDEAAGKAVVKHYTDMVYAVYSDSLSTAKTLQTAVDAFLAKPNDETLKAAKEAWF 103

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR+PY QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN
Sbjct: 104 AARVPYLQSETFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGASANIIAN 162

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
           ++I V E+++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP
Sbjct: 163 TEIQVGEEKVDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRP 222

Query: 196 YTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAG 251
            +D+  G   TGGH  RR  YLK V+ +LV+DLEEM+  W P   D    K   + +N G
Sbjct: 223 ASDYLEGQGATGGHNDRRRAYLKAVTDLLVTDLEEMVGNWAPNVADNYRAKLEAEPVNDG 282

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L  ++ GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY
Sbjct: 283 LRKMLFGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEY 342

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENN 371
            R +G K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N
Sbjct: 343 TRPDGTKLTGPSLSSLVAKVDPAADATLKADLEATEAKLQVIVDHALKGEHYDQLIAADN 402

Query: 372 PEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
             GN++VR+ I  L+ QT S+ +    L +   N
Sbjct: 403 AAGNQVVRDAIAALVKQTGSIEQAAGKLGIANLN 436


>gi|260776049|ref|ZP_05884944.1| iron-regulated protein A precursor [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607272|gb|EEX33537.1| iron-regulated protein A precursor [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 420

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 163/413 (39%), Positives = 245/413 (59%), Gaps = 8/413 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        + + +     NV+ E+V+++YA +AHA + DAL  A+TLD +IE+ +  
Sbjct: 5   SLLARSVATSLVLASSSVFAANVTKEQVVEHYADVAHAVFADALTTAKTLDQSIESFLAA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P++  L   +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSEAKLAEVKQAWLDSRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSTDYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N   +ANI+AN ++ +   ++D++ ++P+ +  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGASANIVANKQLTIGATKLDVAQLTPEAIADLNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT G+C RR EYLK  + +LV DL+ M K W  D  G
Sbjct: 184 QDLNGTNAGAGERAYTDFVVGKGCTNGNCDRRGEYLKAAADLLVQDLQWMEKQWSSDVKG 243

Query: 239 QATKDLMKDI-NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+ D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYREELLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G  + G SI DL++  ++  A+EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGLYKREDGTLLSGPSIADLVAQKDKAAAKEIQKQFDVTRSQVGQLVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           E N + FDQ+I+  N +GN +V   I  L+ QT S+ +    + ++ + P+  
Sbjct: 364 EKNGQYFDQLIAAGNAQGNALVNETIMSLVAQTSSIERAAKIVGINSLNPDTA 416


>gi|85706973|ref|ZP_01038063.1| lipoprotein, putative [Roseovarius sp. 217]
 gi|85668584|gb|EAQ23455.1| lipoprotein, putative [Roseovarius sp. 217]
          Length = 420

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 173/403 (42%), Positives = 251/403 (62%), Gaps = 6/403 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +T  +I   L   A +   N    +VL  YA IA A Y D+L   R L+ A+  L+ +
Sbjct: 4   TLLTSTAIATALLGSAQAQTAN----EVLDTYADIAEANYGDSLEAVRALEKAVTALIKS 59

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ +++  AR  W++AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD  YG  
Sbjct: 60  PSAESMSAARDAWLQARVPYQQTEVFRFGNPIVDDWEGKVNAWPLDEGLIDYVDGLYGGP 119

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
            + N     N+IAN    ++ KEID + I+PDLL   LH A+GI+ N+ TGYH IEFLLW
Sbjct: 120 TDANQFAALNVIANPSFSLSGKEIDATEITPDLLENILHEADGIEANVATGYHAIEFLLW 179

Query: 181 GQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GQDL  +    G+RP+TD+    +CT G+C RR +YL   + +L SDLE +   W  DG+
Sbjct: 180 GQDLNGHGDGAGSRPWTDYAQNEDCTNGNCERRADYLMAATDLLSSDLEWITAQWAKDGE 239

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
           A   +  D  AGL +I+TGM SLSY E AGERM LGL+L+DPE+E  CF+DNT+  +  +
Sbjct: 240 ARATITADEQAGLTAILTGMGSLSYGETAGERMRLGLMLNDPEEEHSCFADNTHNDHYYN 299

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
            +GI S Y G Y+R +G  + GAS+ DL+++ +  L +E+  + +  +     +K  AE+
Sbjct: 300 GVGIRSVYLGNYVRTDGTTVSGASLSDLVANIDPELDREMRTRLAEAVLALGRIKTAAES 359

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
             ++D+M++  +  G  ++   ++ LI QT S+ ++  ALDL 
Sbjct: 360 GFAYDEMLARGDEGGEALIMGGVDGLINQTRSIERVVTALDLG 402


>gi|227824161|ref|YP_002828134.1| hypothetical protein NGR_c36600 [Sinorhizobium fredii NGR234]
 gi|227343163|gb|ACP27381.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 426

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 193/379 (50%), Positives = 264/379 (69%), Gaps = 1/379 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYEDAL  A  LD A++ L+  P+++ L+ AR  W++AR PYQ++EVYR
Sbjct: 34  VVKHYAAVAHAKYEDALTTAEALDKAVDALIAGPSEETLKAARDAWLKARNPYQETEVYR 93

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD SYG E++EN L+TAN+IAN  I ++ K++D +
Sbjct: 94  FGNAIVDEWEGKVNAWPLDEGLIDYVDPSYGTESDENALFTANVIANKTIKIDGKDVDAT 153

Query: 149 IISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            I+P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       G R YTDFD   CT G
Sbjct: 154 NITPEFLAGTLQEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGKRTYTDFDTKACTNG 213

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR  YLK  + +LV+DL+EM+  W P+G A K +  D  AGL +I+TGM SLSY EL
Sbjct: 214 NCDRRAAYLKAATDLLVADLKEMVANWAPEGAAAKAVEADPKAGLAAILTGMGSLSYGEL 273

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DC SDNT+ S+L+D IGI S+YTGEY R++G K+ G S+ +L
Sbjct: 274 AGERMKLGLLLHDPEEEHDCSSDNTHNSHLHDAIGIQSAYTGEYTRVDGTKLAGPSLSEL 333

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  +  L +E+    + T++    +  RAE  E++DQMI+E N +GN  V+  I+ LI 
Sbjct: 334 VAAKDAALDKEMATNLATTVEKMQAMAKRAEAGEAYDQMIAEGNKDGNATVQAAIDGLIA 393

Query: 388 QTESLRKIRIALDLIEPNR 406
           Q +++ ++  AL+L     
Sbjct: 394 QAKTVERVIAALELGTIEL 412


>gi|258620194|ref|ZP_05715233.1| iron-regulated protein A, putative [Vibrio mimicus VM573]
 gi|258587552|gb|EEW12262.1| iron-regulated protein A, putative [Vibrio mimicus VM573]
          Length = 420

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 162/409 (39%), Positives = 238/409 (58%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +T   +     S + S     +  +V+++YA IAHA Y D+ + A+ L  +I+  + T
Sbjct: 5   SILTSAILASLTLSASASFAAAPTQAQVVEHYANIAHAVYADSRLTAQQLQKSIDRFLQT 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  K LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAKGLEEVKQAWLAARVPYQQSEVFRFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIVANTSLTIGANKLDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDG 238
           QDL       G R YTD+  G  CT G+C RR +YLK  +++LV+DLE M K W  G  G
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKECTNGNCDRRAQYLKAAAQLLVTDLEWMEKQWANGEKG 243

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              + L+ +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLNESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + +TG Y R +G ++ G S+++L++  + + A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIFTGTYTRADGSELKGPSLYELVAEKDASAAKEILQQFETARTQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 364 EKNNQHFDQLIAADNTAGHAIINQAIMALVVQTGSIERAAGIIGIDNLN 412


>gi|146283464|ref|YP_001173617.1| iron-regulated protein A, putative [Pseudomonas stutzeri A1501]
 gi|145571669|gb|ABP80775.1| iron-regulated protein A, putative [Pseudomonas stutzeri A1501]
 gi|327481861|gb|AEA85171.1| iron-regulated protein A, putative [Pseudomonas stutzeri DSM 4166]
          Length = 444

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 164/401 (40%), Positives = 238/401 (59%), Gaps = 4/401 (0%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           S   ++P+         + + V+ +YA +A A + DA   A  L  AI+ L+  P+++ L
Sbjct: 37  STTESVPAEQAQKPDEKAAKAVVSHYADLALAVFSDAHATAVQLQQAIDALLANPSEETL 96

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           + AR  W+ AR+PY Q+EV+RFGN +VD W+ ++NAWPLDEG IDYV+  Y +    N  
Sbjct: 97  QAARQAWLAARVPYMQTEVFRFGNPVVDEWEGQLNAWPLDEGLIDYVEGDY-QHALGNPG 155

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
             ANIIAN+++ V E +ID S I+ +LL  L+   G + N+ TGYH IEFLLWGQDL   
Sbjct: 156 ANANIIANTELQVGEDKIDTSEITAELLTSLNELAGSEANVATGYHAIEFLLWGQDLNGT 215

Query: 188 VREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
               G RPYTD+  G  CTGG+C RR  YLKV + +LVSDL+EM++ W P  +  +  ++
Sbjct: 216 GPGAGERPYTDYVEGEGCTGGNCDRRRTYLKVATDLLVSDLQEMVEQWQPGAENYRASLE 275

Query: 247 --DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
                 GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI 
Sbjct: 276 AESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYNARGIR 335

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y GEY R++G  + G S+  L+   +  +   +     +T     +L + A N E+FD
Sbjct: 336 NVYLGEYKRVDGSTLTGPSLASLVQGVSPEVDSTLKTDLESTEAKLQVLVESANNGEAFD 395

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           Q+I+ +N EG + VRN I  L+ QT S+ +   AL + + N
Sbjct: 396 QLIAADNAEGQEKVRNAIAALVKQTASIEQAAAALGISDLN 436


>gi|86148451|ref|ZP_01066741.1| Uncharacterized iron-regulated protein [Vibrio sp. MED222]
 gi|218709910|ref|YP_002417531.1| putative iron-regulated protein A [Vibrio splendidus LGP32]
 gi|85833748|gb|EAQ51916.1| Uncharacterized iron-regulated protein [Vibrio sp. MED222]
 gi|218322929|emb|CAV19106.1| putative iron-regulated protein A [Vibrio splendidus LGP32]
          Length = 419

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 158/407 (38%), Positives = 240/407 (58%), Gaps = 6/407 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +   ++  +L   + S    V+ ++V+++YA IAHA + D+++ A+ L+S+I+T + +P+
Sbjct: 6   LVTKAVTSSLIFASASSFAAVTQDQVVEHYADIAHAVFADSVITAKALNSSIDTFLASPS 65

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
             N E  +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E  
Sbjct: 66  AGNFEQVKQAWLDSRVPYQQSEVFRFGNVVVDDWEGQLNAWPLDEGLIDYVSTDYQYE-L 124

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
            N   +ANI+AN    + +  +D + I+P+L+  L+   G + N+ +GYH IEFLLWGQD
Sbjct: 125 GNEGASANIVANKTFQIGQTTVDATNITPELIADLNEIGGSEANVASGYHAIEFLLWGQD 184

Query: 184 LKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQA 240
           L       G R YTDF +G  CT G+C RR  YLK  +++L+ DLE M K W     G  
Sbjct: 185 LNGTNSGAGERAYTDFVVGAECTNGNCDRRGAYLKASAELLIQDLEWMEKQWAEGEKGNY 244

Query: 241 TKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
            ++L+ +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +
Sbjct: 245 RQELLSESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYN 304

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE- 358
             GI + YTG Y R +G  + G S+ DL+   +   A+EI  +F         L   AE 
Sbjct: 305 EQGIYNVYTGLYKREDGSLLSGPSLFDLVEQKDEQAAKEIQKQFDLARAQVGQLVVSAEK 364

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           N + FDQ+I+ +N  GN +V   I  L++QT ++ +    + +   N
Sbjct: 365 NNQHFDQLIAADNAAGNALVNKTIVALVSQTAAIERAAGVIGIDSLN 411


>gi|259416101|ref|ZP_05740021.1| hypothetical protein SCH4B_1473 [Silicibacter sp. TrichCH4B]
 gi|259347540|gb|EEW59317.1| hypothetical protein SCH4B_1473 [Silicibacter sp. TrichCH4B]
          Length = 422

 Score =  533 bits (1373), Expect = e-149,   Method: Composition-based stats.
 Identities = 184/403 (45%), Positives = 257/403 (63%), Gaps = 2/403 (0%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M    +        +   S     S   VL NYA IA AKYED+L+ A+ L +A++ L+ 
Sbjct: 1   MKTPLLTGAAIAALTVGTSAAFAASKADVLTNYANIAEAKYEDSLITAKALQAAVDALIA 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P+ +NLE A+  W+ AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG 
Sbjct: 61  DPSAENLEAAKHAWLAARVPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGG 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLL 179
             +EN     N++AN +  ++ K ID S I+P+LL + LH A+G++ N+ TGYH IEFLL
Sbjct: 121 PTDENAAAALNVVANPEFTLSGKTIDASDITPELLAETLHEADGVEANVATGYHAIEFLL 180

Query: 180 WGQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           WGQDL       G R +TD+  G  CT G+C RR  YLK  + +LVSDLE +   W   G
Sbjct: 181 WGQDLNGTEHGAGERAWTDYAAGESCTNGNCDRRGAYLKAATDLLVSDLEWITAQWAEGG 240

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
           +A + ++ D +AG+ +I+TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  
Sbjct: 241 EARETVLSDEDAGITTILTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYY 300

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D +GI + Y GEY+R+NG+ + G ++ DL+   +  L  E+  K S TM     +K  AE
Sbjct: 301 DGLGIQNVYLGEYVRVNGDLVSGPALADLVEAADSELNAELTGKLSTTMMKLGRIKTAAE 360

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
              S+DQM+++ +  G  +V   ++ L+ QT S+ +   AL+L
Sbjct: 361 AGFSYDQMLAQGSDAGEALVMGGVDALVDQTRSIERAVAALEL 403


>gi|262165520|ref|ZP_06033257.1| iron-regulated protein A precursor [Vibrio mimicus VM223]
 gi|262025236|gb|EEY43904.1| iron-regulated protein A precursor [Vibrio mimicus VM223]
          Length = 420

 Score =  533 bits (1372), Expect = e-149,   Method: Composition-based stats.
 Identities = 162/409 (39%), Positives = 238/409 (58%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +T   +     S + S     +  +V+++YA IAHA Y D+ + A+ L  +I+  + T
Sbjct: 5   SILTSAILASLTLSASASFAAAPTQAQVVEHYANIAHAVYADSRLTAQQLQKSIDRFLQT 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  K LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAKGLEEVKQAWLAARVPYQQSEVFRFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIVANTSLTIGANKLDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDG 238
           QDL       G R YTD+  G  CT G+C RR +YLK  +++LV+DLE M K W  G  G
Sbjct: 184 QDLNGTKAGAGARSYTDYLKGKECTNGNCDRRAQYLKAAAQLLVADLEWMEKQWANGEKG 243

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              + L+ +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLNESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + +TG Y R +G ++ G S+++L++  + + A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIFTGTYTRADGSELKGPSLYELVAEKDASAAKEILQQFETARTQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 364 EKNNQHFDQLIAADNTAGHAIINQAIMALVVQTGSIERAAGIIGIDNLN 412


>gi|312883632|ref|ZP_07743357.1| uncharacterized iron-regulated protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368855|gb|EFP96382.1| uncharacterized iron-regulated protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 420

 Score =  533 bits (1372), Expect = e-149,   Method: Composition-based stats.
 Identities = 165/409 (40%), Positives = 238/409 (58%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   +   +V+ ++V+++YA IAHA + D+L  A+ L+ +IE  +  
Sbjct: 5   SLLAKSIAASMLIASGTAFSADVTNKQVVEHYADIAHAVFADSLATAKNLNKSIEAFLAA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P    L   +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV S Y  E
Sbjct: 65  PTDAKLMEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGMIDYVTSDYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+++ +    +D+S I+P L+  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNAGAKANIVANTQLTIGASTLDVSKITPALIADLNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG--PDG 238
           QDL       GNRPYTDF +G  CT G+C RR  +L+   ++LV DLE M K W     G
Sbjct: 184 QDLNGTESGAGNRPYTDFVLGEACTHGNCDRRGAFLRAAGQLLVQDLEWMEKQWSKEAKG 243

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+    + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQELVNGSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G  + G S+HDL++  ++  AQEI  +F  T      L   A
Sbjct: 304 YNEQGIYNIYTGIYKRQDGSLLSGPSLHDLVNQKDKVAAQEIQKQFDQTRSQVGKLVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+  N +GNK+V   I  L+ QTE + +    + +   N
Sbjct: 364 EKNNQHFDQLIAAGNAKGNKLVNETIMSLVAQTEQIERAAKIVGVNSLN 412


>gi|89053859|ref|YP_509310.1| putative lipoprotein [Jannaschia sp. CCS1]
 gi|88863408|gb|ABD54285.1| lipoprotein putative [Jannaschia sp. CCS1]
          Length = 420

 Score =  533 bits (1372), Expect = e-149,   Method: Composition-based stats.
 Identities = 176/402 (43%), Positives = 253/402 (62%), Gaps = 6/402 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +T  ++   L   AL+         VL  YA IA A YED+L+ A+ L+ A++ L+  
Sbjct: 4   TILTTTALASFLAGPALAQ----DAADVLNTYADIAAAGYEDSLITAQALERAVDALIAE 59

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ + L  AR  W++AR+PYQQ+EV+RFGN IVD W+ +VNAWPLDEG IDYVD +YG  
Sbjct: 60  PSAQTLTAARTAWLQARVPYQQTEVFRFGNAIVDDWEGRVNAWPLDEGLIDYVDGAYGGP 119

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
            +EN L   N+IAN    ++  E+D S I+P LL   LH A+G++ N+ TGYH +EFLLW
Sbjct: 120 TDENTLAAVNVIANPTFTLSGSEVDASSITPALLEDTLHEADGVEANVATGYHAVEFLLW 179

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GQDL  +    GNRPYTD+  G+ CTGG+C RR EYL   +++LVSDLE M   W  DG 
Sbjct: 180 GQDLNGHGDGAGNRPYTDYAAGDDCTGGNCDRRAEYLAAATELLVSDLEWMAAQWTADGD 239

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
           A   LM++  AGL++++TGM SLSY E AGERM LGL+L+DPE+E  CF+DNT+  +  +
Sbjct: 240 ARAALMENEQAGLSAMLTGMGSLSYGETAGERMRLGLMLNDPEEEHSCFADNTHNDHFFN 299

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
            +G+ + Y G Y R++G  + G S+ DL+   + +L  E+  + +  +     +K  AE 
Sbjct: 300 GVGVRNVYLGSYSRIDGTLVSGPSLSDLVMDVDADLDAEMRSRLAEAVLALGEIKTAAEA 359

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
             ++D+M+   N  G  ++   +N LI QT S+ ++  AL L
Sbjct: 360 GFAYDEMLERGNEGGELLIMGGVNGLIEQTRSIERVVTALGL 401


>gi|84393101|ref|ZP_00991866.1| Uncharacterized iron-regulated protein [Vibrio splendidus 12B01]
 gi|84376258|gb|EAP93141.1| Uncharacterized iron-regulated protein [Vibrio splendidus 12B01]
          Length = 419

 Score =  532 bits (1370), Expect = e-149,   Method: Composition-based stats.
 Identities = 158/407 (38%), Positives = 241/407 (59%), Gaps = 6/407 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +   ++  +L   + S    V+ ++V+++YA IAHA + D+++ A+ L+S+I+T + +P+
Sbjct: 6   LVTKAVTSSLLFASASSFAAVTQDQVVEHYADIAHAVFADSVITAKALNSSIDTFLASPS 65

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
             N E  +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E  
Sbjct: 66  AGNFEQVKQAWLESRVPYQQSEVFRFGNVVVDDWEGQLNAWPLDEGLIDYVSTDYQYE-L 124

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
            N   +ANI+AN    + +  +D + I+P+L+  L+   G + N+ +GYH IEFLLWGQD
Sbjct: 125 GNEGASANIVANKTFQIGQTTVDATNITPELIADLNEIGGSEANVASGYHAIEFLLWGQD 184

Query: 184 LKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQA 240
           L       G R YTDF +G  CT G+C RR  YLK  +++L+ DLE M K W     G  
Sbjct: 185 LNGTNSGAGERVYTDFVVGAECTNGNCDRRGAYLKASAELLIQDLEWMEKQWAEGEKGNY 244

Query: 241 TKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
            ++L+ +  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +
Sbjct: 245 RQELLSESSDNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYN 304

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE- 358
             GI + YTG Y R +G  + G S+ DL+   +   A+EI  +F         L   AE 
Sbjct: 305 EQGIYNVYTGLYKREDGTLLSGPSLFDLVEQKDEQAAKEIQKQFDLARAQVGQLVTSAEK 364

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           N + FDQ+I+ +N  GN +V   I  L++QT ++ +    + +   N
Sbjct: 365 NNQHFDQLIAADNAAGNALVNKTIVALVSQTAAIERAAGVIGIDSLN 411


>gi|167035468|ref|YP_001670699.1| hypothetical protein PputGB1_4475 [Pseudomonas putida GB-1]
 gi|166861956|gb|ABZ00364.1| conserved hypothetical protein [Pseudomonas putida GB-1]
          Length = 445

 Score =  532 bits (1370), Expect = e-149,   Method: Composition-based stats.
 Identities = 166/389 (42%), Positives = 231/389 (59%), Gaps = 5/389 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+++Y  + +A Y D+L  A+TL +AI+  +  PN + L+ A+  W  AR+P
Sbjct: 50  VDEAAGKAVVKHYTEMVYAVYSDSLSTAKTLQTAIDAFLAKPNDETLKAAKEAWFAARVP 109

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N    ANIIAN++I V
Sbjct: 110 YLQSEAFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPAAGANIIANTEIQV 168

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E+++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+ 
Sbjct: 169 GEEKVDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYL 228

Query: 201 IGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+ +LVSDLEEM+  W P   D    K   + +N GL  ++
Sbjct: 229 EGQGATGGHNDRRRAYLKAVTDLLVSDLEEMVGNWAPNVADNYRAKLEAEPVNDGLRKML 288

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +G
Sbjct: 289 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRPDG 348

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN+
Sbjct: 349 TKVSGPSLSSLVAKVDPATDAALKADLEATEAKIQVIVDHALKGEHYDQLIAADNAAGNQ 408

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPN 405
           IVR+ I  L+ QT S+ +    L +   N
Sbjct: 409 IVRDAIAALVKQTGSIEQAAGKLGIANLN 437


>gi|323492413|ref|ZP_08097561.1| iron-regulated protein A precursor [Vibrio brasiliensis LMG 20546]
 gi|323313200|gb|EGA66316.1| iron-regulated protein A precursor [Vibrio brasiliensis LMG 20546]
          Length = 420

 Score =  531 bits (1369), Expect = e-149,   Method: Composition-based stats.
 Identities = 164/409 (40%), Positives = 240/409 (58%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +       NV+ E+V+++YA +AHA + D+L  A+ LD +IE+ +  
Sbjct: 5   SLLAQSVAASLLLASGSVFAANVTKEQVVEHYADVAHAVFADSLTTAKALDQSIESFLAN 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P     +  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV S Y  E
Sbjct: 65  PTADKFQQVKQVWLASRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVSSDYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+K+ +    +D++ I+P+L+  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIVANTKLTIGASTLDVAKITPELIADLNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT G+C RR ++LK  +++LV DLE M K W  D  G
Sbjct: 184 QDLNGTNAGAGARAYTDFVVGEACTNGNCDRRGDFLKAAAELLVQDLEWMEKQWSADVKG 243

Query: 239 QATKDLMKDI-NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+ D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYREELLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G  + G SI+DL++  ++  A+EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGLYKREDGSLLSGPSINDLVAQKDKQAAKEIQKQFDVTRSQVGQLVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+  N +GN +V + I  L+ QT  + +    + +   N
Sbjct: 364 EKNNQFFDQLIAAGNTQGNALVNDTIMSLVAQTAQIERAAKIVGITSLN 412


>gi|15641277|ref|NP_230909.1| iron-regulated protein A, putative [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121590729|ref|ZP_01678060.1| iron-regulated protein A, putative [Vibrio cholerae 2740-80]
 gi|147673863|ref|YP_001216829.1| putative iron-regulated protein A [Vibrio cholerae O395]
 gi|153819649|ref|ZP_01972316.1| iron-regulated protein A, putative [Vibrio cholerae NCTC 8457]
 gi|227081436|ref|YP_002809987.1| putative iron-regulated protein A [Vibrio cholerae M66-2]
 gi|254848388|ref|ZP_05237738.1| iron-regulated protein A [Vibrio cholerae MO10]
 gi|298498644|ref|ZP_07008451.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9655748|gb|AAF94423.1| iron-regulated protein A, putative [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121547410|gb|EAX57521.1| iron-regulated protein A, putative [Vibrio cholerae 2740-80]
 gi|126509808|gb|EAZ72402.1| iron-regulated protein A, putative [Vibrio cholerae NCTC 8457]
 gi|146315746|gb|ABQ20285.1| putative iron-regulated protein A [Vibrio cholerae O395]
 gi|227009324|gb|ACP05536.1| putative iron-regulated protein A [Vibrio cholerae M66-2]
 gi|227013181|gb|ACP09391.1| putative iron-regulated protein A [Vibrio cholerae O395]
 gi|254844093|gb|EET22507.1| iron-regulated protein A [Vibrio cholerae MO10]
 gi|297542977|gb|EFH79027.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 435

 Score =  531 bits (1368), Expect = e-149,   Method: Composition-based stats.
 Identities = 159/409 (38%), Positives = 232/409 (56%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IA+A Y D+ + A+ L   I+  +  
Sbjct: 20  SILSSTILASLTLTTSASFAAAPTQAQVVEHYADIAYAVYADSRVTAQQLQKTIDRFLQA 79

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 80  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 139

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 140 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 198

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 199 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 258

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 259 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 318

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 319 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 378

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 379 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLN 427


>gi|153212296|ref|ZP_01948084.1| iron-regulated protein A, putative [Vibrio cholerae 1587]
 gi|153801301|ref|ZP_01955887.1| iron-regulated protein A, putative [Vibrio cholerae MZO-3]
 gi|153829589|ref|ZP_01982256.1| putative iron-regulated protein A [Vibrio cholerae 623-39]
 gi|254291715|ref|ZP_04962502.1| iron-regulated protein A, putative [Vibrio cholerae AM-19226]
 gi|124116674|gb|EAY35494.1| iron-regulated protein A, putative [Vibrio cholerae 1587]
 gi|124123126|gb|EAY41869.1| iron-regulated protein A, putative [Vibrio cholerae MZO-3]
 gi|148874923|gb|EDL73058.1| putative iron-regulated protein A [Vibrio cholerae 623-39]
 gi|150422399|gb|EDN14359.1| iron-regulated protein A, putative [Vibrio cholerae AM-19226]
          Length = 435

 Score =  531 bits (1367), Expect = e-149,   Method: Composition-based stats.
 Identities = 160/409 (39%), Positives = 232/409 (56%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 20  SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 79

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 80  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 139

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 140 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 198

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 199 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 258

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 259 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 318

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 319 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 378

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 379 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLN 427


>gi|325277944|ref|ZP_08143481.1| hypothetical protein G1E_29817 [Pseudomonas sp. TJI-51]
 gi|324096918|gb|EGB95227.1| hypothetical protein G1E_29817 [Pseudomonas sp. TJI-51]
          Length = 444

 Score =  531 bits (1367), Expect = e-149,   Method: Composition-based stats.
 Identities = 163/389 (41%), Positives = 235/389 (60%), Gaps = 5/389 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+++YA + +A Y D+L  A+TL +A++  +  P+ + L+ A+  W+ AR+P
Sbjct: 49  VDEAAGKAVVKHYAEMVYAVYSDSLSTAKTLQTAVDAFLAKPDDETLKAAKQAWVAARVP 108

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN++I V
Sbjct: 109 YLQSEAFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPAASANIIANTEIQV 167

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E++ID+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+ 
Sbjct: 168 GEEKIDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYL 227

Query: 201 IGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+++LV+DLEEM+  W P   D    K   + +N GL  ++
Sbjct: 228 EGQGATGGHNERRRAYLKAVTQLLVTDLEEMVGNWAPNVADNYRAKLEAEPVNDGLRKML 287

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +G
Sbjct: 288 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRPDG 347

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ G S+  L++  +      +      T     ++ D A+  E +DQ+I+ +N  GN+
Sbjct: 348 TKVSGPSLSSLVAKVDPAADATLKADLEATEAKIQVMVDHAQKGEHYDQLIAPDNAAGNQ 407

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPN 405
           IVR+ I  L+ QT ++ +    L +   N
Sbjct: 408 IVRDAIAALVKQTGAIEQAAGKLGIANLN 436


>gi|330807971|ref|YP_004352433.1| hypothetical protein PSEBR_a1249 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376079|gb|AEA67429.1| Conserved hypothetical protein; putative outer membrane protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 447

 Score =  531 bits (1367), Expect = e-148,   Method: Composition-based stats.
 Identities = 165/393 (41%), Positives = 236/393 (60%), Gaps = 7/393 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           +   + + V+ +YA I +A Y DA   A+TL +A++  +  PN + L+ AR  W+ AR+P
Sbjct: 52  IDEAAAKAVVAHYADIVYAVYSDAESTAKTLQTAVDAFLAKPNAETLKAARTAWVAARVP 111

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSEV+RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   TANIIAN+++ V
Sbjct: 112 YLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGATANIIANTEVQV 170

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+ 
Sbjct: 171 GEDKVDVKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYL 230

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+++LV+DLEEM+  W P   D        +   +GL  ++
Sbjct: 231 QGAGATGGHNDRRRAYLKSVTQLLVNDLEEMVGNWKPNVSDNYRATLEAEPAESGLRKML 290

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  G+ + Y GEY R++G
Sbjct: 291 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGVRNVYLGEYTRVDG 350

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ GAS+  L++  +      +    ++T     ++ D A   E +DQ+I+  N  GN+
Sbjct: 351 TKMTGASLSSLVAKADPAADTALKADLADTEAKIQVMVDHANKGEHYDQLIAAGNTAGNQ 410

Query: 377 IVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
           IVR+ I  L+ QT S+ +    L +  + P+  
Sbjct: 411 IVRDAIAALVKQTGSIEQAAGKLGISDLNPDNA 443


>gi|89073973|ref|ZP_01160479.1| hypothetical protein SKA34_15425 [Photobacterium sp. SKA34]
 gi|89050301|gb|EAR55805.1| hypothetical protein SKA34_15425 [Photobacterium sp. SKA34]
          Length = 417

 Score =  531 bits (1367), Expect = e-148,   Method: Composition-based stats.
 Identities = 171/410 (41%), Positives = 242/410 (59%), Gaps = 10/410 (2%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
                I + +FTLP+    +    + ++V+ +YA +AH  Y DAL  A+ LD AI  LV 
Sbjct: 5   FTHTLIAAAIFTLPT----VTQAATKQEVVTHYADLAHNVYSDALTTAKDLDKAIAALVA 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P++K L  AR+ W  +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  
Sbjct: 61  NPSEKTLSAARIAWKASRVPYQQSEVFRFGNGIVDDWEGQLNAWPLDEGLIDYVANDYQH 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
           E   N    ANI+A++ + V  KEID++ I+P+L+  L+   G + N+ +GYH IEFLLW
Sbjct: 121 E-LGNEGAKANIVASNTLNVGNKEIDVTKITPELIAGLNELGGSEANVASGYHAIEFLLW 179

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP--- 236
           GQDL       G+R +TDF  G  CT G+C RR EYL   S++L++DL+ M K W     
Sbjct: 180 GQDLNGTKSGAGDRKFTDFVKGEACTNGNCDRRAEYLTASSQLLINDLQWMEKQWSATEA 239

Query: 237 DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASY 296
               ++ L +  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+
Sbjct: 240 KNYRSELLAESADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSH 299

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDR 356
             +  GI + YTG Y R NGE + G SI+DL++  ++  A EI  +F  T      L D 
Sbjct: 300 YYNEQGIYNVYTGTYTRTNGEVLTGPSINDLVAAQDKKAAAEIKAEFDKTRAQLQTLVDS 359

Query: 357 AEN-IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           AE   + FDQ+I+ +N  G+ +V   I  L+ QT  + K    + +   N
Sbjct: 360 AEKDNQHFDQLIATDNKAGHALVNKSIMALVQQTAEIEKAASIIGVSNLN 409


>gi|149191668|ref|ZP_01869911.1| putative iron-regulated protein A [Vibrio shilonii AK1]
 gi|148834509|gb|EDL51503.1| putative iron-regulated protein A [Vibrio shilonii AK1]
          Length = 419

 Score =  531 bits (1367), Expect = e-148,   Method: Composition-based stats.
 Identities = 160/403 (39%), Positives = 244/403 (60%), Gaps = 6/403 (1%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           ++  +L   + +    V+ ++V+++YA +AHA + DAL+ A+ LD++I T +  P++K L
Sbjct: 10  AVAASLVMTSSAAFSAVTKDQVVEHYADLAHAVFADALITAKDLDTSINTFLANPSEKGL 69

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
            + +  W+ +R+PYQQ+EV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N  
Sbjct: 70  ADVQQAWLASRVPYQQTEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVSADYQYE-LGNEG 128

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
             ANI+AN  + +    +D+  I+P+++  L+   G + N+ +GYH IEFLLWGQDL   
Sbjct: 129 AQANIVANKSLKIGATTLDVKEITPEVIANLNEVGGSEANVASGYHAIEFLLWGQDLNGT 188

Query: 188 VREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP--DGQATKDL 244
               G RPYTD+ +G  CT G+C RR +YL+  SK+L+ DL+ M K W     G    +L
Sbjct: 189 NAGAGERPYTDYVVGEGCTNGNCERRAQYLQAASKLLIQDLQWMEKQWSASEKGNYRSEL 248

Query: 245 MKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           + D  + G+  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI
Sbjct: 249 LADKADNGIRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGI 308

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN-IES 362
            + YTG Y+R++G  + G SI +L+   ++  A+EI  +F         L   AE   + 
Sbjct: 309 YNVYTGTYVRVDGTLVDGPSIANLVEAKDKTAAKEIQKQFDLARAQVGKLVTSAEKDNQH 368

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           FDQ+I+ NNP+GNK+V   I  L+ QT S+ +    + +   N
Sbjct: 369 FDQLIASNNPQGNKLVNETIVALVAQTGSIERAAGIIGIDSLN 411


>gi|254460033|ref|ZP_05073449.1| insulin-cleaving metalloproteinase outer membrane [Rhodobacterales
           bacterium HTCC2083]
 gi|206676622|gb|EDZ41109.1| insulin-cleaving metalloproteinase outer membrane [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 420

 Score =  530 bits (1366), Expect = e-148,   Method: Composition-based stats.
 Identities = 176/404 (43%), Positives = 259/404 (64%), Gaps = 6/404 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +T  ++V  L + A +    V    VL  YA IA AKY D+L  A+TL +A+  L+  
Sbjct: 4   TILTTTALVTALSTSAFA----VEKADVLGTYADIAAAKYGDSLTTAQTLQAAVNALIAN 59

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+   L+ A+  W+ AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  
Sbjct: 60  PSADALQAAKTAWLAARVPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGP 119

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
           ++EN     N++AN+   ++ +E+D + I+  LL + L  A+G++ N+ TGYH IEFLLW
Sbjct: 120 SDENEFAALNVVANASFTLSGREVDANEINSALLEETLQEADGVEANVATGYHAIEFLLW 179

Query: 181 GQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GQDL  +    GNRP+TD+  G  CT  +C RR EYL   + +LVSDLE M   W   G 
Sbjct: 180 GQDLNGHGAGAGNRPWTDYAAGHACTNDNCDRRGEYLTAATDLLVSDLEWMTAQWAAGGA 239

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
           A  +L ++ +AG+ +++TGM SLSY E+AGERM LG++L+DPE+E  CF+DNT+  + +D
Sbjct: 240 ARTELNRNEDAGIAAVLTGMGSLSYGEVAGERMRLGVMLNDPEEEHSCFADNTHNDHYHD 299

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
            +G+ ++Y GEY+R++G  + GAS+ D+++  + +L  E+  K S TMK    +K  AE 
Sbjct: 300 GLGVQNAYLGEYVRIDGSVVSGASLSDMVAATDVSLDTEMRAKLSATMKALGRIKTTAEA 359

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
             ++DQM+   N  G  ++   +N  I QT S+ ++  AL L +
Sbjct: 360 GFAYDQMLERGNEAGEAVIMGGVNGFIDQTRSIERVVSALGLDQ 403


>gi|307545021|ref|YP_003897500.1| iron-regulated protein [Halomonas elongata DSM 2581]
 gi|307217045|emb|CBV42315.1| K07231 putative iron-regulated protein [Halomonas elongata DSM
           2581]
          Length = 427

 Score =  530 bits (1366), Expect = e-148,   Method: Composition-based stats.
 Identities = 174/406 (42%), Positives = 240/406 (59%), Gaps = 7/406 (1%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
            +++   LP  A++    V+ E+V+ +YA +AHA Y+DAL+ ARTLD  I+ L+  PN +
Sbjct: 13  AVALAALLPVTAMAADSEVTAEQVVDHYADLAHANYQDALVAARTLDERIDALLADPNDE 72

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
            L  AR  W+ AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV S   +    N
Sbjct: 73  TLAAARQAWLEARVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGMIDYVASDDYQHELGN 132

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
              TANIIAN  I V  + +D+S ++P+LL +L+   G + N+ TGYH IEFLLWGQDL 
Sbjct: 133 AGATANIIANQSIQVGGEIVDVSELTPELLAELNEIGGSEANVATGYHAIEFLLWGQDLH 192

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQAT 241
                 G RP +D+  G  CT GHC RR  YL   S +LVSDLE M+  W P   D    
Sbjct: 193 GFEAGNGERPASDYMSGEACTHGHCDRRSAYLDATSDLLVSDLEWMVAQWAPDEDDNYRR 252

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
             L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  
Sbjct: 253 ALLAESPKEGLRRMLFGMGSLSLGELAGERMKVALEANSVEDEHDCFSDNTHNSHYYNGQ 312

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI- 360
           GI + YTG Y R++G  + G S+ DL++  +  L   +  + +++M     LK  AE   
Sbjct: 313 GIQNVYTGSYQRLDGSTLEGPSLSDLVATRDNTLDDTLKAQLTSSMDALEALKQAAEAEQ 372

Query: 361 --ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEP 404
              +FD MI+  N +G ++V N I  L+TQT S+ K    L +   
Sbjct: 373 DPMAFDMMIAPGNEQGAELVNNAILALVTQTGSIEKAAGELGVNSL 418


>gi|297578856|ref|ZP_06940784.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297536450|gb|EFH75283.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 435

 Score =  530 bits (1366), Expect = e-148,   Method: Composition-based stats.
 Identities = 161/409 (39%), Positives = 233/409 (56%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 20  SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 79

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 80  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 139

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  ISP+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 140 -LGNEGANANIIANTALTIGATKVDVKEISPELLASLNEIGGSEANVASGYHAIEFLLWG 198

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 199 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 258

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L + +  GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 259 NYRQQLLSESVENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 318

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 319 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 378

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 379 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLN 427


>gi|302608206|emb|CBW44452.1| putative iron-regulated protein A precursor [Marinobacter
           hydrocarbonoclasticus]
          Length = 431

 Score =  530 bits (1366), Expect = e-148,   Method: Composition-based stats.
 Identities = 165/416 (39%), Positives = 241/416 (57%), Gaps = 9/416 (2%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +   T ++        +       +   V+ +YA +AHA YEDAL+ AR LD A + L+ 
Sbjct: 12  LTIATALTAGCANAPWSAEQSAQATKASVVTHYADLAHATYEDALITARALDEATDRLIA 71

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P + NL+ A+  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV +   +
Sbjct: 72  NPTEANLKAAKEAWLASRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVKADDYQ 131

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
               N   TANI+A++ I V  + +D++ ++P+LL  L+   G + N+ TGYH +EFLLW
Sbjct: 132 HELGNAGATANIVASNSINVGGETLDVATLTPELLADLNEVGGSEANVATGYHAVEFLLW 191

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP--- 236
           GQDL       G RP TD+  GN CT G+C RR +YL  V+ +LV DLE M+  W P   
Sbjct: 192 GQDLHGFEGGAGERPVTDYAKGNDCTNGNCERRAQYLDAVTDLLVDDLEWMVAQWAPGTS 251

Query: 237 DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASY 296
           D   ++    + + G+  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+
Sbjct: 252 DNYRSQLTSANADEGIQKMLFGMGSLSLGELAGERMKVALEANSYEDEHDCFSDNTHNSH 311

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDR 356
             +  GI + YTG Y R++G  + G S+ DL+   N  L   +N +   +M+   ++K R
Sbjct: 312 YYNGQGIQNVYTGTYRRVDGSVVSGPSLSDLVEQTNPELDARLNRQLDASMEALALMKAR 371

Query: 357 AE---NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
           AE   N  +FD MI+  N EG +IV   I  L+ QT S+ +    L +  + P+  
Sbjct: 372 AESSQNPMAFDTMIAPGNAEGTRIVNGAIMALVEQTGSIEQAARQLGIQALSPDDA 427


>gi|120555744|ref|YP_960095.1| putative iron-regulated protein A [Marinobacter aquaeolei VT8]
 gi|120325593|gb|ABM19908.1| imelysin, Metallo peptidase, MEROPS family M75 [Marinobacter
           aquaeolei VT8]
          Length = 431

 Score =  530 bits (1365), Expect = e-148,   Method: Composition-based stats.
 Identities = 164/416 (39%), Positives = 241/416 (57%), Gaps = 9/416 (2%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +   T ++        +       +   V+ +YA +AHA YEDAL+ AR LD A + L+ 
Sbjct: 12  LTIATALTAGCANAPWSAEQSAQATKASVVTHYADLAHATYEDALITARALDEATDRLIA 71

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P + NL+ A+  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV +   +
Sbjct: 72  NPTEANLKAAKEAWLASRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVKADDYQ 131

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
               N   TANI+A++ I V  + +D++ ++P+LL  L+   G + N+ TGYH +EFLLW
Sbjct: 132 HELGNAGATANIVASNSINVGGETLDVATLTPELLADLNEVGGSEANVATGYHAVEFLLW 191

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP--- 236
           GQDL       G RP TD+  GN CT G+C RR +YL  V+ +LV DLE M+  W P   
Sbjct: 192 GQDLHGFEGGAGERPVTDYAKGNDCTNGNCERRAQYLDAVTDLLVDDLEWMVAQWAPGTS 251

Query: 237 DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASY 296
           D   ++    + + G+  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+
Sbjct: 252 DNYRSQLTSANADEGIQKMLFGMGSLSLGELAGERMKVALEANSYEDEHDCFSDNTHNSH 311

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDR 356
             +  GI + YTG Y R++G  + G S+ DL+   N  L   +N +   +M+   ++K R
Sbjct: 312 YYNGQGIQNVYTGTYRRVDGSVVSGPSLSDLVEQTNPELDARLNRQLDASMEALALMKAR 371

Query: 357 AE---NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
           AE   N  +FD MI+  N EG +I+   I  L+ QT S+ +    L +  + P+  
Sbjct: 372 AESSQNPMAFDTMIAPGNAEGTRIINGAIMALVEQTGSIEQAARQLGIQALSPDDA 427


>gi|262171702|ref|ZP_06039380.1| iron-regulated protein A precursor [Vibrio mimicus MB-451]
 gi|261892778|gb|EEY38764.1| iron-regulated protein A precursor [Vibrio mimicus MB-451]
          Length = 420

 Score =  530 bits (1365), Expect = e-148,   Method: Composition-based stats.
 Identities = 162/409 (39%), Positives = 239/409 (58%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +T   +     S + S+    +  +V+++YA IAHA Y D+ + A+ L  +I+  + T
Sbjct: 5   SILTSAILASLTLSASASLAAAPTQAQVVEHYANIAHAVYADSRLTAQQLQKSIDRFLQT 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  K LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAKGLEEVKQAWLAARVPYQQSEVFRFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIVANTSLTIGANKLDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDG 238
           QDL       G R YTD+  G  CT G+C RR +YLK  +++LV+DLE M K W  G  G
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKECTNGNCDRRAQYLKAAAQLLVTDLEWMEKQWANGEKG 243

Query: 239 QATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              + L+ +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLNESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + +TG Y R +G ++ G S+++L++  + + A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIFTGTYTRADGSELKGPSLYELVAEKDASAAKEILQQFEAARTQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 364 EKNNQHFDQLIAADNTAGHAIINQAIMALVVQTGSIERAAGIIGIDNLN 412


>gi|144899636|emb|CAM76500.1| lipoprotein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 423

 Score =  530 bits (1365), Expect = e-148,   Method: Composition-based stats.
 Identities = 190/403 (47%), Positives = 253/403 (62%), Gaps = 2/403 (0%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           F+ + +    L     +    V  + VL  YA IAHAKYED+L+ A+ L  AI+ LV  P
Sbjct: 4   FVMVAASAAVLLGTGQAGAAGVDKKAVLTTYADIAHAKYEDSLIAAKQLKVAIDALVAAP 63

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSS-YGKE 121
           + + L  A+  WI AR+PYQQSE +RFGN  VD W+ KVNAWPLDEG IDYV++  YG E
Sbjct: 64  SAETLATAKAAWIAARVPYQQSEAFRFGNTAVDEWEGKVNAWPLDEGLIDYVNADTYGTE 123

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
           + EN LYTANIIA+ K+ V  K ++ S I   LL K+H A G++ N+TTGYH IEF+LWG
Sbjct: 124 SGENPLYTANIIAHPKLKVGGKNVNASKIDKKLLAKMHEAGGVEANVTTGYHAIEFMLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           QD        GNRP +DFD  +CTGG+C RR  YL   + +LV DL+ M+  WG  G+  
Sbjct: 184 QDTNGTGPGAGNRPASDFDTKSCTGGNCDRRAAYLVTATDLLVDDLKTMVDGWGAKGKIR 243

Query: 242 KDLMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
             L+K   +AG+ +I+TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D 
Sbjct: 244 AKLLKGKADAGIATIVTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHFYDA 303

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
            GI + Y G+Y R +G ++ G ++ DL++  +  L  ++  K   TM    +L   AE  
Sbjct: 304 KGIQNIYLGKYTRTDGTEVKGPALADLVAAKDATLDGDMKAKLDATMTAMGVLVKTAEGG 363

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           E++DQMI   N  GN  V+  I+ L+ QT SL K    L L E
Sbjct: 364 EAYDQMIGAGNSAGNAKVQAAIDALVAQTRSLEKAVAVLALGE 406


>gi|163857778|ref|YP_001632076.1| hypothetical protein Bpet3465 [Bordetella petrii DSM 12804]
 gi|163261506|emb|CAP43808.1| putative exported protein [Bordetella petrii]
          Length = 432

 Score =  529 bits (1363), Expect = e-148,   Method: Composition-based stats.
 Identities = 195/392 (49%), Positives = 265/392 (67%), Gaps = 13/392 (3%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
             + V+Q YA IA A YED+L  A+ L +A+E L+  P+ + L+ AR  W+ AR+PYQQ+
Sbjct: 24  EPKAVVQTYADIALAGYEDSLASAQALRAAVEALIEQPSAQTLQAARAAWLAARVPYQQT 83

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           E +RFGN +VD W+  VNAWPLDEG IDYVD+SYG E+++N  Y  N+IANSKI V  K 
Sbjct: 84  EAFRFGNPVVDDWEGSVNAWPLDEGLIDYVDASYGTESDQNAFYAVNVIANSKISVGGKT 143

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE------------P 191
           ID + I+P+LL + LH A+G + N+ TGYH IEFLLWGQDL  +                
Sbjct: 144 IDATTITPELLAETLHEADGNEANVATGYHAIEFLLWGQDLNGSGPAPADRQGTPQERHA 203

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
           GNRP+TDFD   CTGGHC RRV+YL+ V+ +LV+DLE M+  W  DGQA K + +D  AG
Sbjct: 204 GNRPHTDFDPAQCTGGHCERRVQYLRAVTDLLVADLETMVANWKADGQARKAVEQDPKAG 263

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  + IGI + Y G Y
Sbjct: 264 LVAMLTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHFYNQIGIRNVYLGSY 323

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENN 371
            R+NG+ + GAS+ DL+   +  L  E+  K   T+     ++DRA+ +E++DQMI+  N
Sbjct: 324 ARINGKTVAGASVSDLVKARDPKLDAEMRAKLDATVAAMQAMRDRADKVETYDQMIASGN 383

Query: 372 PEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
            EGN +V+  I+ L+ QT SL ++   L+L E
Sbjct: 384 AEGNAVVQAAIDRLVDQTRSLERVIAVLELGE 415


>gi|59711797|ref|YP_204573.1| hypothetical protein VF_1190 [Vibrio fischeri ES114]
 gi|59479898|gb|AAW85685.1| Uncharacterized iron-regulated protein [Vibrio fischeri ES114]
          Length = 417

 Score =  529 bits (1362), Expect = e-148,   Method: Composition-based stats.
 Identities = 172/405 (42%), Positives = 235/405 (58%), Gaps = 9/405 (2%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I + +F +PS    I    +  +V+++YA IAHA Y D+L  A+ LD AI T +  P+K
Sbjct: 10  LITASLFVIPS----ISQATTQSEVVEHYADIAHAVYSDSLSTAQKLDKAITTFLNNPSK 65

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
             LE  +L W  AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  E   
Sbjct: 66  DGLETVKLAWKEARVPYQQSEVFRFGNAIVDEWEGQLNAWPLDEGLIDYVADDYQYE-LG 124

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
           N+   ANI+A+  I +  + ID++ I  + L  L+   G + N+ TGYH IEFLLWGQDL
Sbjct: 125 NDGAKANIVASKSIKIGAETIDVTSIKAEQLADLNELGGSEANVATGYHAIEFLLWGQDL 184

Query: 185 KTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQAT 241
                  G RPYTD+ IG+ CT G+C RR EYLK  S++L+ DL  M K W         
Sbjct: 185 NGTNSGAGERPYTDYVIGSACTNGNCERRAEYLKAASELLIKDLSWMEKQWKEGEKNYRA 244

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
           + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  
Sbjct: 245 ELLSESSEQGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQ 304

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN-I 360
           GI + YTG Y R +G ++ G SIHDL++  +   A+EI  +F  T      L   AE   
Sbjct: 305 GIYNVYTGTYTRADGSQLSGPSIHDLVAKKDAKAAKEIKQQFDATRTQVGTLVSAAEKDN 364

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           + FDQ+I+ +N  GN +V   I  L+ QT S+ +    + +   N
Sbjct: 365 QHFDQLIAADNAVGNALVNKSIMSLVLQTASIERAANVIGITSLN 409


>gi|163735580|ref|ZP_02143012.1| lipoprotein, putative [Roseobacter litoralis Och 149]
 gi|161391200|gb|EDQ15537.1| lipoprotein, putative [Roseobacter litoralis Och 149]
          Length = 419

 Score =  528 bits (1361), Expect = e-148,   Method: Composition-based stats.
 Identities = 177/383 (46%), Positives = 252/383 (65%), Gaps = 2/383 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
               VL NYA IA AKYED+L  A+ L SA++TL+ TP+ + L+ A+  WI+AR+PYQQS
Sbjct: 22  DKAAVLDNYADIALAKYEDSLTTAQALQSAVDTLIATPSAEALQAAKEAWIKARVPYQQS 81

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG   +EN     N+IAN    ++ + 
Sbjct: 82  EVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGATDENEYAVLNVIANPSFTLSGET 141

Query: 145 IDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           +D + I+P LL   LH A+ +++N+ TGYH IEFLLWGQDL  +    GNRP+TD+ +G+
Sbjct: 142 LDATEITPALLEGALHEADAVESNVATGYHAIEFLLWGQDLNGHGPGAGNRPWTDYAVGD 201

Query: 204 -CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSL 262
            CTGG+C RR +YL   +++LVSDL+ M+  W   G A   L  D NAG+++I+TGM SL
Sbjct: 202 ACTGGNCDRRGDYLSAATELLVSDLDWMVAQWQDGGAARTQLTADENAGISTILTGMGSL 261

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           SY E AGERM LGL+L+DPE+E DCF+DNT+ S+  D +GI + Y G Y R++G  + G 
Sbjct: 262 SYGEQAGERMKLGLMLNDPEEEHDCFADNTHNSHFYDAMGIRNVYLGSYTRIDGTVVSGP 321

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+  L++  +  +  E+  K + TM +   +K  AE   ++D M+   N  G  ++   +
Sbjct: 322 SLSSLVAAADAGVDAELTAKLNTTMLEMSEMKTAAEAGFAYDMMLERGNEAGEALIMGAV 381

Query: 383 NDLITQTESLRKIRIALDLIEPN 405
           + L+ QT S+ +  +AL + +  
Sbjct: 382 DALVDQTRSIERAVVALGVDQIE 404


>gi|152996576|ref|YP_001341411.1| putative iron-regulated protein [Marinomonas sp. MWYL1]
 gi|150837500|gb|ABR71476.1| putative iron-regulated protein [Marinomonas sp. MWYL1]
          Length = 431

 Score =  528 bits (1361), Expect = e-148,   Method: Composition-based stats.
 Identities = 181/401 (45%), Positives = 260/401 (64%), Gaps = 3/401 (0%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +T   +    P+        ++ + V+ +YA IA A Y D+L  A+TL S+IET +  P 
Sbjct: 12  VTGAMLTACGPATVKKESSAITADSVVVHYADIAEAVYGDSLTTAKTLRSSIETFLANPT 71

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSS-YGKEN 122
           + NL+ AR +WI AR+PYQQSEVYRFGN IVD W+ KVNAWPLDEG IDYV +  YG E+
Sbjct: 72  EVNLKAARAEWIAARVPYQQSEVYRFGNPIVDEWEGKVNAWPLDEGLIDYVAADSYGTES 131

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWG 181
           + N LY AN+IA++ +++   +ID + I+P+L+   L  A+G++ N+ +GYH IEFLLWG
Sbjct: 132 DLNPLYAANVIASTSLMIGGVKIDTTNITPELIADSLQEADGVEANVASGYHAIEFLLWG 191

Query: 182 QDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           QDL       G RP TDFD+ NCT G+C RR +YL   + +L+SDLEEM   W   G A 
Sbjct: 192 QDLNGTNPGAGERPATDFDLNNCTNGNCDRRRDYLVAATDLLISDLEEMANNWKQGGAAR 251

Query: 242 -KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              L +    GL++I+TGM SL+Y EL GER  LGL+LHDPE+E DCFSDNT+ S+  D 
Sbjct: 252 VALLEQSAEQGLSTILTGMGSLAYGELGGERTKLGLMLHDPEEEHDCFSDNTHWSHYYDA 311

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
            GI ++Y GEY R++G  + GAS+ DL++  N  L  E+  K + T      + D A+  
Sbjct: 312 KGIKNAYLGEYKRVDGSWVKGASLSDLVAKQNPQLDIEMKQKLNETEAAAQAMVDAAKKG 371

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           ++FD +I+ NN +GN++V+N ++ L+ +T +  ++   L+L
Sbjct: 372 QTFDVLIAMNNTKGNQLVQNFVDSLVNETRTTEEVIHELNL 412


>gi|229592249|ref|YP_002874368.1| hypothetical protein PFLU4859 [Pseudomonas fluorescens SBW25]
 gi|229364115|emb|CAY51736.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 447

 Score =  528 bits (1361), Expect = e-148,   Method: Composition-based stats.
 Identities = 169/391 (43%), Positives = 232/391 (59%), Gaps = 5/391 (1%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
             V   + + V+ +YA +  A Y DA   A+TL +AI+  +  PN + L+ AR  WI AR
Sbjct: 50  GQVDEAAAKAVVAHYADMVFAVYSDAESTAKTLQTAIDAFLAKPNDETLKAARTAWIAAR 109

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
           +PY QSEV+RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   TANIIAN++I
Sbjct: 110 VPYLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGATANIIANTEI 168

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
            V E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D
Sbjct: 169 QVGEDKVDVKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASD 228

Query: 199 FDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNS 254
           +  G+  TGGH  RR  YL+ V+++LVSDLEEM+  W P   D        +    GL  
Sbjct: 229 YLTGDGATGGHNERRRTYLRAVTQLLVSDLEEMVGNWKPNVEDNYRATLEAEPATDGLRK 288

Query: 255 IITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRM 314
           ++ GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R+
Sbjct: 289 MLFGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGIRNVYLGEYTRV 348

Query: 315 NGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEG 374
           +G K+ GAS+  L++  +      +    + T     ++ D A   E +DQ+I+  N  G
Sbjct: 349 DGTKLTGASLSSLVAKADPAADTALKADLAATEAKIQVMVDHANKGEHYDQLIAAGNDAG 408

Query: 375 NKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           N+IVR+ I  L+ QT S+      L + + N
Sbjct: 409 NQIVRDAIAALVKQTGSIEAAAGKLGISDLN 439


>gi|327483952|gb|AEA78359.1| Iron-regulated protein A precursor [Vibrio cholerae LMA3894-4]
          Length = 420

 Score =  528 bits (1360), Expect = e-148,   Method: Composition-based stats.
 Identities = 160/409 (39%), Positives = 232/409 (56%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWVSGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 364 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLN 412


>gi|110678258|ref|YP_681265.1| putative lipoprotein [Roseobacter denitrificans OCh 114]
 gi|109454374|gb|ABG30579.1| lipoprotein, putative [Roseobacter denitrificans OCh 114]
          Length = 408

 Score =  528 bits (1360), Expect = e-148,   Method: Composition-based stats.
 Identities = 178/383 (46%), Positives = 250/383 (65%), Gaps = 2/383 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
               VL NYA IA AKYED+L  A+ L SA++TL+ TP+ + L+ A+  WIRAR+PYQQS
Sbjct: 22  DKAAVLDNYADIALAKYEDSLTTAQALQSAVDTLIATPSAEALQAAKEAWIRARVPYQQS 81

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG   + N     N+IAN    ++ + 
Sbjct: 82  EVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGATDANEYAVLNVIANPSFTLSGET 141

Query: 145 IDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           +D + I+P LL   LH A+ +++N+ TGYH IEFLLWGQDL  +    GNRP+TD+ +G 
Sbjct: 142 LDATQITPALLEGALHEADAVESNVATGYHAIEFLLWGQDLNGHGPGAGNRPWTDYAVGE 201

Query: 204 -CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSL 262
            CTGG+C RR +YL   +++LVSDLE M+  W   G A   L+ D NAG+++I+TGM SL
Sbjct: 202 ACTGGNCDRRGDYLSAATELLVSDLEWMVAQWQDGGAARTQLIADENAGISAILTGMGSL 261

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           SY E AGERM LGL+L+DPE+E DCF+DNT+ S+  D +GI + Y G Y R++G  + G 
Sbjct: 262 SYGEQAGERMKLGLMLNDPEEEHDCFADNTHNSHFYDAMGIRNVYLGSYTRIDGTIVSGP 321

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+  L++  +  +  E+  K + TM +   +K  AE   ++D M+   N  G  ++   +
Sbjct: 322 SLSSLVAAADAGVDAELTAKLNTTMLEMSEMKTAAEAGFAYDMMLERGNAAGEALIMGAV 381

Query: 383 NDLITQTESLRKIRIALDLIEPN 405
           + L+ QT S+ +   AL + +  
Sbjct: 382 DALVEQTRSIERAVAALGVDQIE 404


>gi|229505149|ref|ZP_04394659.1| iron-regulated protein A precursor [Vibrio cholerae BX 330286]
 gi|229511179|ref|ZP_04400658.1| iron-regulated protein A precursor [Vibrio cholerae B33]
 gi|229518298|ref|ZP_04407742.1| iron-regulated protein A precursor [Vibrio cholerae RC9]
 gi|229608169|ref|YP_002878817.1| iron-regulated protein A precursor [Vibrio cholerae MJ-1236]
 gi|255745660|ref|ZP_05419608.1| iron-regulated protein A precursor [Vibrio cholera CIRS 101]
 gi|262159063|ref|ZP_06030175.1| iron-regulated protein A precursor [Vibrio cholerae INDRE 91/1]
 gi|262169421|ref|ZP_06037113.1| iron-regulated protein A precursor [Vibrio cholerae RC27]
 gi|229345013|gb|EEO09987.1| iron-regulated protein A precursor [Vibrio cholerae RC9]
 gi|229351144|gb|EEO16085.1| iron-regulated protein A precursor [Vibrio cholerae B33]
 gi|229357372|gb|EEO22289.1| iron-regulated protein A precursor [Vibrio cholerae BX 330286]
 gi|229370824|gb|ACQ61247.1| iron-regulated protein A precursor [Vibrio cholerae MJ-1236]
 gi|255736735|gb|EET92132.1| iron-regulated protein A precursor [Vibrio cholera CIRS 101]
 gi|262022234|gb|EEY40943.1| iron-regulated protein A precursor [Vibrio cholerae RC27]
 gi|262029248|gb|EEY47900.1| iron-regulated protein A precursor [Vibrio cholerae INDRE 91/1]
          Length = 420

 Score =  528 bits (1360), Expect = e-148,   Method: Composition-based stats.
 Identities = 159/409 (38%), Positives = 232/409 (56%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IA+A Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSTILASLTLTTSASFAAAPTQAQVVEHYADIAYAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 364 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLN 412


>gi|229525863|ref|ZP_04415268.1| iron-regulated protein A precursor [Vibrio cholerae bv. albensis
           VL426]
 gi|229529656|ref|ZP_04419046.1| iron-regulated protein A precursor [Vibrio cholerae 12129(1)]
 gi|229333430|gb|EEN98916.1| iron-regulated protein A precursor [Vibrio cholerae 12129(1)]
 gi|229339444|gb|EEO04461.1| iron-regulated protein A precursor [Vibrio cholerae bv. albensis
           VL426]
          Length = 420

 Score =  528 bits (1359), Expect = e-148,   Method: Composition-based stats.
 Identities = 160/409 (39%), Positives = 232/409 (56%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 364 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLN 412


>gi|197334683|ref|YP_002155989.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           fischeri MJ11]
 gi|197316173|gb|ACH65620.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           fischeri MJ11]
          Length = 417

 Score =  528 bits (1359), Expect = e-148,   Method: Composition-based stats.
 Identities = 172/405 (42%), Positives = 235/405 (58%), Gaps = 9/405 (2%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I + +F +PS    I    +  +V+++YA IAHA Y D+L  A+ LD AI T +  P+K
Sbjct: 10  LITASLFVIPS----ISQAATQSEVVEHYADIAHAVYSDSLSAAQKLDKAITTFLNNPSK 65

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
             LE  +L W  AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  E   
Sbjct: 66  DGLETVKLAWKEARVPYQQSEVFRFGNAIVDEWEGQLNAWPLDEGLIDYVADDYQYE-LG 124

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
           N+   ANI+A+  I +  + ID++ I  + L  L+   G + N+ TGYH IEFLLWGQDL
Sbjct: 125 NDGAKANIVASKSIKIGAETIDVTSIKAEQLADLNELGGSEANVATGYHAIEFLLWGQDL 184

Query: 185 KTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQAT 241
                  G RPYTD+ IG+ CT G+C RR EYLK  S++L+ DL  M K W         
Sbjct: 185 NGTNSGAGERPYTDYVIGSACTNGNCERRAEYLKAASELLIKDLSWMEKQWKEGEKNYRA 244

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
           + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  
Sbjct: 245 ELLSESSEQGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQ 304

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN-I 360
           GI + YTG Y R +G ++ G SIHDL++  +   A+EI  +F  T      L   AE   
Sbjct: 305 GIYNVYTGTYTRADGSQLSGPSIHDLVAKKDAKAAKEIKQQFDATRTQVGTLVSAAEKDN 364

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           + FDQ+I+ +N  GN +V   I  L+ QT S+ +    + +   N
Sbjct: 365 QHFDQLIAADNAAGNALVNKSIMSLVLQTASIERAANVIGITSLN 409


>gi|262189894|ref|ZP_06048216.1| iron-regulated protein A precursor [Vibrio cholerae CT 5369-93]
 gi|262034223|gb|EEY52641.1| iron-regulated protein A precursor [Vibrio cholerae CT 5369-93]
          Length = 420

 Score =  528 bits (1359), Expect = e-148,   Method: Composition-based stats.
 Identities = 161/409 (39%), Positives = 232/409 (56%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + A S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSAILASLTLTTAASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 364 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLN 412


>gi|83950301|ref|ZP_00959034.1| lipoprotein, putative [Roseovarius nubinhibens ISM]
 gi|83838200|gb|EAP77496.1| lipoprotein, putative [Roseovarius nubinhibens ISM]
          Length = 424

 Score =  528 bits (1359), Expect = e-148,   Method: Composition-based stats.
 Identities = 185/400 (46%), Positives = 252/400 (63%), Gaps = 2/400 (0%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
            T   +  +L S A          +VL  YA IA A Y D+L  AR L  A+  L+  P+
Sbjct: 6   ATTSILALSLASAAPLWAEAPEKTEVLNTYADIAAAGYGDSLTTARALQEAVAALIADPS 65

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           + NL  AR  WI AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   +
Sbjct: 66  EANLAAARAAWIDARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGATD 125

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN     N++AN K  ++ +E+D S I+P LL + LH A+G++ N+ TGYH IEFLLWGQ
Sbjct: 126 ENGFAVLNVVANPKFTLSGQEVDASDITPALLAETLHEADGVEANVATGYHAIEFLLWGQ 185

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           DL  +    G+RP+TDF  G  CT G+C RR  YLK  + +LVSDL+ M   W  DG A 
Sbjct: 186 DLNGHAAGAGDRPWTDFASGEACTNGNCDRRAAYLKAATDLLVSDLDWMAAQWASDGAAR 245

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
             L+ D +AG+++++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +
Sbjct: 246 ATLLSDEDAGISAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGL 305

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           G+ + Y G Y R++G K+ G S+ DL++  +  L  E+  K S TM     LK  A+   
Sbjct: 306 GVQNVYLGAYTRVDGSKVEGPSLADLVAAQDAALDAEMQAKLSTTMDALGALKSAADGGF 365

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           S+D M+   N +G  ++   +N LI QT S+ ++  AL +
Sbjct: 366 SYDMMLERGNDKGEALIMGGVNGLIDQTRSIERVVAALGV 405


>gi|261253184|ref|ZP_05945757.1| iron-regulated protein A precursor [Vibrio orientalis CIP 102891]
 gi|260936575|gb|EEX92564.1| iron-regulated protein A precursor [Vibrio orientalis CIP 102891]
          Length = 420

 Score =  527 bits (1357), Expect = e-147,   Method: Composition-based stats.
 Identities = 164/408 (40%), Positives = 239/408 (58%), Gaps = 6/408 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +        L +       NV+ ++V+++YA +AHA + D++  A+ LD +IE  +  P
Sbjct: 6   LLAQSVAASLLIASGSVFAANVTKDQVVEHYADVAHAVFADSVTTAKALDVSIENFLANP 65

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
                E  +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E 
Sbjct: 66  TAAKFEQVKQVWLASRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSADYQYE- 124

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N    ANI+AN+++ +   ++D++ I+P L+  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 125 LGNEGANANIVANTELTIGASKLDVAKITPQLIADLNEVGGSEANVASGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQ 239
           DL       G R YTDF +G  CT GHC RR ++LK  +++LV DLE M   W  D  G 
Sbjct: 185 DLNGTNAGAGQRAYTDFVVGAECTNGHCDRRGDFLKAAAELLVQDLEWMENQWSADVKGN 244

Query: 240 ATKDLMKDI-NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
             ++L+ D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YREELLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G  + G SIHDL+S N++  AQEI  +F  T      L   AE
Sbjct: 305 NEQGIYNVYTGLYKREDGTLLSGPSIHDLVSQNDKQAAQEIQKQFDMTRSQVGQLVTSAE 364

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
            N + FDQ+I+  N +GN +V + I  L+ QT  + +    + +   N
Sbjct: 365 KNNQYFDQLIAAGNTQGNALVNDTIMSLVAQTVQIERAAKIVGITSLN 412


>gi|209695263|ref|YP_002263192.1| putative iron-regulated protein [Aliivibrio salmonicida LFI1238]
 gi|208009215|emb|CAQ79471.1| putative iron-regulated protein [Aliivibrio salmonicida LFI1238]
          Length = 417

 Score =  526 bits (1356), Expect = e-147,   Method: Composition-based stats.
 Identities = 169/405 (41%), Positives = 241/405 (59%), Gaps = 9/405 (2%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            + + +F LP+ + +     +  +V+++YA IAHA Y DAL  A++LD+ +   +  P++
Sbjct: 10  LLTASLFVLPTFSYAA----TQSEVVEHYADIAHAVYSDALTTAQSLDTTLNAFLANPSE 65

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           K LE A++ W  AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV   Y  E   
Sbjct: 66  KTLEQAKIAWKAARVPYQQSEVFRFGNPVVDDWEGQLNAWPLDEGLIDYVADDYQYE-LG 124

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
           N+   ANI+++  I +  + ID++ I  D L  L+   G + N+ TGYH IEFLLWGQDL
Sbjct: 125 NDGAKANIVSSKSIKIGAETIDVTNIKADHLAALNELGGSEANVATGYHAIEFLLWGQDL 184

Query: 185 KTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQAT 241
                  G RPYTD+ IG+ CT G+C RR EYLK  S++L+SDL  M K W         
Sbjct: 185 NGTNAGAGERPYTDYAIGSACTNGNCERRAEYLKAASELLISDLSWMEKQWKEGETNYRA 244

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
           + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  
Sbjct: 245 ELLEESSKQGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQ 304

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA-ENI 360
           GI + YTG Y R +G  + G SIH+L++  ++  A+EI  +F    +    L   A EN 
Sbjct: 305 GIYNVYTGTYKRTDGTILAGPSIHELVAQKDKQAAKEIQQQFDQAREQVKTLVISAEENN 364

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           + FDQ+I+ NN  GN +V   I  L+TQT S+ +    + +   N
Sbjct: 365 QHFDQLIAANNAAGNALVNQSIMALVTQTASIERAANIIGITSLN 409


>gi|229515638|ref|ZP_04405097.1| iron-regulated protein A precursor [Vibrio cholerae TMA 21]
 gi|229347407|gb|EEO12367.1| iron-regulated protein A precursor [Vibrio cholerae TMA 21]
          Length = 420

 Score =  526 bits (1355), Expect = e-147,   Method: Composition-based stats.
 Identities = 159/409 (38%), Positives = 231/409 (56%), Gaps = 6/409 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+  R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLATRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 364 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLN 412


>gi|307943588|ref|ZP_07658932.1| imelysin [Roseibium sp. TrichSKD4]
 gi|307773218|gb|EFO32435.1| imelysin [Roseibium sp. TrichSKD4]
          Length = 421

 Score =  526 bits (1355), Expect = e-147,   Method: Composition-based stats.
 Identities = 194/381 (50%), Positives = 251/381 (65%), Gaps = 2/381 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
           S ++VL  Y  IA A Y D+L  A+ L SAI+TL+  P + NL  AR  W+ AR PYQQ+
Sbjct: 24  SPKEVLGTYGDIAQAGYADSLESAKLLQSAIDTLIAEPTEANLATARSAWVAARNPYQQT 83

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EVYRFGN IVD W+ +VNAWPLDEG IDYVD+SYG E EEN+ Y AN+IAN  + V  + 
Sbjct: 84  EVYRFGNAIVDNWEGRVNAWPLDEGLIDYVDASYGTEAEENDFYVANVIANPTLKVGGET 143

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           ID ++I+  LL+  L  A  ++ N+ TGYH IEFLLWGQDL       GNRP TDFD  N
Sbjct: 144 IDATVINASLLQDTLQEAGEVEANVATGYHAIEFLLWGQDLNGTGPGAGNRPTTDFDTAN 203

Query: 204 CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL-MKDINAGLNSIITGMTSL 262
           CTGG+C RR +YLK  + +L+SDLEEM+ AW P G A +DL  K    GL +I+TGM SL
Sbjct: 204 CTGGNCERRSQYLKAATDLLISDLEEMVAAWAPGGAAREDLGSKGDTGGLATILTGMGSL 263

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           SY ELAGERM LGL+LHDPE+E DCFSDNT+ S+ NDV+GI + Y G Y    G  + GA
Sbjct: 264 SYGELAGERMKLGLMLHDPEEEHDCFSDNTHMSHYNDVVGIRNVYFGTYKSDFGRDVSGA 323

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+  ++   +  LA E+  K   T+  F  +  R    E++DQ+I E N EGN +V+  I
Sbjct: 324 SLAHMVEDKDPALAAEMKTKLDATLAAFEAVNARVAQGEAYDQLIGEGNAEGNALVQAAI 383

Query: 383 NDLITQTESLRKIRIALDLIE 403
           + L+ QT S+ ++   L L +
Sbjct: 384 DALVDQTTSIERVVKVLGLDD 404


>gi|260768288|ref|ZP_05877222.1| iron-regulated protein A precursor [Vibrio furnissii CIP 102972]
 gi|260616318|gb|EEX41503.1| iron-regulated protein A precursor [Vibrio furnissii CIP 102972]
 gi|315179995|gb|ADT86909.1| Uncharacterized iron-regulated protein [Vibrio furnissii NCTC
           11218]
          Length = 419

 Score =  526 bits (1355), Expect = e-147,   Method: Composition-based stats.
 Identities = 164/387 (42%), Positives = 234/387 (60%), Gaps = 6/387 (1%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V+ ++V+ +YA IAHA + D+L  A+ L+ +I++ +  P++  L+  +  WI AR+PYQQ
Sbjct: 26  VTQDQVVAHYADIAHAVFSDSLTTAKNLEKSIDSFLAAPSEAKLQQVKQAWITARVPYQQ 85

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           SEV+RFGN +VD W+ ++NAWPLDEG IDYV   Y  E   N   +ANI+ N+ I +   
Sbjct: 86  SEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSDDYQYE-LGNEGASANIVGNASITIGAT 144

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
            ID S I+P+L+  L+   G + N+ +GYH IEFLLWGQDL       G RPYTD+  G+
Sbjct: 145 TIDASKITPELIASLNEVGGSEANVASGYHAIEFLLWGQDLHGTQAGAGERPYTDYAQGD 204

Query: 204 -CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATKDLMKDINA-GLNSIITGM 259
            CT G+C RR +YLK  +++LV DLE M K W     G   + L+ D +  GL  ++ GM
Sbjct: 205 ACTHGNCDRRAQYLKASAQLLVQDLEWMEKQWSEKEKGNYREALLTDSSTNGLRKMLFGM 264

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            SLS  ELAGERM + L  +  E E DCFSDNT+ S+  D  GI + YTG Y R +G  +
Sbjct: 265 GSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYDEQGIYNIYTGTYTRADGSTL 324

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIV 378
            GASI+DL++  +   A+EI  +F         L + AE N + FDQ+I+ +N  GN +V
Sbjct: 325 TGASIYDLVAQKDDVAAKEIMKQFDAARAQVGELVNSAEKNNQHFDQLIAADNKAGNALV 384

Query: 379 RNLINDLITQTESLRKIRIALDLIEPN 405
              I  L+ QT S+ +    + +   N
Sbjct: 385 NKAIMALVAQTASIERAANVIGIDNLN 411


>gi|149377143|ref|ZP_01894892.1| iron-regulated protein A, putative [Marinobacter algicola DG893]
 gi|149358561|gb|EDM47034.1| iron-regulated protein A, putative [Marinobacter algicola DG893]
          Length = 442

 Score =  526 bits (1354), Expect = e-147,   Method: Composition-based stats.
 Identities = 156/409 (38%), Positives = 243/409 (59%), Gaps = 9/409 (2%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           +   +  +   +    ++   V+++YA +AHA +EDAL  A++LDS ++T + +P ++NL
Sbjct: 30  TASTSSSTEEPAAAEAITKSDVVEHYADLAHANFEDALTAAQSLDSTVDTFLESPTEENL 89

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           + A+  W+ +R+PYQQ+EV+RFGN +VD W+ ++NAWPLDEG IDYV     +    N  
Sbjct: 90  QKAKQAWLASRVPYQQTEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVKEDGYQYELGNEG 149

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
            TANIIA+ +I +    +D S ++P+LL +L+   G + N+ TGYH IEFLLWGQDL   
Sbjct: 150 ATANIIASPEINIGGTTVDASSLTPELLAELNEIGGSEANVATGYHAIEFLLWGQDLHGF 209

Query: 188 VREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKD 243
            R  G RP TD+  G  CT G+C RR  YL   + +L++DLE M+  W P   D   ++ 
Sbjct: 210 DRGAGQRPATDYAQGEECTHGNCDRRAAYLDAATDLLITDLEWMVAQWAPGQEDNYRSQL 269

Query: 244 LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           L +  +A +  +  GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  G+
Sbjct: 270 LAEAPDAAIQKMFFGMGSLSLGELAGERMKVALEANSYEDEHDCFSDNTHNSHYYNGQGV 329

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI--- 360
            + Y+G Y R++G ++ G S+ D+++  N  L + ++ +F ++M     +K  AE     
Sbjct: 330 ANIYSGSYTRIDGSELTGPSLSDMVAELNPELDETLSQQFEDSMDALQTMKSSAEAESEP 389

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
             FD MI+  N +G KIV   I  L+ QT S+ +    L +  ++P+  
Sbjct: 390 MKFDMMIAPGNEKGAKIVNGAIMALVAQTGSIEQAARELGIDSLKPDDA 438


>gi|330445729|ref|ZP_08309381.1| imelysin family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489920|dbj|GAA03878.1| imelysin family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 418

 Score =  525 bits (1352), Expect = e-147,   Method: Composition-based stats.
 Identities = 173/406 (42%), Positives = 239/406 (58%), Gaps = 9/406 (2%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            +   +F+LP+ A +     + + V+ +YA +AH+ Y DAL  A+TLD AI  LV  P++
Sbjct: 9   LVAVALFSLPAVAQAAT---TKQDVVTHYADLAHSVYSDALTTAQTLDKAIAALVANPSE 65

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           + L  AR  W  +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  E   
Sbjct: 66  QTLSAAREAWKASRVPYQQSEVFRFGNGIVDDWEGQLNAWPLDEGLIDYVAKDYQHE-LG 124

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
           N    ANII+N KI V  KEID++ I+P+L+  L+   G + N+ +GYH IEFLLWGQDL
Sbjct: 125 NEGANANIISNKKINVGNKEIDVAKITPELIADLNELGGSEANVASGYHAIEFLLWGQDL 184

Query: 185 KTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQA 240
                  G+R +TDF  G  CT G+C RR +YL   S++L++DL+ M K W         
Sbjct: 185 NGTGSGAGDRKFTDFVKGEACTNGNCDRRSDYLTASSQLLINDLQWMEKQWSATEAKNYR 244

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
           ++ L +  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  + 
Sbjct: 245 SELLAESADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNE 304

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN- 359
            GI + YTG Y R+NGE + G SIHDL++  +   A EI  +F         L D AE  
Sbjct: 305 QGIFNVYTGSYTRVNGEVLTGPSIHDLVAAKDEKAAAEIKAEFVQARAQLQTLVDSAEKD 364

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
            + FDQ+I+  N  GN +V   I  L+ QT  + K    + +   N
Sbjct: 365 NQHFDQLIAAGNKAGNALVNKSIMALVKQTAEIEKAASIIGVSNLN 410


>gi|87122310|ref|ZP_01078192.1| hypothetical protein MED121_03527 [Marinomonas sp. MED121]
 gi|86162453|gb|EAQ63736.1| hypothetical protein MED121_03527 [Marinomonas sp. MED121]
          Length = 427

 Score =  524 bits (1350), Expect = e-147,   Method: Composition-based stats.
 Identities = 175/401 (43%), Positives = 258/401 (64%), Gaps = 1/401 (0%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
               +++    S  +     ++   V+ NY+ IAHA Y D+L  A++L  A++  +  P 
Sbjct: 11  CVAATLLTACGSQGVQPNKAITANDVVVNYSDIAHAIYTDSLTTAQSLKVAVDAFIANPT 70

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           +  L NAR  WI +R+PYQQSEVYRFGN IVD W+ KVNAWPLDEG IDYV + YG +++
Sbjct: 71  EATLANARQAWIDSRVPYQQSEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVATDYGTDSD 130

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
            N LYTAN++A++ + +  + +D S I+P LL +LH A+ ++ N+ TGYH IEFLLWGQD
Sbjct: 131 VNPLYTANVVASTSLTIAGQAVDTSNITPSLLEELHEADEVEANVATGYHAIEFLLWGQD 190

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
           L       G RP TD+D+ NCTGG+C RR  YL   + +L++DLEEM   WG +G+A + 
Sbjct: 191 LNGTNPGAGERPATDYDVNNCTGGNCDRRAAYLVAATDLLITDLEEMAANWGANGEARQA 250

Query: 244 LM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
           ++ +    GL +I+TGM SL+Y EL GER  LGL+LHDPE+E DCFSDNT+ S+  D  G
Sbjct: 251 ILDQGDKQGLATILTGMGSLAYGELGGERTKLGLMLHDPEEEHDCFSDNTHYSHFYDAKG 310

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           I + Y GEY R++G  + GAS+  L+S  +  L  E+  K  NT +    + D A+  ++
Sbjct: 311 IQNVYLGEYQRVDGSWVKGASLSALVSAQDSILDAEMKGKLENTQEAGQAMVDAAKVGQT 370

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           FD +I+  N  GN++V++ ++ L+ +T +  +I   L+L +
Sbjct: 371 FDVLIAMGNQAGNQLVQDFVDSLVAETRTTEEIIRLLELED 411


>gi|323497652|ref|ZP_08102669.1| uncharacterized iron-regulated protein [Vibrio sinaloensis DSM
           21326]
 gi|323317401|gb|EGA70395.1| uncharacterized iron-regulated protein [Vibrio sinaloensis DSM
           21326]
          Length = 420

 Score =  524 bits (1350), Expect = e-146,   Method: Composition-based stats.
 Identities = 162/392 (41%), Positives = 235/392 (59%), Gaps = 8/392 (2%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
            V+ E+V+++YA +AHA +ED+L+ A+ L+  IE+ +  P+    E  +  W+ +R+PYQ
Sbjct: 26  KVTQEQVVEHYADVAHAVFEDSLVTAKQLEKTIESFLAAPSAAKFEEVKQAWLESRVPYQ 85

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNE 142
           QSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N   +ANI+AN ++ +  
Sbjct: 86  QSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVSADYQYE-LGNEGASANIVANKQLKIGA 144

Query: 143 KEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG 202
             +D++ ++P  +  L+   G + N+ +GYH IEFLLWGQDL       G R YTDF +G
Sbjct: 145 TTLDVAELTPAAIADLNEVGGSEANVASGYHAIEFLLWGQDLNGTSAGAGQRAYTDFVVG 204

Query: 203 -NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDI-NAGLNSIITG 258
             CT G+C RR EYLK  +++LV DLE M K W  D  G    +L+ D    GL  ++ G
Sbjct: 205 AECTNGNCDRRGEYLKATAELLVQDLEWMEKQWSADEKGNYRAELLADSAENGLRKMLFG 264

Query: 259 MTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEK 318
           M SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG Y R +G  
Sbjct: 265 MGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYTGLYKRQDGTL 324

Query: 319 IHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN-IESFDQMISENNPEGNKI 377
           + G SI+DL++  ++  AQEI  +F  T      L   AE   E FDQ+I+  N +GN +
Sbjct: 325 VSGPSINDLVAQKDKQAAQEIQKQFDTTRAQVGQLVTSAEKEGEFFDQLIASGNAKGNAL 384

Query: 378 VRNLINDLITQTESLRKIR--IALDLIEPNRV 407
           V   I  L+ QT  + +    + ++ + P+  
Sbjct: 385 VNETIMSLVAQTTQIERAAKIVGINSLNPDTA 416


>gi|254466477|ref|ZP_05079888.1| insulin-cleaving metalloproteinase outer membrane protein
           [Rhodobacterales bacterium Y4I]
 gi|206687385|gb|EDZ47867.1| insulin-cleaving metalloproteinase outer membrane protein
           [Rhodobacterales bacterium Y4I]
          Length = 422

 Score =  524 bits (1350), Expect = e-146,   Method: Composition-based stats.
 Identities = 190/403 (47%), Positives = 260/403 (64%), Gaps = 2/403 (0%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M  + +        +   S         VL NYA IA AKY+D+L  A+ L +A++ LV 
Sbjct: 1   MKSLFLAGTALAGLTFGASAALAAEKSAVLTNYANIAEAKYQDSLTTAQALKAAVDALVA 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P+ +NL+ AR  WI AR+PYQQSEV+RFGN IVD W+ KVNAWPLDEG IDYVD++YG 
Sbjct: 61  QPSAENLQAARAAWIAARVPYQQSEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDAAYGG 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLL 179
             EEN L   N+IAN    ++ K +D + I+P+LL   LH A+GI+ N+ TGYH IEFLL
Sbjct: 121 PTEENTLAALNVIANPSFELSGKAVDAARITPELLESTLHEADGIEANVATGYHAIEFLL 180

Query: 180 WGQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           WGQDL       G RP+TD+  G+ CT G+C RR +YL+  + +L+SDLE M   WG +G
Sbjct: 181 WGQDLNGTGHGAGERPWTDYAQGDACTNGNCGRRGDYLQAATDLLISDLEWMAAQWGAEG 240

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            A   L+ D  AG+ +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  
Sbjct: 241 DARTALLADEYAGITAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYY 300

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D +G+ + Y GEY+R+NGE + G S+ DL++  +  L  E+  K ++TM     +K  AE
Sbjct: 301 DGLGVQNVYLGEYVRVNGELVSGPSLSDLVAEKDAELDTEMRGKLADTMLALGRIKTAAE 360

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
              S+DQM+++ N  G  +V   +N LI QT S+ ++  ALDL
Sbjct: 361 AGLSYDQMLAQGNAAGEALVMGGVNGLIGQTRSIERVVTALDL 403


>gi|26987649|ref|NP_743074.1| hypothetical protein PP_0913 [Pseudomonas putida KT2440]
 gi|24982331|gb|AAN66538.1|AE016282_6 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 443

 Score =  524 bits (1349), Expect = e-146,   Method: Composition-based stats.
 Identities = 163/391 (41%), Positives = 232/391 (59%), Gaps = 5/391 (1%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
             V   + + V+++Y  + +A Y D+L  A+TL +A++  +  PN + L+ A+  W  AR
Sbjct: 46  GAVDEAAGKAVVKHYTDMVYAVYSDSLSTAKTLQTAVDAFLAKPNDETLKAAKEAWFAAR 105

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
           +PY QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN++I
Sbjct: 106 VPYLQSETFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGASANIIANTEI 164

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
            V E+++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D
Sbjct: 165 QVGEEKVDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASD 224

Query: 199 FDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNS 254
           +  G   TGGH  RR  YLK V+ +LV+DLEEM+  W P   D    K   + +N GL  
Sbjct: 225 YLEGQGATGGHNDRRRAYLKAVTDLLVTDLEEMVGNWAPNVADNYRAKLEAEPVNDGLRK 284

Query: 255 IITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRM 314
           ++ GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R 
Sbjct: 285 MLFGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRP 344

Query: 315 NGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEG 374
           +G K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  G
Sbjct: 345 DGTKLTGPSLSSLVAKVDPAADAALKADLEATEAKLQVIVDHALKGEHYDQLIAADNAAG 404

Query: 375 NKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           N++VR+ I  L+ QT S+ +    L +   N
Sbjct: 405 NQVVRDAIAALVKQTGSIEQAAGKLGIANLN 435


>gi|229521377|ref|ZP_04410796.1| iron-regulated protein A precursor [Vibrio cholerae TM 11079-80]
 gi|229341475|gb|EEO06478.1| iron-regulated protein A precursor [Vibrio cholerae TM 11079-80]
          Length = 420

 Score =  523 bits (1348), Expect = e-146,   Method: Composition-based stats.
 Identities = 160/396 (40%), Positives = 229/396 (57%), Gaps = 6/396 (1%)

Query: 15  SHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
           + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  P  + LE  +  W
Sbjct: 18  TTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQAPTAQGLEEVKQAW 77

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           + AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E   N    ANIIA
Sbjct: 78  LAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE-LGNEGANANIIA 136

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNR 194
           N+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G R
Sbjct: 137 NTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQDLNGTKAGAGAR 196

Query: 195 PYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINA 250
            YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D    + L +    
Sbjct: 197 SYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKDNYRQQLLSESAEN 256

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
           GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG 
Sbjct: 257 GLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNIYTGS 316

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISE 369
           Y R +G ++ G S++ L++  + N A+EI  +F         L   AE N + FDQ+I+ 
Sbjct: 317 YTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAEKNNQHFDQLIAA 376

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 377 DNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLN 412


>gi|83944208|ref|ZP_00956664.1| lipoprotein, putative [Sulfitobacter sp. EE-36]
 gi|83845075|gb|EAP82956.1| lipoprotein, putative [Sulfitobacter sp. EE-36]
          Length = 419

 Score =  523 bits (1348), Expect = e-146,   Method: Composition-based stats.
 Identities = 172/402 (42%), Positives = 250/402 (62%), Gaps = 6/402 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +    +  TL S AL+    V   +V+  YA IA A Y D+L+ A+ L  A++ L+  P+
Sbjct: 5   LMTSVLALTLASPALA----VEKSEVIDTYADIAEAAYGDSLITAQALVDAVDALIAEPS 60

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
              ++ AR  W+ AR+PYQQ+E YRFGN IVD W+ K+NAWPLDEG IDYVD+SYG   +
Sbjct: 61  ADTMQAARTAWLAARVPYQQTEAYRFGNPIVDDWEGKLNAWPLDEGLIDYVDASYGGATD 120

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN     N+IAN    ++  E+D S I+PD L + LH A+G + N+ +GYH +EFLLWGQ
Sbjct: 121 ENAAAALNVIANPTFTLSGTEVDASTITPDFLAETLHEADGNEANVASGYHAVEFLLWGQ 180

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           DL       G R +TD+  G +CT  +C RR +YLK  + ++V+DLE M+  W   G A 
Sbjct: 181 DLNGTEHGAGGRDWTDYATGEDCTNDNCDRRGQYLKAAADLIVTDLEYMVAQWAEGGAAR 240

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
            +L  + +  +++++TGM SLSY ELAGERM LGL+L+DPE+E DCFSDNT+ S+  D +
Sbjct: 241 TNLTDNEDGAISAMLTGMGSLSYGELAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGL 300

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y G Y R +G  + G S+ DL++  N +L  E+    S TM+    +K  AE   
Sbjct: 301 GIQNVYLGAYARTDGTLVTGPSLSDLVAAENADLDAEMQLNLSTTMRKLGQIKTAAEAGM 360

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           S+DQM++  N  G  +V   +N LI QT+++ ++   L + +
Sbjct: 361 SYDQMMARGNKGGEALVMGGVNALIAQTKTIERVVATLGVDD 402


>gi|311695455|gb|ADP98328.1| lipoprotein [marine bacterium HP15]
          Length = 428

 Score =  523 bits (1348), Expect = e-146,   Method: Composition-based stats.
 Identities = 168/416 (40%), Positives = 246/416 (59%), Gaps = 12/416 (2%)

Query: 4   ITIISIVFTLPSH---ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +T+ +++    ++   +       +   V+ +YA +AHA YEDAL+ AR LD A + L+ 
Sbjct: 9   LTVTALLTAGCANHPWSTKDHQPATKNSVVDHYADLAHANYEDALITARALDEATDRLIA 68

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P + NL  A+  W+ AR+PYQQ+EV+RFGN IVD W+ ++NAWPLDEG IDYV +   +
Sbjct: 69  NPTEANLATAKEAWLAARVPYQQTEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVKADGYQ 128

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
               N   TANIIA+++I V  + ++++ +SP LL  L+   G + N+ TGYH +EFLLW
Sbjct: 129 HELGNAGATANIIASNRINVGGETLNVASLSPALLADLNEVGGSEANVATGYHAVEFLLW 188

Query: 181 GQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP--- 236
           GQDL       G RP TD+  G +CT G+C RR EYL  V+ +LVSDLE M+  W P   
Sbjct: 189 GQDLHGFESGAGERPVTDYAKGADCTNGNCERRGEYLDAVTDLLVSDLEWMVAQWAPGAS 248

Query: 237 DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASY 296
           D    +    D N G+  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+
Sbjct: 249 DNYRAQLTAADANQGVQKMLFGMGSLSLGELAGERMKVALEANSYEDEHDCFSDNTHNSH 308

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDR 356
             +  GI + YTG Y R++G  + G S+ DL+  ++  L   +N++   +M+   ++K R
Sbjct: 309 YYNGQGIQNVYTGTYRRVDGSLVTGPSLSDLVQQSDPELDARLNNQLDASMEALALMKAR 368

Query: 357 A---ENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
           A   EN  +FD MI+  N EG +IV   I  L+ QT S+ +    L +  + P+  
Sbjct: 369 AESSENPMAFDTMIAPGNAEGTRIVNGAIMALVAQTGSIEQAARDLGIEALSPDDA 424


>gi|148546195|ref|YP_001266297.1| hypothetical protein Pput_0952 [Pseudomonas putida F1]
 gi|148510253|gb|ABQ77113.1| Uncharacterized iron-regulated protein [Pseudomonas putida F1]
          Length = 444

 Score =  523 bits (1348), Expect = e-146,   Method: Composition-based stats.
 Identities = 164/389 (42%), Positives = 232/389 (59%), Gaps = 5/389 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+++Y  + +A Y D+L  A+TL +A++  +  PN + L+ A+  W  AR+P
Sbjct: 49  VDEAAGKAVVKHYTDMVYAVYSDSLSTAKTLQTAVDAFLAKPNDETLKAAKEAWFAARVP 108

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN++I V
Sbjct: 109 YLQSETFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGASANIIANTEIQV 167

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E+++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+ 
Sbjct: 168 GEEKVDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYL 227

Query: 201 IGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+ +LV+DLEEM+  W P   D    K   + +N GL  ++
Sbjct: 228 EGQGATGGHNDRRRAYLKAVTDLLVTDLEEMVGNWAPNVADNYRAKLEAEPVNDGLRKML 287

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +G
Sbjct: 288 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRPDG 347

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN+
Sbjct: 348 TKLTGPSLSSLVAKVDPAADAALKADLEATEAKLQVIVDHALKGEHYDQLIAADNAAGNQ 407

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPN 405
           IVR+ I  L+ QT S+ +    L +   N
Sbjct: 408 IVRDAIAALVKQTGSIEQAAGKLGIANLN 436


>gi|254511799|ref|ZP_05123866.1| insulin-cleaving metalloproteinase outer membrane protein
           [Rhodobacteraceae bacterium KLH11]
 gi|221535510|gb|EEE38498.1| insulin-cleaving metalloproteinase outer membrane protein
           [Rhodobacteraceae bacterium KLH11]
          Length = 422

 Score =  523 bits (1347), Expect = e-146,   Method: Composition-based stats.
 Identities = 189/405 (46%), Positives = 259/405 (63%), Gaps = 4/405 (0%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           F    ++   + S A++  P  S   VL  YA IA AKY+D+L+ A+ L +A+ TL+  P
Sbjct: 5   FAATSALTLCIASAAIADAP--SKADVLNTYANIAEAKYDDSLIAAKRLQAAVNTLIADP 62

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +   L  AR  W+ AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  +
Sbjct: 63  SDATLNAARAAWVAARVPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPS 122

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWG 181
           +EN     N+IAN    ++ + ID S I+P+LL   LH A+GI+ N+ TGYH IEFLLWG
Sbjct: 123 DENEFAVLNVIANPSFELSGQTIDASDITPELLSGTLHEADGIEANVATGYHAIEFLLWG 182

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDL  +    GNRPYTD+  G+ CTGG+C RR +YL   + +LVSDLE M   W   G A
Sbjct: 183 QDLNGHNAGAGNRPYTDYVQGDGCTGGNCDRRAQYLSAATDLLVSDLEWMTSQWSEGGDA 242

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              L  D +AG+++I+TGM SLSY E AGERM LGL+L+DPE+E DCF+DNT+ S+  D 
Sbjct: 243 RAALTADESAGVSAILTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFADNTHNSHYYDG 302

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +GI + Y G Y R++G  + GAS+ DL+   +  L  E+  K + TMK    +K  AE  
Sbjct: 303 LGIQNVYLGNYTRIDGTPVSGASLSDLVLATDPALDTEMKAKLAATMKALGNIKSTAEAG 362

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
            ++DQM+   N  G  ++   +N L+ QT+++ +I   LDL +  
Sbjct: 363 FAYDQMLERGNEAGEALIMGGVNGLVDQTKTIERIVTVLDLNQIE 407


>gi|118592450|ref|ZP_01549842.1| hypothetical protein SIAM614_26521 [Stappia aggregata IAM 12614]
 gi|118435108|gb|EAV41757.1| hypothetical protein SIAM614_26521 [Stappia aggregata IAM 12614]
          Length = 420

 Score =  522 bits (1344), Expect = e-146,   Method: Composition-based stats.
 Identities = 200/404 (49%), Positives = 267/404 (66%), Gaps = 6/404 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           + + +++      + AL+  P+     +L  Y  IA AKY D+L  A+TL +AI+ LV  
Sbjct: 4   FKLGLLAASALFVTPALAAAPS----DILSTYGDIAQAKYADSLATAKTLKTAIDKLVAE 59

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P + NLE AR  W  AR PYQQ+E YRFGN IVD W+ KVNAWPLDEG IDYVD+SYG E
Sbjct: 60  PTEANLEAARTAWKDARDPYQQTEAYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGDE 119

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
           +EEN+ Y AN+IAN  + V  + ID + I+P LL   L  A  ++TN+ TGYH IEFLLW
Sbjct: 120 SEENDFYVANVIANPSLKVGGETIDATEITPALLADTLQEAGEVETNVATGYHAIEFLLW 179

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           GQDL       G RP TDFD  NCTGG+C RR++YL+  + +L+SDLEEM  AW PDG A
Sbjct: 180 GQDLNGTDAGAGKRPATDFDPANCTGGNCERRIQYLQAATDLLISDLEEMAAAWAPDGAA 239

Query: 241 TKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
            ++L  K    GL +I+TGM SLSY ELAGER+ LGL+LHDPE+E DCFSDNT+ S+ ND
Sbjct: 240 REELASKGEAGGLATILTGMGSLSYGELAGERIKLGLMLHDPEEEHDCFSDNTHMSHYND 299

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
           V+GI + Y G Y    G  + GAS+ +L++  +  LA+E+  K   T+  F  +K RAE 
Sbjct: 300 VVGIRNVYFGSYKSPVGNDVSGASLAELVAEKDPALAEEMKTKLDATLAAFEAMKARAEA 359

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
            E++DQMI E N EGN +V+  ++ L+ QT S+ ++   L+L +
Sbjct: 360 GEAYDQMIGEGNEEGNAVVQAAVDALVDQTASIERVVKVLELDD 403


>gi|126729383|ref|ZP_01745197.1| lipoprotein, putative [Sagittula stellata E-37]
 gi|126710373|gb|EBA09425.1| lipoprotein, putative [Sagittula stellata E-37]
          Length = 419

 Score =  521 bits (1343), Expect = e-146,   Method: Composition-based stats.
 Identities = 175/407 (42%), Positives = 258/407 (63%), Gaps = 5/407 (1%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M  +T  +   +L +   + +      +VL  YA IA A YED+L  A+ L  A++ L+ 
Sbjct: 1   MKTLTTTAAAMSLCA---APLFAADSAEVLDTYADIAQAGYEDSLTTAKALQKAVDALIA 57

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P++  L  AR  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG 
Sbjct: 58  NPSEDTLAAARDAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGG 117

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLL 179
            ++EN     N+IA     ++ +EID S I+P+L+ + LH A+G++ N+ +GYH IEFLL
Sbjct: 118 PSDENQFAGLNVIATPSFTLSGEEIDASEITPELIAETLHEADGVEANVASGYHAIEFLL 177

Query: 180 WGQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           WGQDL       G+R + D+  G+ CT G+C RR EYL+  +++LVSDLE M   W   G
Sbjct: 178 WGQDLNGTDAGAGDRSFADYASGDACTNGNCDRRAEYLQAATELLVSDLEWMAAQWQEGG 237

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            A   LM+D +AG+ +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  
Sbjct: 238 AARDALMEDEDAGIVAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHFY 297

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D  G+ + Y G Y R++G ++ GAS+ DL++  +  L +E+  K   TM++   +   AE
Sbjct: 298 DGKGVQNVYLGSYTRVDGTEVTGASLSDLVAEADPALDEEMKAKLHTTMENLGAIVAAAE 357

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           +  S+D M+   N EG  ++   ++ L+ QT S+ ++  AL +   +
Sbjct: 358 DGFSYDMMLERGNAEGEALIMGGVDALVDQTRSIERVVSALSVDSID 404


>gi|261211007|ref|ZP_05925297.1| iron-regulated protein A precursor [Vibrio sp. RC341]
 gi|260839982|gb|EEX66582.1| iron-regulated protein A precursor [Vibrio sp. RC341]
          Length = 420

 Score =  521 bits (1341), Expect = e-145,   Method: Composition-based stats.
 Identities = 156/386 (40%), Positives = 229/386 (59%), Gaps = 6/386 (1%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
           +  +V+++YA IAHA Y D+ + A+ L  +I+  +  P  K L++ +  W+ AR+PYQQS
Sbjct: 28  TQTQVVEHYADIAHAVYADSRVTAQQLQKSIDRFLQKPTAKGLDDVKQAWLAARVPYQQS 87

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EV+RFGN IVD W+ ++NAWPLDEG IDYV  +Y  E   N    ANI+AN+ + +    
Sbjct: 88  EVFRFGNTIVDDWEGQLNAWPLDEGLIDYVAGTYQHE-LGNAGANANIVANTSLTIGANN 146

Query: 145 IDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-N 203
           ID+  I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G R YTD+  G  
Sbjct: 147 IDVQEITPELLASLNEIGGSEANVASGYHAIEFLLWGQDLNGTKAGAGTRSYTDYLQGKE 206

Query: 204 CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATKDLM-KDINAGLNSIITGMT 260
           CT G+C RR +YL   +++LV+DLE M K W  G  G   + L+ +    GL  ++ GM 
Sbjct: 207 CTNGNCDRRAQYLNAAAQLLVTDLEWMEKQWANGEKGNYRQQLLSESSENGLRKMLFGMG 266

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
           SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + +TG Y R +G ++ 
Sbjct: 267 SLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNIFTGTYTRADGSELK 326

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIVR 379
           G S++ L++  + + A+EI  +F         L   AE N + FDQ+I+ +N  G+ I+ 
Sbjct: 327 GPSLYALVAEKDASAAKEILQQFETARTQVGELVTLAEKNNQHFDQLIAADNTAGHAIIN 386

Query: 380 NLINDLITQTESLRKIRIALDLIEPN 405
             I  L+ QT S+ +    + +   N
Sbjct: 387 QAIMALVVQTGSIERAAGIIGIDNLN 412


>gi|126727963|ref|ZP_01743787.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2150]
 gi|126702766|gb|EBA01875.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2150]
          Length = 419

 Score =  520 bits (1340), Expect = e-145,   Method: Composition-based stats.
 Identities = 178/402 (44%), Positives = 257/402 (63%), Gaps = 6/402 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           +++   +I   L + AL+    V    VL  YA IA A Y D+L+ A+ L +A+  LV  
Sbjct: 3   HYLLTTAIAVGLATPALA----VETTDVLDTYADIAAANYGDSLITAQRLQTAVNALVAD 58

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ +NL  AR  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  
Sbjct: 59  PSAENLTAARAAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGP 118

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
           ++EN     N+IAN    ++ ++ID + I+P LL   L  A+G++ N+ TGYH IEFLLW
Sbjct: 119 SDENAFAALNVIANPTFTLSGQDIDATSITPALLEDTLQEADGVEANVATGYHAIEFLLW 178

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GQDL  +    G+RP+TD+ +G+ CT G+C RR EYL   + +L+SDLE M  AW   G+
Sbjct: 179 GQDLNGHGTGAGDRPWTDYAMGDDCTNGNCDRRGEYLTAATDLLISDLEYMAGAWADGGE 238

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
           A  +LM D + G+++I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  +
Sbjct: 239 ARTELMSDADVGISAILTGMGSLSYGETAGERMRLGVMLNDPEEEHSCFADNTHNDHYYN 298

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
            +GI + Y GEYIR++G  I G S+ DL++  +  L  E+  K  + +     +K  AE 
Sbjct: 299 GVGIQNVYLGEYIRVDGSLITGPSLSDLVAETDAALDAEMQGKLGDAVMALGRIKIAAEA 358

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
             ++DQM+   N  G  ++   +N LI QT S+ ++  AL +
Sbjct: 359 GFAYDQMLERGNEAGEALIMGGVNGLIDQTRSIERVITALGV 400


>gi|330504568|ref|YP_004381437.1| hypothetical protein MDS_3654 [Pseudomonas mendocina NK-01]
 gi|328918854|gb|AEB59685.1| hypothetical protein MDS_3654 [Pseudomonas mendocina NK-01]
          Length = 445

 Score =  520 bits (1339), Expect = e-145,   Method: Composition-based stats.
 Identities = 159/390 (40%), Positives = 229/390 (58%), Gaps = 6/390 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+ +YA +A A + DA    + L +A++ L+  P++  L+ AR  W+ AR+P
Sbjct: 49  VDEAAAKAVVNHYADLALAVFSDAASTGKALQAAVDALLADPSEATLKAAREAWLAARVP 108

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y Q+EV+RFGN +VD W+ ++NAWPLDEG IDYV   Y +    N    ANIIAN++I V
Sbjct: 109 YMQTEVFRFGNPVVDEWEGQLNAWPLDEGLIDYVADDY-QHALGNPGAQANIIANTEIQV 167

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+S I+ +LL  L+   G + N+ TGYH IEFLLWGQDL       G RPYTD+ 
Sbjct: 168 GEDKIDVSEITGELLASLNELGGSEANVATGYHAIEFLLWGQDLNGTNPGAGERPYTDYL 227

Query: 201 IGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDI-NAGLNSII 256
           +G   TGGH  RR  YLK  + +LVSDL+EM++ W     G    +L+ D    GL  ++
Sbjct: 228 VGEGATGGHNERRRTYLKAATDLLVSDLDEMVEQWKDGVEGNYRSELVADSAENGLRKML 287

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY + +G
Sbjct: 288 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYKKADG 347

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGN 375
             + G S+ +L++  +      +      T      L D AE N   FDQ+I+ +N EG 
Sbjct: 348 TTLTGPSLSELVAKADAQADATLKADLQETEAKLQALVDSAEKNNVHFDQLIAADNAEGQ 407

Query: 376 KIVRNLINDLITQTESLRKIRIALDLIEPN 405
           ++VR+ I  L+ QT ++ +    L + + N
Sbjct: 408 QLVRDAIAALVKQTGAIEQAAGKLGISDLN 437


>gi|146308346|ref|YP_001188811.1| hypothetical protein Pmen_3326 [Pseudomonas mendocina ymp]
 gi|145576547|gb|ABP86079.1| imelysin, Metallo peptidase, MEROPS family M75 [Pseudomonas
           mendocina ymp]
          Length = 445

 Score =  519 bits (1338), Expect = e-145,   Method: Composition-based stats.
 Identities = 159/395 (40%), Positives = 231/395 (58%), Gaps = 6/395 (1%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
              + V   + + V+ +YA +A A + DA    + L SA++ L+  P++  L+ AR  W+
Sbjct: 44  AGAAQVDEAAAKAVVNHYADLALAVFSDAASTGKALQSAVDALLADPSEATLKAAREAWL 103

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR+PY Q+EV+RFGN +VD W+ ++NAWPLDEG IDYV   Y +    N    ANIIAN
Sbjct: 104 AARVPYMQTEVFRFGNPVVDEWEGQLNAWPLDEGLIDYVADDY-QHALGNPGAQANIIAN 162

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
           ++I V E +ID++ I+ +LL  L+   G + N+ TGYH IEFLLWGQDL       G RP
Sbjct: 163 TEIQVGEDKIDVAEITGELLASLNELGGSEANVATGYHAIEFLLWGQDLNGTNPGAGERP 222

Query: 196 YTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDINA-G 251
           YTD+ +G   TGGH  RR  YLKV + +LVSDL +M++ W     G    +L+ D    G
Sbjct: 223 YTDYLVGEGATGGHNERRRTYLKVATDLLVSDLNDMVEQWKDGVEGNYRSELVADSGENG 282

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y G Y
Sbjct: 283 LRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYNGKGIRNVYLGVY 342

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISEN 370
            +++G  + G S+ +L++  +      +      T      L D AE N   FDQ+I+E+
Sbjct: 343 KKVDGSTLSGPSLSELVAKVDAQADASLKADLQATEAKLQALVDSAEKNNVHFDQLIAED 402

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           N EG ++VR+ I  L+ QT ++ +    L + + N
Sbjct: 403 NAEGQQLVRDAIAALVKQTGAIEQAAAKLGISDLN 437


>gi|90579545|ref|ZP_01235354.1| hypothetical protein VAS14_01246 [Vibrio angustum S14]
 gi|90439119|gb|EAS64301.1| hypothetical protein VAS14_01246 [Vibrio angustum S14]
          Length = 417

 Score =  519 bits (1337), Expect = e-145,   Method: Composition-based stats.
 Identities = 174/410 (42%), Positives = 241/410 (58%), Gaps = 10/410 (2%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
                I + +FTLP+ A       + E+V+ +YA +AH+ Y DAL  A+ LD AI  LV 
Sbjct: 5   FTHTLIAAAIFTLPTVA----QAATKEEVVTHYADLAHSVYSDALTTAQDLDKAIAALVA 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P++K L  AR  W  +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  
Sbjct: 61  NPSEKTLSAARTAWKASRVPYQQSEVFRFGNGIVDDWEGQLNAWPLDEGLIDYVAKDYQH 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
           E   N    ANI+A+  + V  KEID++ I+P+L+  L+   G + N+ +GYH IEFLLW
Sbjct: 121 E-LGNEGAKANIVASKTLNVGNKEIDVTKITPELIADLNELGGSEANVASGYHAIEFLLW 179

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP--- 236
           GQDL       G+R +TDF  G  CT G+C RR EYL   S++L++DL+ M K W     
Sbjct: 180 GQDLNGTKSGAGDRKFTDFVKGEACTNGNCDRRAEYLTASSQLLINDLQWMEKQWSATEA 239

Query: 237 DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASY 296
               ++ L +  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+
Sbjct: 240 KNYRSELLAESADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSH 299

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDR 356
             +  GI + YTG Y R NGE + G SI+DL++  ++  A EI  +F  T     IL D 
Sbjct: 300 YYNEQGIYNVYTGTYTRTNGEVLTGPSINDLVAAKDKKAAAEIKAEFDKTRAQLQILVDS 359

Query: 357 AEN-IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           AE   + FDQ+I+ +N  G+ +V   I  L+ QT  + K    + +   N
Sbjct: 360 AEKDNQHFDQLIATDNKAGHALVNKSIMALVQQTAEIEKAASIIGVSNLN 409


>gi|83955090|ref|ZP_00963746.1| lipoprotein, putative [Sulfitobacter sp. NAS-14.1]
 gi|83840419|gb|EAP79592.1| lipoprotein, putative [Sulfitobacter sp. NAS-14.1]
          Length = 419

 Score =  519 bits (1337), Expect = e-145,   Method: Composition-based stats.
 Identities = 171/402 (42%), Positives = 250/402 (62%), Gaps = 6/402 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +    +  TL S AL+    V   +V+  YA IA A Y D+L+ A+ L  A++ L+  P+
Sbjct: 5   LMTSVLALTLASPALA----VEKSEVIDTYADIAEAAYGDSLITAQALVDAVDALIAEPS 60

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
              ++ AR  W+ AR+PYQQ+E YRFGN IVD W+ K+NAWPLDEG IDYVD+SYG   +
Sbjct: 61  ADTMQAARTAWLAARVPYQQTEAYRFGNPIVDDWEGKLNAWPLDEGLIDYVDASYGGATD 120

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN     N+IAN    ++  E+D S I+PD L + LH A+G + N+ +GYH +EF+LWGQ
Sbjct: 121 ENAAAALNVIANPTFTLSGTEVDASTITPDFLAETLHEADGNEANVASGYHAVEFMLWGQ 180

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           DL       G R +TD+  G+ CT  +C RR +YLK  + ++V+DLE M+  W   G A 
Sbjct: 181 DLNGTKHGAGARDWTDYATGDDCTNDNCDRRGQYLKAAADLIVTDLEYMVAQWAEGGAAR 240

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
            +L  + +  +++++TGM SLSY ELAGERM LGL+L+DPE+E DCFSDNT+ S+  D +
Sbjct: 241 TNLTDNEDGAISAMLTGMGSLSYGELAGERMRLGLMLNDPEEEQDCFSDNTHNSHYYDGL 300

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y G Y R +G  + G S+ DL++  N +L  E+    S TM+    +K  AE   
Sbjct: 301 GIQNVYLGAYARTDGTLVTGPSLSDLVAAENADLDAEMQLNLSTTMRKLGQIKTAAEAGM 360

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           S+DQM++  N  G  +V   +N LI QT+++ ++   L + +
Sbjct: 361 SYDQMMARGNKGGEALVMGGVNALIAQTKTIERVVATLGVDD 402


>gi|330981176|gb|EGH79279.1| iron-regulated protein A, putative [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 409

 Score =  518 bits (1335), Expect = e-145,   Method: Composition-based stats.
 Identities = 158/380 (41%), Positives = 220/380 (57%), Gaps = 5/380 (1%)

Query: 30  LQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRF 89
           + NYA +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RF
Sbjct: 23  VANYANMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRF 82

Query: 90  GNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSI 149
           GN I+D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  
Sbjct: 83  GNTIIDDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKE 141

Query: 150 ISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGH 208
           I+ + L  L+   G + N+ TGYH +EFLLWGQDL       G RP +D+  G   TGGH
Sbjct: 142 ITSEKLASLNELGGSEANVATGYHAVEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGH 201

Query: 209 CRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYN 265
             RR  YLK V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  
Sbjct: 202 NDRRRAYLKAVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLG 261

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+ 
Sbjct: 262 ELAGERMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLS 321

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
            L++  +      +     +T     I+ D A   E FDQ+I+  N  GN++VR+ I  L
Sbjct: 322 SLVAKADPATDATLRADLDDTQAKLQIIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAAL 381

Query: 386 ITQTESLRKIRIALDLIEPN 405
           + QT ++ +    L + + N
Sbjct: 382 VKQTGAIEQAAGKLGITDLN 401


>gi|159043116|ref|YP_001531910.1| iron-regulated protein [Dinoroseobacter shibae DFL 12]
 gi|157910876|gb|ABV92309.1| iron-regulated protein [Dinoroseobacter shibae DFL 12]
          Length = 420

 Score =  518 bits (1335), Expect = e-145,   Method: Composition-based stats.
 Identities = 177/401 (44%), Positives = 259/401 (64%), Gaps = 8/401 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           +  T +++V   P+ A          +VL +YA +A AKYED+L+ A+ L +A++ LV+T
Sbjct: 6   HLSTALALVLATPAFATEPA------EVLDHYADMAVAKYEDSLITAQRLQAAVDALVST 59

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ + L  AR  W+ AR+PYQQSEVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  
Sbjct: 60  PSAEALTAARAAWLAARVPYQQSEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGP 119

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
            +EN   + N+IA+    ++  E+D + I+P LL + LH A+G++ N+ TGYH IEFLLW
Sbjct: 120 TDENAFASLNVIASPTFTLSGAEVDATEITPALLEETLHEADGVEANVATGYHAIEFLLW 179

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GQDL  +   PG+RP+TD+  G+ CT G+C RR  +LK  + +LVSDLE M+  W  DG 
Sbjct: 180 GQDLNGHGAGPGDRPWTDYAPGDDCTNGNCDRRGAFLKAATDLLVSDLEWMVAQWADDGA 239

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
           A  +L  D  AG+ +I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  +
Sbjct: 240 ARAELTADAEAGIAAILTGMGSLSYGETAGERMRLGVMLNDPEEEHSCFADNTHNDHFYN 299

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
            IGI + Y GEY+R++G  + G ++ DL+   +  L  E+  K +  +     +K  AE 
Sbjct: 300 GIGIQNVYLGEYVRVDGTLVSGPALSDLVVAADPALDAEMQGKLAMAVMQLGRIKTAAEA 359

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
             ++DQM+ + N  G  ++   +N L+ QT S+ ++   L+
Sbjct: 360 GFAYDQMLEQGNAAGEALIMGGVNGLVDQTRSIERVIAVLN 400


>gi|152986581|ref|YP_001350275.1| hypothetical protein PSPA7_4939 [Pseudomonas aeruginosa PA7]
 gi|150961739|gb|ABR83764.1| hypothetical protein PSPA7_4939 [Pseudomonas aeruginosa PA7]
          Length = 475

 Score =  517 bits (1331), Expect = e-144,   Method: Composition-based stats.
 Identities = 158/394 (40%), Positives = 226/394 (57%), Gaps = 8/394 (2%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   +   V++NYA +A A + DAL  AR L  A++  +  P+ + L+ A+  W  AR P
Sbjct: 79  VDEAAARAVIKNYADLAEATFADALSTARELQKAVDAFLAKPDAETLKAAKEAWFAARTP 138

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYV   Y +    N   TANI+AN++I V
Sbjct: 139 YSQSEAFRFGNAIIDDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIVANTEIQV 197

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+  I+ + L  L+   G + N+ TGYH IEFLLWGQDL       G+RP TD+ 
Sbjct: 198 GEDKIDVKEITGEKLAGLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGDRPATDYA 257

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSII 256
            G +CTGGHC RR  YLK V+ +LVSDLE M   W     D    K   + ++ GL  + 
Sbjct: 258 QGKDCTGGHCDRRAAYLKAVTDLLVSDLEYMAGQWKAGVADNYRAKLEAEPVDTGLRKMF 317

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSD+T+ +   +   I + Y GEY R++G
Sbjct: 318 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDDTHHTLFFNAKSIRNIYLGEYKRVDG 377

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN-IESFDQMISENNPEGN 375
             + G S+ DL++  +      +    ++T     ++ D AE     FDQMI+ +N EG 
Sbjct: 378 SVVKGPSLADLVAKADAAANDTLKADLADTEAKLQVIVDSAEKDGVHFDQMIAPDNKEGQ 437

Query: 376 KIVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
           + +R+ I  L+ QT ++ +    L +  ++P+  
Sbjct: 438 QKIRDAIAALVKQTGAIEQAAGKLGIQDLKPDNA 471


>gi|84684574|ref|ZP_01012475.1| lipoprotein, putative [Maritimibacter alkaliphilus HTCC2654]
 gi|84667553|gb|EAQ14022.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2654]
          Length = 444

 Score =  517 bits (1331), Expect = e-144,   Method: Composition-based stats.
 Identities = 185/397 (46%), Positives = 260/397 (65%), Gaps = 2/397 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
            ++               +  +VL  YA IAHA YED+L  A+ L+ A+E L+ +P++  
Sbjct: 29  ATLTAAGLILGTVPAFAATKGEVLTTYADIAHAGYEDSLTTAQALNDAVEALIASPSEDT 88

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  W+ AR PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD SYG   +EN 
Sbjct: 89  LAAARAAWVAAREPYQQTEVYRFGNPIVDDWEGKVNAWPLDEGLIDYVDESYGGATDENP 148

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLK 185
               N+IAN ++ +  +E+D S I+P+L+   L+ A+GI++N+  GYH IEFLLWGQDL 
Sbjct: 149 FAAVNVIANPQLTIAGQEVDASSITPELIADTLNEADGIESNVARGYHAIEFLLWGQDLN 208

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
                 G+RPY+DF  G+ CT G+C RRV+YL+    +L+SDLEEM+ AWG  G+A + +
Sbjct: 209 GTDAGAGDRPYSDFAQGDDCTNGNCDRRVDYLEASMDLLISDLEEMVAAWGQGGEAREAV 268

Query: 245 MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
           M + +AG+ +I+TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+ ND +G+ 
Sbjct: 269 MANEDAGIIAILTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHRSHYNDGLGVQ 328

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y G Y R++G  + G S+ DL++  N +L  E+ +K   TM     + D AEN  + D
Sbjct: 329 NVYLGSYTRVDGTVVEGPSLSDLVAEANADLDAEMKEKLDTTMTAMTAISDAAENGMAVD 388

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           QM++  N EG K++ + I+ LI QT ++ +I   L L
Sbjct: 389 QMLAPGNEEGEKLMMDAIDGLIDQTATIERIVADLGL 425


>gi|328542028|ref|YP_004302137.1| Insulin-cleaving metalloproteinase outer membrane protein
           [polymorphum gilvum SL003B-26A1]
 gi|326411778|gb|ADZ68841.1| Insulin-cleaving metalloproteinase outer membrane protein
           [Polymorphum gilvum SL003B-26A1]
          Length = 439

 Score =  516 bits (1330), Expect = e-144,   Method: Composition-based stats.
 Identities = 197/403 (48%), Positives = 264/403 (65%), Gaps = 2/403 (0%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +  +   +IV        ++        VL  Y  +A A YED+L  AR L +A+E LV 
Sbjct: 18  LMLLAATAIVAGAVVTGSALADAPKPADVLATYGDVAQAGYEDSLATARALKAAVEALVA 77

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
           +P+   L  AR  W+ AR+PYQQ+E +RFGN IVD W+ KVNAWPLDEG IDYVD++YG 
Sbjct: 78  SPSDDTLAAARQAWLAARVPYQQTEAFRFGNAIVDDWEGKVNAWPLDEGLIDYVDTAYGD 137

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLL 179
            +EEN  Y AN+IAN K+ V  +EID S I+P LL + L  A  I+ N+ TGYH IEFLL
Sbjct: 138 SSEENPFYAANVIANPKLTVAGEEIDASEITPALLSETLQEAGEIEANVATGYHAIEFLL 197

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           WGQDL       G RP +D+D  NCTGG+C RR+ YL+ V+ +L++DLEEM  AW P G 
Sbjct: 198 WGQDLNGTDAGAGARPASDYDTANCTGGNCDRRIAYLRAVTDLLIADLEEMAVAWAPGGA 257

Query: 240 ATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
           A  +L  K    GL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  
Sbjct: 258 ARAELAAKGEGGGLATILTGMGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHLSHYY 317

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           DV+GI + Y GEY R++G K+ GAS+ D+++  +  LA+E+  +   T+  F  LK RAE
Sbjct: 318 DVVGIRNVYFGEYARVDGSKVEGASLADMVAARDPALAEEMKARLDATLAAFEALKTRAE 377

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            +E++DQMI E N EGN +V+  ++ L+ QT S+ ++   L L
Sbjct: 378 TVEAYDQMIGEGNAEGNAVVQAAVDALVDQTRSIERVVAVLGL 420


>gi|146279058|ref|YP_001169217.1| hypothetical protein Rsph17025_3028 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557299|gb|ABP71912.1| Uncharacterized iron-regulated protein-like protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 422

 Score =  516 bits (1330), Expect = e-144,   Method: Composition-based stats.
 Identities = 178/403 (44%), Positives = 251/403 (62%), Gaps = 3/403 (0%)

Query: 6   IISIVFTLPSHALS-IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           ++++  T P   L      V   +V++ YA IA A Y D+L  AR L  A++ LV  P++
Sbjct: 5   LLALAATAPCALLPLPALAVERAEVVETYADIAEATYGDSLATARDLQMAVKALVAQPSE 64

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           + L  AR  WI AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD ++G   EE
Sbjct: 65  QTLAAARTAWIAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDPTHGGATEE 124

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQD 183
           N+L T N+IA     ++  E+D + I+P L+   LH A+GI+ N+ +GYH IEFLLWGQD
Sbjct: 125 NDLATLNVIATPTFTLSGTEVDATEITPALISGTLHEADGIEANVASGYHAIEFLLWGQD 184

Query: 184 LKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           L       GNRPYTD+  G  CTGG+C RR  YL   + +LVSDLE M+  W   G A  
Sbjct: 185 LNGTEAGAGNRPYTDYASGGACTGGNCDRRGAYLLAATDLLVSDLEYMVAQWSEGGAARN 244

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
            +  D  AGL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G
Sbjct: 245 AVSADPAAGLQAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYYDGLG 304

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           I + Y G Y R++G ++ G S+ DL++  +  L + +  +   T++    L+  A    +
Sbjct: 305 IRNVYLGRYERVDGSRVEGPSLSDLVAEADTGLDEVLRGQLDTTLERLDALRTAAAEGMA 364

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           +DQM++  N  G +++   ++ L+TQT S+ +   AL L +  
Sbjct: 365 YDQMLAPGNKRGEELIMGAVDALVTQTASIERATTALGLAKIE 407


>gi|330943761|gb|EGH46039.1| iron-regulated protein A, putative [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 452

 Score =  516 bits (1328), Expect = e-144,   Method: Composition-based stats.
 Identities = 155/375 (41%), Positives = 216/375 (57%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 ADPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 430 AIEQAAGKLGITDLN 444


>gi|66047288|ref|YP_237129.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae B728a]
 gi|63257995|gb|AAY39091.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae B728a]
          Length = 458

 Score =  516 bits (1328), Expect = e-144,   Method: Composition-based stats.
 Identities = 155/375 (41%), Positives = 216/375 (57%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+
Sbjct: 77  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTII 136

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 137 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 195

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 196 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGHNDRRR 255

Query: 214 EYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGE
Sbjct: 256 AYLKAVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 315

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 316 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 375

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 376 ADPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 435

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 436 AIEQAAGKLGITDLN 450


>gi|330973344|gb|EGH73410.1| iron-regulated protein A, putative [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 453

 Score =  515 bits (1327), Expect = e-144,   Method: Composition-based stats.
 Identities = 155/375 (41%), Positives = 216/375 (57%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+
Sbjct: 72  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTII 131

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 132 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 190

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 191 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 250

Query: 214 EYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGE
Sbjct: 251 AYLKAVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 310

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 311 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 370

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 371 ADPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 430

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 431 AIEQAAGKLGITDLN 445


>gi|302189751|ref|ZP_07266424.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae 642]
          Length = 452

 Score =  515 bits (1327), Expect = e-144,   Method: Composition-based stats.
 Identities = 155/375 (41%), Positives = 216/375 (57%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 ADPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 430 AIEQAAGKLGITDLN 444


>gi|255264811|ref|ZP_05344153.1| hypothetical protein TR2A62_0089 [Thalassiobium sp. R2A62]
 gi|255107146|gb|EET49820.1| hypothetical protein TR2A62_0089 [Thalassiobium sp. R2A62]
          Length = 419

 Score =  514 bits (1325), Expect = e-144,   Method: Composition-based stats.
 Identities = 178/401 (44%), Positives = 257/401 (64%), Gaps = 6/401 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           ++   +I   L + AL+    V    VL  YA IA A Y D+L+ A+ L +A+  LV  P
Sbjct: 4   YLLTTAIAVGLATPALA----VETTDVLDTYADIAAANYGDSLITAQRLQAAVNALVADP 59

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + +NL  AR  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  +
Sbjct: 60  SAENLTAARAAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPS 119

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           +EN     N+IAN    ++ ++ID + I+P LL   L  A+G++ N+ TGYH IEFLLWG
Sbjct: 120 DENAFAALNVIANPTFTLSGQDIDATSITPALLEDTLQEADGVEANVATGYHAIEFLLWG 179

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDL  +    G+RP+TD+ +G+ CT G+C RR EYL   + +L+SDLE M  AW   G+A
Sbjct: 180 QDLNGHGTGAGDRPWTDYAMGDECTNGNCDRRGEYLTAATDLLISDLEYMAGAWAIGGEA 239

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
             +LM D +AG+++I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  + 
Sbjct: 240 RSELMSDADAGISAILTGMGSLSYGETAGERMRLGVMLNDPEEEHSCFADNTHNDHYYNG 299

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +GI + Y GEYIR++G  + G S+ DL++  +  L  E+  K  + +     +K  AE  
Sbjct: 300 VGIQNVYLGEYIRVDGSLVTGPSLSDLMAETDAALDAEMQGKLGDAVMALGRIKIAAEAG 359

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            ++DQM+   N EG  ++   +N LI QT  + ++  AL +
Sbjct: 360 FAYDQMLERGNVEGEALIMGGVNGLIDQTRFIERVIAALGV 400


>gi|330950176|gb|EGH50436.1| iron-regulated protein A, putative [Pseudomonas syringae Cit 7]
          Length = 408

 Score =  513 bits (1322), Expect = e-143,   Method: Composition-based stats.
 Identities = 155/375 (41%), Positives = 216/375 (57%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+
Sbjct: 27  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTII 86

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 87  DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 145

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 146 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 205

Query: 214 EYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGE
Sbjct: 206 AYLKAVTDLLVSDLEEMSGNWKAGVPDNYRATLEAEPGESGLRKMLFGMGSLSLGELAGE 265

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 266 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 325

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 326 VDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 385

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 386 AIEQAAGKLGITDLN 400


>gi|104780332|ref|YP_606830.1| hypothetical protein PSEEN1119 [Pseudomonas entomophila L48]
 gi|95109319|emb|CAK14019.1| conserved hypothetical protein; putative signal peptide
           [Pseudomonas entomophila L48]
          Length = 442

 Score =  513 bits (1321), Expect = e-143,   Method: Composition-based stats.
 Identities = 164/389 (42%), Positives = 231/389 (59%), Gaps = 5/389 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+++YA + HA Y D+L  A+ L +A++  + TPN + L+ A+  W  AR+P
Sbjct: 47  VDETAGKAVVKHYAEMVHAVYSDSLSTAKQLQTAVDAFLATPNDQTLKAAKEAWAAARVP 106

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN++I V
Sbjct: 107 YLQSEAFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPAASANIIANTQIQV 165

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+ 
Sbjct: 166 GEDKVDVKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYL 225

Query: 201 IGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDI-NAGLNSII 256
            G   TGGH  RR  YLK V+++LV DLEEM+  W P+        L     N GL  ++
Sbjct: 226 EGKGATGGHNDRRRAYLKAVTELLVKDLEEMVGNWAPNVADNYRATLENGPVNDGLRKML 285

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R++G
Sbjct: 286 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRVDG 345

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN+
Sbjct: 346 SKLTGPSLSSLVAKVDPATDATLKADLEATEAKIQVMVDHALKGEHYDQLIAADNAAGNQ 405

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPN 405
           IVR+ I  L+ QT ++ +    L +   N
Sbjct: 406 IVRDAIASLVKQTGAIEQAAGKLGIDNLN 434


>gi|99082039|ref|YP_614193.1| imelysin [Ruegeria sp. TM1040]
 gi|99038319|gb|ABF64931.1| imelysin. Metallo peptidase. MEROPS family M75 [Ruegeria sp.
           TM1040]
          Length = 422

 Score =  513 bits (1320), Expect = e-143,   Method: Composition-based stats.
 Identities = 182/385 (47%), Positives = 253/385 (65%), Gaps = 2/385 (0%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           S     S  +VL NYA IA AKYED+L+ A+TL +A+  L+  P+ + L  A+  W+ AR
Sbjct: 19  SAAFATSKGEVLINYANIAEAKYEDSLITAKTLQAAVGALIDAPSAETLAAAKKAWLAAR 78

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
           +PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG   +EN     N++AN   
Sbjct: 79  VPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPTDENAAAVLNVVANPDF 138

Query: 139 IVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYT 197
            ++ + ID S I+P+LL + LH A+G++ N+ TGYH IEFLLWGQDL       G R +T
Sbjct: 139 SLSGQAIDASEITPELLAETLHEADGVEANVATGYHAIEFLLWGQDLNGTEHGAGARAWT 198

Query: 198 DFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSII 256
           D+  G +CT G+C RR  YLK  + +LVSDLE +   W   G A  +++ D NAG+ +I+
Sbjct: 199 DYATGEDCTNGNCDRRGAYLKAATDLLVSDLEWITAQWAEGGAARAEVLSDENAGITAIL 258

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
           TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI + Y GEY+R+NG
Sbjct: 259 TGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIQNVYLGEYVRVNG 318

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
             + GA++ DL+   +  L  E+  K + TM     +K  AE   S+DQM+++ +  G  
Sbjct: 319 ALVSGAALADLVEAADPALNSELTAKLATTMMKLGRIKTAAEAGFSYDQMLAQGSTAGEA 378

Query: 377 IVRNLINDLITQTESLRKIRIALDL 401
           +V   ++ L+ QT S+ ++  AL+L
Sbjct: 379 LVMGGVDALVDQTRSIERVVAALEL 403


>gi|114706077|ref|ZP_01438980.1| hypothetical protein FP2506_16464 [Fulvimarina pelagi HTCC2506]
 gi|114538923|gb|EAU42044.1| hypothetical protein FP2506_16464 [Fulvimarina pelagi HTCC2506]
          Length = 425

 Score =  513 bits (1320), Expect = e-143,   Method: Composition-based stats.
 Identities = 191/402 (47%), Positives = 270/402 (67%), Gaps = 6/402 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           ++   + F+ P+ A     +VS E +L+NYA IA A Y DAL  A+TLD+A + L+  P+
Sbjct: 11  LSTSILAFSTPALA----QDVSKEAILKNYADIALAAYTDALETAKTLDAATDELIAKPS 66

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           ++ L  AR  W  +R  YQQ+EVYRFGN IVD W+ +VNAWPLDEG IDYVDSSYG  ++
Sbjct: 67  EETLTAARKAWKESRPSYQQTEVYRFGNPIVDAWEGRVNAWPLDEGLIDYVDSSYGTGSD 126

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQ 182
            N LYTAN+IA  ++ +  + +D+S I+P L++ +L  A G++ N+ TGYH +EFLLWGQ
Sbjct: 127 SNQLYTANVIAADEVTIGGETVDVSTITPALIQDQLQEAGGVEANVATGYHAVEFLLWGQ 186

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           DL       G RP TDF  G+ CT G C +R EYL   + +LVSDLEEM+  W   G+A 
Sbjct: 187 DLNGTEAGAGERPATDFASGDECTNGSCDKRGEYLDAATDLLVSDLEEMVANWEDGGEAR 246

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
             LM+D N GLN ++TGM SLSY E+AGERM LGL+LHDPE+E DCFSDNT+ S+L DV+
Sbjct: 247 AALMEDENQGLNMMLTGMGSLSYGEMAGERMKLGLLLHDPEEEHDCFSDNTHVSHLYDVV 306

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y G Y +++G  + G ++ DL++  N  L +E+    + T++    + D AE+ E
Sbjct: 307 GIENVYLGRYEKVDGSTVEGPALADLVAAENAELEEEMKADLTATLEAMRAISDAAESGE 366

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           ++DQ I+E N EGN+ V+  ++ LI QT ++ ++  ALD+ E
Sbjct: 367 AYDQQIAEGNSEGNERVQAAVDALIAQTRTIERVIAALDIGE 408


>gi|71734726|ref|YP_276192.1| lipoprotein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71555279|gb|AAZ34490.1| lipoprotein, putative [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 452

 Score =  513 bits (1320), Expect = e-143,   Method: Composition-based stats.
 Identities = 153/375 (40%), Positives = 215/375 (57%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 430 AIEQAASKLGITDLN 444


>gi|126666893|ref|ZP_01737869.1| putative iron-regulated protein A [Marinobacter sp. ELB17]
 gi|126628609|gb|EAZ99230.1| putative iron-regulated protein A [Marinobacter sp. ELB17]
          Length = 438

 Score =  513 bits (1320), Expect = e-143,   Method: Composition-based stats.
 Identities = 160/393 (40%), Positives = 233/393 (59%), Gaps = 9/393 (2%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V+   V+ +YA +AHA +ED+L+ AR L++A + L+ +P+  NL+ A+  W  AR+PYQQ
Sbjct: 42  VNQNTVVAHYADVAHATFEDSLITARALNAATDRLIASPSDANLKAAKEAWYAARVPYQQ 101

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           SE +RFGN ++D W+ +VNAWPLDEG IDYV S   +    N   TANIIA++ I V  +
Sbjct: 102 SEAFRFGNTLIDDWEGQVNAWPLDEGLIDYVTSDDYQYELGNAGATANIIASTSINVGGE 161

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG- 202
           ++D+S ++ +LL  L+   G + N+ +GYH IEFLLWGQDL       G RP +D+  G 
Sbjct: 162 QLDVSTLTAELLANLNEIGGSEANVASGYHAIEFLLWGQDLNGFDAGNGERPVSDYQQGE 221

Query: 203 NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGM 259
           +CT G+C RR +YL  V+ +LV DLE M   W     D    +    D   G+  ++ GM
Sbjct: 222 DCTNGNCDRRGQYLDAVTDLLVDDLEWMTVQWARGSSDNYRAQLTSADAGEGVQKMLFGM 281

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG Y R++   +
Sbjct: 282 GSLSLGELAGERMKVALEANSYEDEHDCFSDNTHNSHYYNGQGIQNVYTGTYRRVDNSVV 341

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI---ESFDQMISENNPEGNK 376
            G S+ DL+   N  L  E+N +   TM+    +K +AE+     +FD MI+  N +G K
Sbjct: 342 TGPSLADLVEQTNPQLNAELNKQLDKTMQALAFMKAKAESSQTPMAFDMMIAPGNGDGAK 401

Query: 377 IVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
           IV + I  L+ QT S+ +    L +  + P+  
Sbjct: 402 IVNDAIMALVVQTGSIEQAARELGIQALSPDDA 434


>gi|320322412|gb|EFW78505.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320330120|gb|EFW86107.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330989423|gb|EGH87526.1| putative lipoprotein [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 452

 Score =  512 bits (1319), Expect = e-143,   Method: Composition-based stats.
 Identities = 153/375 (40%), Positives = 215/375 (57%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 430 AIEQAAGKLGITDLN 444


>gi|331009887|gb|EGH89943.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 452

 Score =  512 bits (1319), Expect = e-143,   Method: Composition-based stats.
 Identities = 152/375 (40%), Positives = 214/375 (57%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L + ++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAETGAKKLSTVVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDAPLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 430 AIEQAAGKLGITDLN 444


>gi|116052404|ref|YP_792715.1| metalloproteinase outer membrane [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115587625|gb|ABJ13640.1| Insulin-cleaving metalloproteinase outer membrane [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 446

 Score =  511 bits (1317), Expect = e-143,   Method: Composition-based stats.
 Identities = 158/396 (39%), Positives = 227/396 (57%), Gaps = 8/396 (2%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           + V   + + V++NYA +A A + DAL  A+ L  AI+  +  P+ + L+ A+  W  AR
Sbjct: 48  TKVDEAAAKAVIKNYADLAEATFADALSTAKDLQKAIDAFLAKPDAETLKAAKEAWFAAR 107

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
            PY QSE +RFGN I+D W+ +VNAWPLDEG IDYV   Y +    N   TANI+AN++I
Sbjct: 108 TPYSQSEAFRFGNAIIDDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIVANTEI 166

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
            V E +ID+  I+ + L  L+   G + N+ TGYH IEFLLWGQDL       GNRP TD
Sbjct: 167 QVGEDKIDVKEITGEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATD 226

Query: 199 FDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNS 254
           +  G +CTGGHC RR  YLK V+ +LVSDLE M   W     D    K   + ++ GL  
Sbjct: 227 YAQGKDCTGGHCDRRAAYLKAVTDLLVSDLEYMAGQWKAGVADNYRAKLEAEPVDTGLRK 286

Query: 255 IITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRM 314
           +  GM SLS  ELAGERM + L  +  E E DCFSD+T+ +   +   I + Y GEY R+
Sbjct: 287 MFFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDDTHHTLFFNGKSIRNIYLGEYKRI 346

Query: 315 NGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN-IESFDQMISENNPE 373
           +G  + G S+ DL++  +      +    ++T      + D AE     FDQMI+ +N +
Sbjct: 347 DGSVVKGPSLADLVAKADAAANDTLKADLADTEAKLQAIVDSAEKDGVHFDQMIAPDNKD 406

Query: 374 GNKIVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
           G + +R+ I  L+ QT ++ +    L +  ++P+  
Sbjct: 407 GQQKIRDAIAALVKQTGAIEQAAGKLGIQDLKPDNA 442


>gi|289625673|ref|ZP_06458627.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647253|ref|ZP_06478596.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298488573|ref|ZP_07006603.1| Iron-regulated protein A precursor [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156914|gb|EFH98004.1| Iron-regulated protein A precursor [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330870178|gb|EGH04887.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 452

 Score =  511 bits (1316), Expect = e-143,   Method: Composition-based stats.
 Identities = 153/375 (40%), Positives = 215/375 (57%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 430 AIEQAAGKLGITDLN 444


>gi|15599566|ref|NP_253060.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa PAO1]
 gi|218893461|ref|YP_002442330.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa LESB58]
 gi|254238967|ref|ZP_04932290.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa C3719]
 gi|254244820|ref|ZP_04938142.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa 2192]
 gi|296391077|ref|ZP_06880552.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa PAb1]
 gi|9950599|gb|AAG07758.1|AE004853_1 Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa PAO1]
 gi|126170898|gb|EAZ56409.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa C3719]
 gi|126198198|gb|EAZ62261.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa 2192]
 gi|218773689|emb|CAW29503.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa LESB58]
          Length = 446

 Score =  511 bits (1316), Expect = e-143,   Method: Composition-based stats.
 Identities = 158/394 (40%), Positives = 226/394 (57%), Gaps = 8/394 (2%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V++NYA +A A + DAL  A+ L  AI+  +  P+ + L+ A+  W  AR P
Sbjct: 50  VDEAAAKAVIKNYADLAEATFADALSTAKDLQKAIDAFLAKPDAETLKAAKEAWFAARTP 109

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYV   Y +    N   TANI+AN++I V
Sbjct: 110 YSQSEAFRFGNAIIDDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIVANTEIQV 168

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+  I+ + L  L+   G + N+ TGYH IEFLLWGQDL       GNRP TD+ 
Sbjct: 169 GEDKIDVKEITGEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYA 228

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSII 256
            G +CTGGHC RR  YLK V+ +LVSDLE M   W     D    K   + ++ GL  + 
Sbjct: 229 QGKDCTGGHCDRRAAYLKAVTDLLVSDLEYMAGQWKAGVADNYRAKLEAEPVDTGLRKMF 288

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSD+T+ +   +   I + Y GEY R++G
Sbjct: 289 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDDTHHTLFFNGKSIRNIYLGEYKRIDG 348

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN-IESFDQMISENNPEGN 375
             + G S+ DL++  +      +    ++T      + D AE     FDQMI+ +N +G 
Sbjct: 349 SVVKGPSLADLVAKADAAANDTLKADLADTEAKLQAIVDSAEKDGVHFDQMIAPDNKDGQ 408

Query: 376 KIVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
           + +R+ I  L+ QT ++ +    L +  ++P+  
Sbjct: 409 QKIRDAIAALVKQTGAIEQAAGKLGIQDLKPDNA 442


>gi|158424368|ref|YP_001525660.1| uncharacterized iron-regulated protein [Azorhizobium caulinodans
           ORS 571]
 gi|158331257|dbj|BAF88742.1| uncharacterized iron-regulated protein [Azorhizobium caulinodans
           ORS 571]
          Length = 436

 Score =  511 bits (1316), Expect = e-143,   Method: Composition-based stats.
 Identities = 174/378 (46%), Positives = 246/378 (65%), Gaps = 3/378 (0%)

Query: 27  EKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEV 86
             V+ +YA +A A Y D+   A  +  AI+  +  P+ +  + A+  W +ARI Y ++E 
Sbjct: 40  RSVITSYADLAQAMYTDSYTAAAEMQKAIDAFIAAPSAETQKAAQEAWRKARISYMKTEG 99

Query: 87  YRFGNKIVDTWDKKVNAWPLDEGFIDYVDS-SYGKENEENNLYTANIIANSKIIVNEKEI 145
           +RFGNKIVD W+  VNAWPLDEG IDYVD+ SYG +++EN LYTANIIAN  I + +K I
Sbjct: 100 FRFGNKIVDEWEGNVNAWPLDEGLIDYVDTKSYGTKSDENPLYTANIIANKSIRIGKKTI 159

Query: 146 DLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCT 205
           D + ++P+LL KL+ A G++ N+ +G+H IEFLLWGQDL       G RPYTD+D   CT
Sbjct: 160 DTTNLTPELLHKLNSAGGVEANVASGWHAIEFLLWGQDLHGTGPGAGERPYTDYDKNACT 219

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM-KDINAGLNSIITGMTSLSY 264
            G+C RR +YLKV +  LV+DL+EM + WGP G+A   L+ K+  AGL +I TG+ SLSY
Sbjct: 220 HGNCERRAQYLKVATDTLVADLKEMAEDWGPKGKARAALLKKNDKAGLATIFTGIGSLSY 279

Query: 265 NELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASI 324
            ELAGERM LGLILHDPE+E DCFSDNT+ S+  D +GI   Y G   R +G    G S+
Sbjct: 280 GELAGERMKLGLILHDPEEEHDCFSDNTHNSHYYDEVGIADIYYGRTKRYDGSTFTGPSV 339

Query: 325 HDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI-ESFDQMISENNPEGNKIVRNLIN 383
            DL+   +  +A EI+ K         ++KD A++    +D M++E N EGNK++++ ++
Sbjct: 340 ADLVRAKDAKIADEIDAKIKGADAALKVIKDTADSGRMYYDMMLAEGNAEGNKMIQDGVD 399

Query: 384 DLITQTESLRKIRIALDL 401
            L+ Q  ++ +   AL +
Sbjct: 400 ALVAQAHAIERGVAALKI 417


>gi|254440885|ref|ZP_05054378.1| hypothetical protein OA307_300 [Octadecabacter antarcticus 307]
 gi|198250963|gb|EDY75278.1| hypothetical protein OA307_300 [Octadecabacter antarcticus 307]
          Length = 419

 Score =  511 bits (1315), Expect = e-142,   Method: Composition-based stats.
 Identities = 170/397 (42%), Positives = 250/397 (62%), Gaps = 2/397 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           I +   L   A         + VL  Y+ IA A Y+D+L  A+TL +A+  L+  P + N
Sbjct: 4   ILLSTALTFVAPIAFAAGHAQDVLTTYSNIAEANYQDSLTTAQTLQTAVNALIVDPTEIN 63

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L+ A+  W  AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN 
Sbjct: 64  LQAAKAAWFAARVPYQQTEVYRFGNSIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDENK 123

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLK 185
               N+IAN    ++   ID S I+PD L  +LH A+G+++N+ TGYH +EFLLWGQDL 
Sbjct: 124 FAALNVIANPTFTLSGANIDASAITPDFLEGQLHEADGVESNVATGYHAVEFLLWGQDLN 183

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
            +    G RP TD+ +G+ CT G+C RR +YL+  + +LV+DLE M + W   G A   +
Sbjct: 184 GHGTGAGMRPATDYAMGDDCTNGNCDRRGDYLQAATDLLVADLEWMAEQWTEGGDARASV 243

Query: 245 MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
           M D +AG+ +I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  + +G+ 
Sbjct: 244 MADEDAGIATILTGMGSLSYGETAGERMRLGVMLNDPEEEHSCFADNTHNDHYYNGVGVQ 303

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y G Y R++G  + GAS+ DL++ ++ +L  E+  K S T+++   +K  AE   ++D
Sbjct: 304 NVYLGSYTRIDGTVVSGASLADLVAGSDGDLDTEMRTKLSATIRELGDIKHAAEAGFAYD 363

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            M+   N  G  ++   +N  I QT S+ ++   L +
Sbjct: 364 MMLEAGNAAGEDLIMGGVNAFIDQTRSIERVVAVLGV 400


>gi|330877884|gb|EGH12033.1| iron-regulated protein A [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 452

 Score =  511 bits (1315), Expect = e-142,   Method: Composition-based stats.
 Identities = 153/375 (40%), Positives = 214/375 (57%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAEGAAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMAGNWKAGVADNYRATLKAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T      + D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDATLRADLDDTQAKLQAIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 430 AIEQAAGKLGITDLN 444


>gi|330874919|gb|EGH09068.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 402

 Score =  510 bits (1314), Expect = e-142,   Method: Composition-based stats.
 Identities = 153/375 (40%), Positives = 215/375 (57%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 21  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 80

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 81  DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 139

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 140 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 199

Query: 214 EYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELAGE
Sbjct: 200 AYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 259

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 260 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 319

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 320 VDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 379

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 380 AIEQAAGKLGITDLN 394


>gi|330966144|gb|EGH66404.1| iron-regulated protein A [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 450

 Score =  510 bits (1313), Expect = e-142,   Method: Composition-based stats.
 Identities = 153/375 (40%), Positives = 214/375 (57%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 69  NMVSAVFDDAEGAAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 128

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 129 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 187

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 188 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 247

Query: 214 EYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELAGE
Sbjct: 248 AYLKAVTDLLVSDLEEMAGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 307

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 308 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 367

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T      + D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 368 VDPATDATLRADLDDTQAKLQAIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 427

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 428 AIEQAAGKLGITDLN 442


>gi|107100046|ref|ZP_01363964.1| hypothetical protein PaerPA_01001067 [Pseudomonas aeruginosa PACS2]
          Length = 443

 Score =  510 bits (1313), Expect = e-142,   Method: Composition-based stats.
 Identities = 158/394 (40%), Positives = 226/394 (57%), Gaps = 8/394 (2%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V++NYA +A A + DAL  A+ L  AI+  +  P+ + L+ A+  W  AR P
Sbjct: 47  VDEAAAKAVIKNYADLAEATFADALSTAKDLQKAIDAFLAKPDAETLKAAKEAWFAARTP 106

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYV   Y +    N   TANI+AN++I V
Sbjct: 107 YSQSEAFRFGNAIIDDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIVANTEIQV 165

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+  I+ + L  L+   G + N+ TGYH IEFLLWGQDL       GNRP TD+ 
Sbjct: 166 GEDKIDVKEITGEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYA 225

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSII 256
            G +CTGGHC RR  YLK V+ +LVSDLE M   W     D    K   + ++ GL  + 
Sbjct: 226 QGKDCTGGHCDRRAAYLKAVTDLLVSDLEYMAGQWKAGVADNYRAKLEAEPVDTGLRKMF 285

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSD+T+ +   +   I + Y GEY R++G
Sbjct: 286 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDDTHHTLFFNGKSIRNIYLGEYKRIDG 345

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN-IESFDQMISENNPEGN 375
             + G S+ DL++  +      +    ++T      + D AE     FDQMI+ +N +G 
Sbjct: 346 SVVKGPSLADLVAKADAAANDTLKADLADTEAKLQAIVDSAEKDGVHFDQMIAPDNKDGQ 405

Query: 376 KIVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
           + +R+ I  L+ QT ++ +    L +  ++P+  
Sbjct: 406 QKIRDAIAALVKQTGAIEQAAGKLGIQDLKPDNA 439


>gi|326794858|ref|YP_004312678.1| peptidase M75, Imelysin [Marinomonas mediterranea MMB-1]
 gi|326545622|gb|ADZ90842.1| Peptidase M75, Imelysin [Marinomonas mediterranea MMB-1]
          Length = 453

 Score =  510 bits (1313), Expect = e-142,   Method: Composition-based stats.
 Identities = 175/387 (45%), Positives = 249/387 (64%), Gaps = 3/387 (0%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
           +VS E V+  YA IA A Y D+LM A+TL S +   +  P + NL+  +  WI +R PYQ
Sbjct: 53  SVSAEAVVTQYADIAEAIYGDSLMTAKTLQSGVNAFLLDPTEANLQKVKDAWIASRAPYQ 112

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS-SYGKENEENNLYTANIIANSKIIVN 141
           QSEVYRFGN IVD W+ KVNAWPLDEG IDYVDS SYG E++ N+LYTAN+IAN+ +++ 
Sbjct: 113 QSEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDSESYGSESDVNDLYTANVIANTSLMIG 172

Query: 142 EKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            +++D + I+P L+   L  A+G++ N+ +GYH IEFLLWGQDL       G R  TDFD
Sbjct: 173 GEKVDTTYITPALISDVLQEADGVEANVASGYHAIEFLLWGQDLHGTNPGAGERKATDFD 232

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL-MKDINAGLNSIITGM 259
           + NCT G+C RR +YLK  + +LVSDLEEM   W   G A  +L  K  + GL +++TGM
Sbjct: 233 LANCTNGNCDRRRDYLKAATDLLVSDLEEMAANWKVGGAARAELAEKGTDGGLATMLTGM 292

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            SL+Y EL GER  LGL+LHDPE+E DCFSDNT+ S+  D  GI + Y G+Y R++G  +
Sbjct: 293 GSLAYGELGGERTKLGLMLHDPEEEHDCFSDNTHWSHYYDAKGIENVYLGKYQRVDGSWV 352

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVR 379
            G S+ +L+++ +  L  ++  + + T      + + A   ++FD +I+ NN  GN +V+
Sbjct: 353 EGPSLSNLVANKDAALDVKMKAQLTKTDAAGKAMTEAAAQGQTFDVLIAMNNEAGNAMVQ 412

Query: 380 NLINDLITQTESLRKIRIALDLIEPNR 406
           N ++ L+ +T     +   L L +   
Sbjct: 413 NFVDQLVAETRVTEDVIQTLGLQDIAL 439


>gi|28871502|ref|NP_794121.1| iron-regulated protein A [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213970316|ref|ZP_03398446.1| iron-regulated protein A [Pseudomonas syringae pv. tomato T1]
 gi|301385468|ref|ZP_07233886.1| iron-regulated protein A, putative [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063002|ref|ZP_07254543.1| iron-regulated protein A, putative [Pseudomonas syringae pv. tomato
           K40]
 gi|302135286|ref|ZP_07261276.1| iron-regulated protein A, putative [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28854753|gb|AAO57816.1| iron-regulated protein A, putative [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213924988|gb|EEB58553.1| iron-regulated protein A [Pseudomonas syringae pv. tomato T1]
          Length = 452

 Score =  509 bits (1312), Expect = e-142,   Method: Composition-based stats.
 Identities = 153/375 (40%), Positives = 213/375 (56%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAQGAAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 TYLKAVTDLLVSDLEEMAGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T      + D A   E FDQ+I   N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDATLRADLDDTQAKLQAIVDHANKGEHFDQLIGAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 430 AIEQAAGKLGITDLN 444


>gi|226945830|ref|YP_002800903.1| hypothetical protein Avin_37840 [Azotobacter vinelandii DJ]
 gi|171854884|dbj|BAG16626.1| iron-regulated protein-like protein homolog [Azotobacter
           vinelandii]
 gi|226720757|gb|ACO79928.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 441

 Score =  509 bits (1312), Expect = e-142,   Method: Composition-based stats.
 Identities = 158/388 (40%), Positives = 226/388 (58%), Gaps = 5/388 (1%)

Query: 22  PNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPY 81
              +   V+ +YA +A A + D+L  A+ L  AI+ L+  P    L+ AR  WI AR+PY
Sbjct: 47  DEAAARAVVNHYADLALAVFGDSLSTAKALQQAIDALLAKPAADTLQAAREAWIAARVPY 106

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
            QSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y +    N   TANIIAN++I V 
Sbjct: 107 MQSEVFRFGNPVVDEWEGQLNAWPLDEGLIDYVAADY-QHALGNPGATANIIANTEIQVG 165

Query: 142 EKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
           E++ID++ I+ + L  L+   G + N+ TGYH IEFLLWGQDL       G RP +DF  
Sbjct: 166 EEKIDVTEITGEALASLNELAGSEANVATGYHAIEFLLWGQDLNGTAPGAGQRPASDFQA 225

Query: 202 GN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDINA-GLNSIIT 257
           G  CTGGHC RR  YL+ V+ +LVSDL+ M++ W P         L KD  A GL  ++ 
Sbjct: 226 GEACTGGHCERRRAYLEAVTDLLVSDLQYMVEQWQPQVADNYRASLEKDPAANGLRKMLF 285

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           GM SLS  ELAGERM + L  +  E E DCFSDNT+ ++  +  GI + Y GEY +++G 
Sbjct: 286 GMGSLSLGELAGERMKVPLEANSTEDEQDCFSDNTHNAHFYNGKGIRNVYLGEYRKLDGS 345

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKI 377
            + G ++  L++  +      +      +      L D A   + FDQ+I+ +N  G ++
Sbjct: 346 LLSGPNLSSLVAKADAQADATLKADLEASEARLQALVDNAAKDQHFDQLIAADNAAGQQL 405

Query: 378 VRNLINDLITQTESLRKIRIALDLIEPN 405
           VR+ I  L+ QT S+ +    L + + N
Sbjct: 406 VRDAIAALVKQTSSIEQAAARLGIGDLN 433


>gi|260432801|ref|ZP_05786772.1| hypothetical protein SL1157_1935 [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416629|gb|EEX09888.1| hypothetical protein SL1157_1935 [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 423

 Score =  509 bits (1312), Expect = e-142,   Method: Composition-based stats.
 Identities = 184/401 (45%), Positives = 261/401 (65%), Gaps = 3/401 (0%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           F    ++   + + A +  P  +  +VL  YA IA A YED+L  A+ L +AI+ L+ TP
Sbjct: 5   FCATSALTLLIATTASAGDP-PAKAQVLNTYADIAQAAYEDSLAAAKRLRAAIDMLIETP 63

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + + L  AR  WI AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD++YG   
Sbjct: 64  SAEALHAARAAWIAARVPYQQTEVYRFGNPIVDDWEGKVNAWPLDEGLIDYVDAAYGGVT 123

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           +EN L   N+IAN    ++ + ID + I+P LL + LH A+G++ N+ TGYH IEFLLWG
Sbjct: 124 DENALAALNVIANPTFQLSGETIDATDITPALLAETLHEADGVEANVATGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QD+  +    G+RP+TD+  G+ CTGG+C RR +YL+  + +LVSDLE M   W   G A
Sbjct: 184 QDMNGHGPGSGDRPWTDYAQGDACTGGNCDRRAQYLQAATDLLVSDLEWMATQWQDGGAA 243

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              L ++ +AGL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D 
Sbjct: 244 RAALFENESAGLTAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDG 303

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +GI + Y G Y+R++G  + G S+ DL+  +   L  E+  K ++TM+    +K  AE  
Sbjct: 304 LGIQNVYLGSYVRIDGTLVSGPSLSDLVMASAPELDDEMKTKLADTMQALGRIKTTAEAG 363

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            ++DQM+   N  G  ++   +N LI QT+++ +I  ALDL
Sbjct: 364 LAYDQMLERGNAGGEALIMGGVNALIDQTKTIERIVTALDL 404


>gi|77460709|ref|YP_350216.1| hypothetical protein Pfl01_4488 [Pseudomonas fluorescens Pf0-1]
 gi|77384712|gb|ABA76225.1| imelysin. Metallo peptidase. MEROPS family M75 [Pseudomonas
           fluorescens Pf0-1]
          Length = 448

 Score =  509 bits (1311), Expect = e-142,   Method: Composition-based stats.
 Identities = 166/393 (42%), Positives = 233/393 (59%), Gaps = 7/393 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+ +YA +  A Y DA   A+TL +AI+  +  P+   L+ A+  W+ AR+P
Sbjct: 53  VDEAAGKAVVAHYADMVFAVYSDAESTAKTLQTAIDAFLAKPDADTLKAAKAAWVAARVP 112

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSEV+RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   TANIIAN+++ V
Sbjct: 113 YLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGATANIIANTEVQV 171

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL +     GNRP +D+ 
Sbjct: 172 GEDKVDVKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNSTGPGAGNRPASDYL 231

Query: 201 IGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+++LVSDLEEM+  W P   D        +   +GL  ++
Sbjct: 232 EGKGATGGHNDRRRAYLKAVTQLLVSDLEEMVANWKPNVADNYRATLEAEPAESGLRKML 291

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R++G
Sbjct: 292 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGIRNVYLGEYTRVDG 351

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ GAS+  L++  +      +    + T     ++ D A   E +DQ+I+  N  GN+
Sbjct: 352 TKLTGASLSSLVAKVDPAADTALKADLAATEAKIQVMVDHANKGEHYDQLIAAGNTAGNQ 411

Query: 377 IVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
           IVR+ I  L+ QT S+      L +  + P+  
Sbjct: 412 IVRDAIASLVKQTGSIEAAAGKLGISDLNPDNA 444


>gi|331017972|gb|EGH98028.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 452

 Score =  509 bits (1310), Expect = e-142,   Method: Composition-based stats.
 Identities = 153/375 (40%), Positives = 213/375 (56%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAQGAAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMAGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T      + D A   E FDQ+I   N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDATLRADLDDTQAKLQAIVDHANKGEHFDQLIGAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 430 AIEQAAGKLGITDLN 444


>gi|254438835|ref|ZP_05052329.1| hypothetical protein OA307_3705 [Octadecabacter antarcticus 307]
 gi|198254281|gb|EDY78595.1| hypothetical protein OA307_3705 [Octadecabacter antarcticus 307]
          Length = 419

 Score =  509 bits (1310), Expect = e-142,   Method: Composition-based stats.
 Identities = 170/397 (42%), Positives = 250/397 (62%), Gaps = 2/397 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           I +   L   A         + VL  Y+ IA A Y+D+L  A+TL +A+  L+  P + N
Sbjct: 4   ILLSTALTFVAPIAFAAGHAQDVLTTYSNIAEANYQDSLTTAQTLQTAVNALIVDPTEIN 63

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L+ A+  W  AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN 
Sbjct: 64  LQAAKAAWSAARVPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDENE 123

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLK 185
               N+IAN    ++   ID S I+PD L  +LH A+G+++N+ TGYH +EFLLWGQDL 
Sbjct: 124 FAALNVIANPTFTLSGANIDASAITPDFLEGQLHEADGVESNVATGYHAVEFLLWGQDLN 183

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
            +    G RP TD+ +G+ CT G+C RR +YL+  + +LV+DLE M + W   G A   +
Sbjct: 184 GHGTGAGMRPATDYAMGDDCTNGNCDRRGDYLQAATDLLVADLEWMAEQWTEGGDARASV 243

Query: 245 MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
           M D +AG+ +I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  + +G+ 
Sbjct: 244 MADEDAGIATILTGMGSLSYGEAAGERMRLGVMLNDPEEEHSCFADNTHNDHYYNGVGVQ 303

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y G Y R++G  + GAS+ DL++ ++ +L  E+  K S T+++   +K  AE   ++D
Sbjct: 304 NVYLGSYTRIDGTVVSGASLADLVAGSDGDLDTEMRTKLSATIRELGDIKHAAEAGFAYD 363

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            M+   N  G  ++   +N  I QT S+ ++   L +
Sbjct: 364 MMLEAGNAAGEDLIMGGVNAFIDQTRSIERVVAVLGV 400


>gi|330888530|gb|EGH21191.1| putative lipoprotein [Pseudomonas syringae pv. mori str. 301020]
          Length = 452

 Score =  509 bits (1310), Expect = e-142,   Method: Composition-based stats.
 Identities = 152/375 (40%), Positives = 214/375 (57%), Gaps = 5/375 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  R  
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRPR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPN 405
           ++ +    L + + N
Sbjct: 430 AIEQAAGKLGITDLN 444


>gi|262275616|ref|ZP_06053425.1| iron-regulated protein A precursor [Grimontia hollisae CIP 101886]
 gi|262219424|gb|EEY70740.1| iron-regulated protein A precursor [Grimontia hollisae CIP 101886]
          Length = 417

 Score =  508 bits (1309), Expect = e-142,   Method: Composition-based stats.
 Identities = 160/395 (40%), Positives = 231/395 (58%), Gaps = 6/395 (1%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            +       +   V+ +YA +AHA + DA   A+ LD+AI+ L+ +P+  +L +A+  W+
Sbjct: 16  SSTVNAATPTPNDVVSHYADLAHAVFVDAHTSAKQLDAAIDELIKSPSNASLASAKKAWL 75

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  E   N    ANI+AN
Sbjct: 76  AARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAEGYQYE-LGNPGAVANIVAN 134

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
             + V  + +D+S I+P+L+  L+   G + N+ +GYH IEFLLWGQDL       GNR 
Sbjct: 135 MSLTVGSETLDVSTITPELIASLNEIGGSEANVASGYHAIEFLLWGQDLNGTNAGAGNRA 194

Query: 196 YTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAG 251
           YTDF  G  CT G+C RR +YLK  S++LV DL  M   W  D       + +  D   G
Sbjct: 195 YTDFSYGEACTNGNCERRRDYLKAASELLVEDLAWMESQWAADKKDNYRAELIANDARHG 254

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  + +GI +  TG Y
Sbjct: 255 LRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYNELGIYNVLTGSY 314

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN-IESFDQMISEN 370
            R++G ++ G S+ D++   N   A +I   F +     + L + AE     FDQ+I+ +
Sbjct: 315 QRIDGSELSGPSLLDMVRAKNDKAATDIKANFDSARSAVYALVESAEKDNVYFDQLIASD 374

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           N  G+K+V N I+ L+ QT+S+  +   + +   N
Sbjct: 375 NAVGHKLVNNAISALVAQTQSIELLAGEIGISNLN 409


>gi|90418784|ref|ZP_01226695.1| possible iron-regulated protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336864|gb|EAS50569.1| possible iron-regulated protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 447

 Score =  508 bits (1308), Expect = e-142,   Method: Composition-based stats.
 Identities = 188/383 (49%), Positives = 252/383 (65%), Gaps = 2/383 (0%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
                 VL NY+ IA A Y+DAL  A+TLD A + L+  P++  L+ AR  W  AR  YQ
Sbjct: 48  APDKAAVLANYSDIALAGYQDALAAAKTLDEATDALIAGPSEATLKAARDAWRAARPSYQ 107

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNE 142
           ++E +RFGN IVD W+ +VNAWPLDEG IDYV  +YG E++ NNLYTAN+IAN  I +  
Sbjct: 108 ETEAFRFGNPIVDDWEGRVNAWPLDEGLIDYVAGTYGTESDANNLYTANVIANPSITIGG 167

Query: 143 KEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
           + ID S I+P+LL+ KL  A G++ N+ TGYH +EFLLWGQDL       G RP+TDF  
Sbjct: 168 ETIDASTITPELLQDKLQEAGGVEANVATGYHAVEFLLWGQDLNGTDAGAGERPHTDFAG 227

Query: 202 GN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
           G+ CTGG+C RR +YL   + +LV+DLEEM+  W  DG A K L+     G+++I+TGM 
Sbjct: 228 GDDCTGGNCDRRGQYLDAATDLLVTDLEEMVGNWEKDGAARKALLDSPENGISAILTGMG 287

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
           SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+L+D IGI + YTG Y R +G  + 
Sbjct: 288 SLSYGELAGERMKLGLLLHDPEEEHDCFSDNTHISHLHDAIGIRNVYTGRYERTDGTIVE 347

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
           G S+ DL++ +   + QE+  K   T+     +   AE+ E++DQ I E N EGN  V+ 
Sbjct: 348 GPSVSDLVAASAPEIDQELRAKLDATVSAMETMAKAAEDGEAYDQQIGEGNDEGNARVQA 407

Query: 381 LINDLITQTESLRKIRIALDLIE 403
            I+ L+ QT ++ +   ALDL  
Sbjct: 408 AIDGLVDQTRAIERAVAALDLGN 430


>gi|237799577|ref|ZP_04588038.1| putative lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331022433|gb|EGI02490.1| putative lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 436

 Score =  507 bits (1307), Expect = e-141,   Method: Composition-based stats.
 Identities = 153/366 (41%), Positives = 212/366 (57%), Gaps = 5/366 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 70  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNNETLKAARDAWVAARVPYMQSEVFRFGNTII 129

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+P+ 
Sbjct: 130 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITPEK 188

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+  G   TGGH  RR 
Sbjct: 189 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYIEGAGATGGHNERRR 248

Query: 214 EYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELAGE
Sbjct: 249 AYLKAVTDLLVSDLEEMSGNWRAGVADNYRASLEAEPGESGLRKMLFGMGSLSLGELAGE 308

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 309 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 368

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T      + D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 369 VDPATDATLRADLDDTQAKLQAIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 428

Query: 391 SLRKIR 396
           ++ +  
Sbjct: 429 AIEQAA 434


>gi|170720165|ref|YP_001747853.1| hypothetical protein PputW619_0979 [Pseudomonas putida W619]
 gi|169758168|gb|ACA71484.1| conserved hypothetical protein [Pseudomonas putida W619]
          Length = 445

 Score =  506 bits (1302), Expect = e-141,   Method: Composition-based stats.
 Identities = 159/383 (41%), Positives = 227/383 (59%), Gaps = 5/383 (1%)

Query: 27  EKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEV 86
           + V+++Y  + +A Y D+L  A++L SAI+  +  PN   L+ A+  W  AR+PY QSE 
Sbjct: 56  KAVVKHYTEMVYAVYSDSLSTAKSLQSAIDAFLAKPNDDTLKAAKEAWAAARVPYLQSEA 115

Query: 87  YRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEID 146
           +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   ++NIIAN++I V E+++D
Sbjct: 116 FRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPAASSNIIANTEIQVGEEKVD 174

Query: 147 LSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CT 205
           +  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+  G   T
Sbjct: 175 VKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYLEGKGAT 234

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDIN-AGLNSIITGMTSL 262
           GGH  RR  YLK V+++LV DLEEM+  W P+        L  +    GL  ++ GM SL
Sbjct: 235 GGHNERRRAYLKSVTELLVKDLEEMVGNWAPNVADNYRATLEAEPATDGLRKMLFGMGSL 294

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           S  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +G K+ G 
Sbjct: 295 SLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRADGTKLTGP 354

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN++VR+ I
Sbjct: 355 SLSSLVAKADPAADATLKADLEATEAKLQVIVDHALKGEHYDQLIAADNAAGNQVVRDAI 414

Query: 383 NDLITQTESLRKIRIALDLIEPN 405
             L+ QT ++ +    L +   N
Sbjct: 415 ASLVKQTGAIEQAAGKLGIANLN 437


>gi|149203191|ref|ZP_01880161.1| lipoprotein, putative [Roseovarius sp. TM1035]
 gi|149143024|gb|EDM31063.1| lipoprotein, putative [Roseovarius sp. TM1035]
          Length = 420

 Score =  505 bits (1300), Expect = e-141,   Method: Composition-based stats.
 Identities = 175/402 (43%), Positives = 249/402 (61%), Gaps = 6/402 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +T  +++  L   AL+  P      VL  YA IA A Y D+L  A+ L +A+  L+ +P
Sbjct: 5   LLTTTAVIAALGGTALAQTPG----DVLDTYADIAAANYTDSLTAAQALQTAVAALIQSP 60

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +   L+ AR  W+ AR+PYQQSEV+RFGN IVD W+ +VNAWPLDEG IDYVD +YG   
Sbjct: 61  SAATLQAARAAWLAARVPYQQSEVFRFGNAIVDDWEGRVNAWPLDEGLIDYVDGAYGGAT 120

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           ++N L   N+IAN    ++ +EID + I+P LL++ LH A+G++ N+ TGYH IEFLLWG
Sbjct: 121 DQNQLAALNVIANPVFTLSGQEIDATEITPALLQETLHEADGVEANVATGYHAIEFLLWG 180

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDL  +    G+RP+TD+  G +CTGG+C RR EYL   +K+LV DL+ M   W   G A
Sbjct: 181 QDLNGHGDGAGDRPWTDYAQGADCTGGNCDRRAEYLAAATKLLVGDLDWMTTQWADGGAA 240

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              LM D  AGL +I+TGM SLSY E AGERM LGL+L+DPE+E  CF+DNT+  +  + 
Sbjct: 241 RAALMADERAGLAAILTGMGSLSYGETAGERMRLGLMLNDPEEEHSCFADNTHNDHFYNG 300

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +GI + Y G Y R +G  + G S+  L++     L  E+  + ++ +     +K  AE  
Sbjct: 301 VGIRNVYLGSYTRTDGTSVSGPSLSGLVAEIAPTLDVEMRARLADAVLALGRIKTSAEAG 360

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
            ++D+M+   N  G  ++   +  LI QT S+ ++  ALDL 
Sbjct: 361 FAYDEMLERGNAGGEALIMGGVEGLIAQTRSIERVIAALDLG 402


>gi|312962702|ref|ZP_07777191.1| iron-regulated protein [Pseudomonas fluorescens WH6]
 gi|311283077|gb|EFQ61669.1| iron-regulated protein [Pseudomonas fluorescens WH6]
          Length = 447

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 166/389 (42%), Positives = 230/389 (59%), Gaps = 5/389 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+ +YA +  A Y DA   A+TL +AI+  +  PN + L+ AR  W+ AR+P
Sbjct: 52  VDETAAKAVVAHYADMVFAVYSDAESTAKTLQTAIDAFLAKPNDETLKAARAAWVAARVP 111

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSEV+RFGN I+D W+ +VNAWPLDEG IDY D SY +    N   TANIIAN++I +
Sbjct: 112 YLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYTDKSY-EHALGNPGATANIIANTQIQI 170

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+ +I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+ 
Sbjct: 171 GEDKIDVKVITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGKRPASDYL 230

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDIN-AGLNSII 256
            G   TGGH  RR  YL  V+++LVSDLEEM+  W P+        L  +    GL  ++
Sbjct: 231 TGSGATGGHNERRRAYLSAVTQLLVSDLEEMVGNWKPNVEDNYRATLEAEPATDGLRKML 290

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R++G
Sbjct: 291 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGIRNVYLGEYTRVDG 350

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ GAS+  L++  +      +    + T     ++ D A   E +DQ+I+  N  GN+
Sbjct: 351 TKMTGASLSSLVAKADPAADTALKADLAATEAKIQVMVDHANKGEHYDQLIAAGNEAGNQ 410

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPN 405
           IVR+ I  L+ QT S+      L + + N
Sbjct: 411 IVRDAIAALVKQTGSIEAAAGKLGISDLN 439


>gi|254470644|ref|ZP_05084047.1| insulin-cleaving metalloproteinase outer membrane protein
           [Pseudovibrio sp. JE062]
 gi|211959786|gb|EEA94983.1| insulin-cleaving metalloproteinase outer membrane protein
           [Pseudovibrio sp. JE062]
          Length = 422

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 202/405 (49%), Positives = 270/405 (66%), Gaps = 2/405 (0%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M FI    +         ++    +   VL  Y  IA A +ED+L  A+TL  AI+ LV 
Sbjct: 1   MSFIRGALLGTVALGSLSTVAVAATPSDVLATYGDIAQAAFEDSLTTAKTLQVAIDKLVA 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P + NL+ AR  WI AR PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD +YG 
Sbjct: 61  EPTEDNLKAARRAWIAARNPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDGAYGN 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLL 179
           E+EEN  Y ANIIAN+K+ V  +EID + I+P LL  +L  A  ++ N+ TGYH IEFLL
Sbjct: 121 ESEENPYYAANIIANAKVTVAGEEIDATEITPALLADQLQEAGEVEANVATGYHAIEFLL 180

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           WGQDL    +  GNRP +DFD  NCTGG+C RRV+YL+  + +L++DLEEM+ AW  DG 
Sbjct: 181 WGQDLNGTGKGAGNRPASDFDTANCTGGNCERRVQYLQAATTLLITDLEEMVAAWQADGA 240

Query: 240 ATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
           A KDL  K   AG+ +I+TGM SLSY ELAGERM LGL+L+DPE+E DCFSDNT+ S+ N
Sbjct: 241 ARKDLADKGEAAGIATILTGMGSLSYGELAGERMKLGLMLNDPEEEHDCFSDNTHMSHYN 300

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           DV+GI + + G+Y R++G  + GAS+ DL++  +  ++ E+  K + ++  F  LK RAE
Sbjct: 301 DVVGINNVFQGKYTRVDGTVVEGASLKDLLAKADSAVSAELEGKLNASLGAFTALKTRAE 360

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
             E++DQMI E N EGN +V+  ++ L+ QT S+ +    L L +
Sbjct: 361 TTEAYDQMIGEGNTEGNAVVQAAVDSLVDQTSSIERAVKVLKLEQ 405


>gi|330895180|gb|EGH27518.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 366

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 151/359 (42%), Positives = 208/359 (57%), Gaps = 5/359 (1%)

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+D W+ +VNAWPLDEG 
Sbjct: 1   LSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTIIDDWEGQVNAWPLDEGL 60

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + L  L+   G + N+ T
Sbjct: 61  IDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASLNELGGSEANVAT 119

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEE 229
           GYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK V+ +LVSDLEE
Sbjct: 120 GYHAIEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGHNDRRRAYLKAVTDLLVSDLEE 179

Query: 230 MMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEID 286
           M   W    PD        +   +GL  ++ GM SLS  ELAGERM + L  +  E E D
Sbjct: 180 MSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGERMKVALEANSSEDEHD 239

Query: 287 CFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNT 346
           CFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  +      +     +T
Sbjct: 240 CFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVRGPSLSSLVAKADPATDATLRADLDDT 299

Query: 347 MKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
                ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ +    L + + N
Sbjct: 300 QAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIEQAAGKLGITDLN 358


>gi|163792732|ref|ZP_02186709.1| hypothetical protein BAL199_17833 [alpha proteobacterium BAL199]
 gi|159182437|gb|EDP66946.1| hypothetical protein BAL199_17833 [alpha proteobacterium BAL199]
          Length = 429

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 188/408 (46%), Positives = 253/408 (62%), Gaps = 8/408 (1%)

Query: 2   YFITIISIVFTLPSHALSIVP------NVSLEKVLQNYATIAHAKYEDALMCARTLDSAI 55
             +   ++  TL   ++  +P       V  + V+ NY  IAHA Y+DA   A TL SA+
Sbjct: 3   SLVRTAALAVTLSVASIGALPIGAHAAAVDAKAVIANYEAIAHAMYQDAHASAVTLKSAV 62

Query: 56  ETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVD 115
             L  TP+ KNL+ AR+ WI AR  YQQ+E  RFGN IVD W+ +VNAWPLDEG IDYVD
Sbjct: 63  RALAKTPSAKNLKAARVAWIAARPAYQQTEALRFGNAIVDDWEGRVNAWPLDEGLIDYVD 122

Query: 116 SSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVI 175
           + YG E + N LYTAN+IAN KI +    +D S I   L+ +LH A  ++ N++ GYH I
Sbjct: 123 AGYGTEADHNPLYTANVIANKKIRIGATMVDASKIDKKLIAELHEAQEVEANVSIGYHAI 182

Query: 176 EFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG 235
           EFLLWGQDL       GNRP+TDFD   CT G+C RR  YL   + +LV DL EM+  W 
Sbjct: 183 EFLLWGQDLNGTGPGAGNRPHTDFDTRKCTNGNCDRRAAYLVAATDLLVDDLAEMVANWA 242

Query: 236 PDGQATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYA 294
           P G A  +L  K    GL +I+TG+ SLSY ELAGERM LGLILHDPE+E DCFSDNT+ 
Sbjct: 243 PGGPARAELEAKGPEGGLATILTGIGSLSYGELAGERMKLGLILHDPEEEHDCFSDNTHN 302

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
           S+  D +G+++  +G Y+R +   I G  I DL +  +   A+E+    + T     ++K
Sbjct: 303 SHYYDQVGMVALASGRYVRSDKSVIKGPGILDLAAAKDPAAAKEMTAALATTSAKMQVMK 362

Query: 355 DRAENI-ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           D A+    ++DQMI E N  GNKIV+++I+ L+ QT +  ++  AL+L
Sbjct: 363 DTADKGTMAYDQMIGEGNEAGNKIVQDVIDGLVAQTRATERVVTALNL 410


>gi|288961780|ref|YP_003452090.1| hypothetical protein AZL_c02530 [Azospirillum sp. B510]
 gi|288914060|dbj|BAI75546.1| hypothetical protein AZL_c02530 [Azospirillum sp. B510]
          Length = 424

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 176/379 (46%), Positives = 240/379 (63%), Gaps = 5/379 (1%)

Query: 27  EKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEV 86
           + V +NYA IAHA YEDA   A+ L  A++ L+  P ++NL  AR  W  AR+PY Q+E 
Sbjct: 29  KDVAKNYADIAHAAYEDATNGAKALKKAVDALIANPTEENLTKARDVWKAARVPYMQTEA 88

Query: 87  YRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEID 146
           +RFGN IVD W+ KVNAWPLDEG IDYVD SY    E N    AN+IAN KI    K ID
Sbjct: 89  FRFGNPIVDEWEGKVNAWPLDEGLIDYVDESYAG-GESNPYAKANVIANPKITAGGKTID 147

Query: 147 LSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-C 204
            + I+ +LL + LH A  ++ N+ TGYH IEFLLWGQDL       G R  TD+  G  C
Sbjct: 148 ATKITKELLAEKLHEAGKVEANVATGYHAIEFLLWGQDLHGTGPGAGERKATDYAKGKAC 207

Query: 205 TGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA-GLNSIITGMTSLS 263
           T  HC RR +YLKV +++LV DL EM   W   G+A   + K   + G+  ++TG+ SLS
Sbjct: 208 TNDHCDRRAQYLKVATQMLVDDLAEMTADWSAKGKARVSIAKAPESEGVARMLTGLGSLS 267

Query: 264 YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
           Y ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D +G+++ Y G Y R +G+ + GAS
Sbjct: 268 YGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYDEVGMVNVYNGSYKRTDGKTVSGAS 327

Query: 324 IHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI-ESFDQMISENNPEGNKIVRNLI 382
           +  L++  + +    +    ++TMK    +KD A++   ++DQMI  +NPEGNK+V + I
Sbjct: 328 LSQLVAAKSADADAAVKAAMADTMKAMQAIKDTADSGKMAYDQMIGADNPEGNKLVSDGI 387

Query: 383 NDLITQTESLRKIRIALDL 401
           + L+ Q ++L     AL +
Sbjct: 388 DRLVAQKKALEGAVAALGV 406


>gi|56695014|ref|YP_165360.1| putative lipoprotein [Ruegeria pomeroyi DSS-3]
 gi|56676751|gb|AAV93417.1| lipoprotein, putative [Ruegeria pomeroyi DSS-3]
          Length = 420

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 176/401 (43%), Positives = 246/401 (61%), Gaps = 2/401 (0%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           T +     L               VL  YA IA AKY+D+L+ AR L  A++ L+  P+ 
Sbjct: 3   TRVFAAAALALSCSVPAWAADRAAVLTTYADIAEAKYQDSLITARALQVAVDALIADPSA 62

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           + L  A+  W+ AR PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SY   ++E
Sbjct: 63  QTLAAAKQAWLAARDPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYPGASDE 122

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQD 183
           N     N+IA     ++   +D S I+P+LL   LH A+G++ N+ TGYH IEFLLWGQD
Sbjct: 123 NGYAALNVIATPVFDLSGTTVDASQITPELLSGTLHEADGVEANVATGYHAIEFLLWGQD 182

Query: 184 LKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           L       GNRP+TD+  G +CTGG+C RR  YL+  + +L+SDLE M   W P G A  
Sbjct: 183 LNGTGPGAGNRPWTDYAPGADCTGGNCDRRGAYLQAATDLLISDLEWMAAQWAPGGDART 242

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
            +  D  AGL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G
Sbjct: 243 SVTADETAGLVAMLTGMGSLSYGEQAGERMRLGLLLNDPEEEHDCFSDNTHNSHYFDGLG 302

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           I + Y G Y R++G  I GAS+ DL++  +  L  E+ D+ + TM     ++  A+   +
Sbjct: 303 IRNVYLGSYTRVDGTVISGASLSDLVADADAALDAEVKDRLNITMDALGAIRSAAKGGFA 362

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           +DQM++  N EG  ++   ++ L+ Q  S +++   L L +
Sbjct: 363 YDQMLARGNAEGEALIMAGVDGLVEQARSFQRLFPVLGLDD 403


>gi|70732153|ref|YP_261909.1| putative lipoprotein [Pseudomonas fluorescens Pf-5]
 gi|68346452|gb|AAY94058.1| lipoprotein, putative [Pseudomonas fluorescens Pf-5]
          Length = 446

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 168/405 (41%), Positives = 234/405 (57%), Gaps = 7/405 (1%)

Query: 9   IVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLE 68
              T  + A   V   + + V+ +YA +  A Y D+   A+TL +AI+  +  PN   L+
Sbjct: 39  STATPAADAAGKVDEAAAKAVVAHYADMVFAVYSDSESTAKTLQTAIDAFLAKPNDDTLK 98

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
            A+  W+ AR+PY QSEV+RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   
Sbjct: 99  AAKAAWVAARVPYLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGA 157

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
           TANIIAN++I V E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL    
Sbjct: 158 TANIIANTEIQVGEDKVDVKDITPEKLASLNELGGAEANVATGYHAIEFLLWGQDLNGTG 217

Query: 189 REPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLM 245
              G RP +D+  G   TGGH  RR  YLK V+++LV+DLEEM+  W PD        L 
Sbjct: 218 PGAGARPASDYLEGAGATGGHNDRRRAYLKAVTQLLVNDLEEMVGNWKPDVADNYRATLE 277

Query: 246 KDI-NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
            +    GL  ++ GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI 
Sbjct: 278 AEPAETGLRKMLFGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGIR 337

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y GEY R +G K+ GAS+  L++  +      +    + T     ++ D A   E +D
Sbjct: 338 NVYLGEYTRTDGTKMSGASLSSLVAKADPAADAALKADLAATEAKIQVMVDHANKGEHYD 397

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
           Q+I+  N  GN+IVR+ I  L+ QT S+ +    L +  + P+  
Sbjct: 398 QLIAAGNESGNQIVRDAIAALVKQTGSIEQAAGKLGISDLNPDNA 442


>gi|298291366|ref|YP_003693305.1| peptidase M75, Imelysin [Starkeya novella DSM 506]
 gi|296927877|gb|ADH88686.1| Peptidase M75, Imelysin [Starkeya novella DSM 506]
          Length = 431

 Score =  494 bits (1273), Expect = e-138,   Method: Composition-based stats.
 Identities = 181/384 (47%), Positives = 244/384 (63%), Gaps = 3/384 (0%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                +  ++  YA IA A Y D+L  A+ L SA++  +  P + NL+ A+  W  AR+P
Sbjct: 30  TQAPKVRDIVTTYADIAEAMYGDSLKTAKDLQSAVDAFLADPTEANLDKAKTAWKAARVP 89

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS-SYGKENEENNLYTANIIANSKII 139
           YQQ+E YRFGN IVD W+ +VNAWPLDEG IDYVD  SYG  ++EN LYTAN+IAN+KI 
Sbjct: 90  YQQTEGYRFGNAIVDDWEGRVNAWPLDEGLIDYVDKKSYGDSSDENPLYTANVIANTKIR 149

Query: 140 VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
           V +K ID + I+P LL  L  A G+++N+  GYH IEFLLWGQDL       G RP TD+
Sbjct: 150 VGKKTIDATKITPKLLDSLQEAGGVESNVAIGYHAIEFLLWGQDLNGTGPGAGKRPATDY 209

Query: 200 DIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDIN-AGLNSIITG 258
              NCT G+C RR  YLK  + +LV+DL +M K WG  G+A   + K  + A L +I+TG
Sbjct: 210 SATNCTNGNCDRRGAYLKAATDLLVADLTDMTKWWGAKGKARAAVAKQKDKAALGTILTG 269

Query: 259 MTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEK 318
           + SLSY ELAGERM LGLILHDPE+E DCFSDNTY S+  D +GI S Y G+Y R++G  
Sbjct: 270 LGSLSYGELAGERMKLGLILHDPEEEHDCFSDNTYNSHYYDELGIASIYRGKYTRVDGSV 329

Query: 319 IHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI-ESFDQMISENNPEGNKI 377
           + GAS+    +      A+E + K    +     +KD  ++  E++DQMI E N  GN +
Sbjct: 330 VEGASVAAYAAAKAPKAAEEADAKVDAALAALKAIKDEGDSGKEAYDQMIGEGNAAGNAL 389

Query: 378 VRNLINDLITQTESLRKIRIALDL 401
           V+  ++ L+ QT ++  +  AL L
Sbjct: 390 VQKGVDSLVAQTRAIEGVVAALKL 413


>gi|153827295|ref|ZP_01979962.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae MZO-2]
 gi|149738786|gb|EDM53128.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae MZO-2]
          Length = 379

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 152/376 (40%), Positives = 217/376 (57%), Gaps = 6/376 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKKAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 363

Query: 358 E-NIESFDQMISENNP 372
           E N + FDQ+I+ +N 
Sbjct: 364 EKNNQHFDQLIAADNA 379


>gi|89092302|ref|ZP_01165256.1| hypothetical protein MED92_05803 [Oceanospirillum sp. MED92]
 gi|89083390|gb|EAR62608.1| hypothetical protein MED92_05803 [Oceanospirillum sp. MED92]
          Length = 427

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 181/400 (45%), Positives = 260/400 (65%), Gaps = 2/400 (0%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++   + S   +     +   +L NYA IAHA YED+L+ A+TL+  I+  + +P+
Sbjct: 7   LAAMAVSVAVLSTTQTQAAAPATTDILNNYANIAHATYEDSLLTAQTLNKVIDQFLASPS 66

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           + NL+ AR  W+ AR+PYQQSE YRFGN +VD W+ KVNAWPLDEG IDYVD+ YG E++
Sbjct: 67  EANLKKARAAWVAARVPYQQSEAYRFGNALVDDWEGKVNAWPLDEGLIDYVDAGYGSESD 126

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN  YTANIIAN  + V    +D + I   LL + LH  + ++ N+ TGYH IEFLLWGQ
Sbjct: 127 ENPFYTANIIANKTLKVGGVTVDSTNIDKKLLAETLHEIDEVEANVATGYHAIEFLLWGQ 186

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           DL       GNRP +DFD+ NCTGG+C RR +YLK  +++L+ DL++M  +W  +G A +
Sbjct: 187 DLNGTNPGAGNRPASDFDLKNCTGGNCDRRRDYLKAATELLIDDLQDMTSSWANNGAARQ 246

Query: 243 DLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
           DLM K    GL +I+TGM SL+Y ELAGER  LGL++HDPE+E DCF+DNT+AS+  D +
Sbjct: 247 DLMAKGPQGGLATILTGMGSLAYGELAGERTKLGLMVHDPEEEHDCFADNTHASHFYDAL 306

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y GEY R++G K+ GAS+  L++     + Q + +K   T     ++ D A    
Sbjct: 307 GIKNVYLGEYTRVDGSKVSGASLSQLVNAEAPVVDQNLRNKLDATQAAAQVMVDEAAKGN 366

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           +FD +I ENN  GN++V+  ++ L+ + E++      L L
Sbjct: 367 TFDVLIGENNAAGNQVVQTFVDALVAEAEAIEHTIAVLKL 406


>gi|154247126|ref|YP_001418084.1| putative iron-regulated protein [Xanthobacter autotrophicus Py2]
 gi|154161211|gb|ABS68427.1| putative iron-regulated protein [Xanthobacter autotrophicus Py2]
          Length = 428

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 165/385 (42%), Positives = 235/385 (61%), Gaps = 3/385 (0%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
                    V+ +YA +A A Y  +   A+ +   I + +  P+   L  AR  W  AR+
Sbjct: 25  PKDAPKPRDVIVHYADLAQAMYGSSAATAKDMQKVILSFLDAPSADTLAKARDAWKAARV 84

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS-SYGKENEENNLYTANIIANSKI 138
            Y Q+E +RFGNK VD  +  VNAWPLDEG IDYVD  SYG++++EN LYTAN+I++  I
Sbjct: 85  FYMQTEGFRFGNKAVDKIEGDVNAWPLDEGLIDYVDKKSYGEKSDENPLYTANVISSKSI 144

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
            + +K ID + I+P+LL  L+ A G++ N+ +G+H IEFLLWGQ+L       G+RPYTD
Sbjct: 145 RIGKKTIDTTKITPELLHSLNTAGGVEANVGSGWHAIEFLLWGQNLHDPKINAGSRPYTD 204

Query: 199 FDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK-DINAGLNSIIT 257
           FD+ NCT  +C RR EYLKV +  LV+DLE+M   WGP G     L+K      L  I T
Sbjct: 205 FDLKNCTNANCDRRAEYLKVATATLVADLEDMAALWGPQGAGRTTLLKMKDKPALAVIFT 264

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           G+ SLSY ELAGERM LGLILHD E+  DCFS+NT+ S+  D +GI   Y G Y + +G 
Sbjct: 265 GLGSLSYGELAGERMKLGLILHDTEEAQDCFSNNTHNSHYYDEVGIRDIYYGRYTKPDGT 324

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE-SFDQMISENNPEGNK 376
              G S+ DLI   +  +A EI+ K    +     +KD A++ E  +DQM++E N +G +
Sbjct: 325 VFSGPSVADLIRAADPKIADEIDQKSDAALAALKKIKDTADSGEIYYDQMLAEGNVKGGQ 384

Query: 377 IVRNLINDLITQTESLRKIRIALDL 401
           ++++ ++ L+ Q  ++ +   AL L
Sbjct: 385 LIQDGVDALVAQAHAIERGVSALKL 409


>gi|110833100|ref|YP_691959.1| hypothetical protein ABO_0239 [Alcanivorax borkumensis SK2]
 gi|110646211|emb|CAL15687.1| Uncharacterized iron-regulated protein [Alcanivorax borkumensis
           SK2]
          Length = 429

 Score =  482 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 168/412 (40%), Positives = 228/412 (55%), Gaps = 6/412 (1%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           ++F        +  +           +KV+ +YA +A A Y DAL  AR L + I+ L+ 
Sbjct: 15  LFFSACSDEPQSSGAVVAQAYDQTQGKKVVSHYADVALATYTDALAEARKLKTQIDALLA 74

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P + +L  AR  W  AR+PY QSEV+RFGN +VD W+ +VNAWPLDEG IDYVD  Y  
Sbjct: 75  APTEDSLTAARDAWRAARVPYMQSEVFRFGNVVVDEWEGQVNAWPLDEGLIDYVDEDY-H 133

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
               N    ANIIA+  + + E+ +DL+ +S +LL  L+   G + N+ TGYH IEFLLW
Sbjct: 134 AVMGNPGARANIIASESLKIGEQALDLTDLSAELLASLNELGGSEVNVATGYHAIEFLLW 193

Query: 181 GQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG- 238
           GQDL       G RP TDF  G   TGGH  RR EYL VV+ +L++DLE M+  W P   
Sbjct: 194 GQDLNGTDAGAGERPATDFATGPQATGGHNARRREYLSVVTDLLINDLEVMVDEWRPGEE 253

Query: 239 QATKDLMKDI-NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               +L  D    GL  ++ GM SLS  ELAGERM + L  H PE E DCFSDNT+AS+ 
Sbjct: 254 NYRAELEADSVENGLRKMLFGMGSLSLGELAGERMKVALAAHSPEDEHDCFSDNTHASHF 313

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + Y GEY R+NGE + G S+ DL++ N   +  ++      +      L D A
Sbjct: 314 YNGKGIRNVYLGEYRRVNGETLTGPSLSDLVAANKPAIDNQLKADLEASRAALQGLVDSA 373

Query: 358 ENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
                FDQ+I+  N EG   V   I+ L+ QT S+      L++  + P+  
Sbjct: 374 NKGIHFDQLIAPGNSEGAATVNAAIDTLVAQTTSIEAAAAVLNIQALNPDTA 425


>gi|254427956|ref|ZP_05041663.1| hypothetical protein ADG881_1186 [Alcanivorax sp. DG881]
 gi|196194125|gb|EDX89084.1| hypothetical protein ADG881_1186 [Alcanivorax sp. DG881]
          Length = 429

 Score =  481 bits (1237), Expect = e-133,   Method: Composition-based stats.
 Identities = 164/401 (40%), Positives = 227/401 (56%), Gaps = 6/401 (1%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           +  +           ++V+ +YA +A A + DAL  AR L + I+ L+  P + NL  AR
Sbjct: 26  STDADTAPAYDQAQGKRVVSHYADVALATFGDALSGARALKTQIDALLAAPTEANLAAAR 85

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W  AR+PY Q+EV+RFGN +VD W+ +VNAWPLDEG IDYVD  Y +    N    AN
Sbjct: 86  DAWRAARVPYMQTEVFRFGNAVVDEWEGQVNAWPLDEGLIDYVDEDY-QAVMGNPGARAN 144

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
           IIA+  + + E+ +DL+ ++ +LL  L+   G + N+ TGYH IEFLLWGQDL       
Sbjct: 145 IIASESLKIGEQTLDLTDLNAELLASLNELGGSEVNVATGYHAIEFLLWGQDLNGTDAGA 204

Query: 192 GNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG-QATKDLMKDI- 248
           G RP TDF  G + TGGH  RR EYL VV+ +L+ DLE M+  W P       +L  D  
Sbjct: 205 GQRPATDFATGPDATGGHNERRREYLSVVTDLLIDDLEVMVDEWRPGEENYRAELEADSV 264

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
             GL  ++ GM SLS  ELAGERM + L  H PE E DCFSDNT+AS+  +  GI + Y 
Sbjct: 265 ENGLRKMLFGMGSLSLGELAGERMKVALAAHSPEDEHDCFSDNTHASHFYNGKGIRNVYL 324

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
           GEY R NGE + G S+ DL++ N      ++    + +     +L D A     FDQ+I+
Sbjct: 325 GEYQRTNGETLAGPSLSDLVAANQPAADSQLKTDLNASEAALQVLVDSANQGTHFDQLIA 384

Query: 369 ENNPEGNKIVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
             N +G   V   I+ L+ QT S+ K    L++  + P+  
Sbjct: 385 PGNAQGADTVNAAIDALVVQTTSIEKAARVLNIQALNPDTA 425


>gi|254226417|ref|ZP_04920004.1| iron-regulated protein A, putative [Vibrio cholerae V51]
 gi|125621039|gb|EAZ49386.1| iron-regulated protein A, putative [Vibrio cholerae V51]
          Length = 346

 Score =  454 bits (1168), Expect = e-125,   Method: Composition-based stats.
 Identities = 136/328 (41%), Positives = 193/328 (58%), Gaps = 5/328 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IA+A Y D+ + A+ L   I+  +  
Sbjct: 20  SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAYAVYADSRVTAQQLQKTIDRFLQA 79

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 80  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 139

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 140 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 198

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 199 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 258

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 259 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 318

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIH 325
            +  GI + YTG Y R +G ++ G S++
Sbjct: 319 YNEQGIYNIYTGSYTRADGSELKGPSLY 346


>gi|88799522|ref|ZP_01115099.1| putative iron-regulated protein A [Reinekea sp. MED297]
 gi|88777832|gb|EAR09030.1| putative iron-regulated protein A [Reinekea sp. MED297]
          Length = 407

 Score =  450 bits (1158), Expect = e-124,   Method: Composition-based stats.
 Identities = 154/407 (37%), Positives = 238/407 (58%), Gaps = 12/407 (2%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M  +  ++++    +HA      ++ + V++ Y  IA+  Y DAL  A  L S IE LV 
Sbjct: 1   MKHLIAVTLLAAGVAHA-----EITSQDVVEGYTDIAYTNYADALQTAEALQSTIENLVD 55

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P+ + L  A+  W+ AR  YQQSEV+RFGN +VD W+ ++NAWPLDEG IDYVD    +
Sbjct: 56  HPSAEALAAAKAAWLEARPSYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVDDRAYE 115

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
               N+  TAN++AN ++     ++ +S + P+ L  L+   G + N+ TGYH IEFLLW
Sbjct: 116 FELGNDGGTANLVANKRV----GDLKVSRLKPETLASLNEFGGSEANVATGYHAIEFLLW 171

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GQDL  +    G RP+TD+  GN CT  +C+RR +YL+  +++LV DLE M+  W PDG 
Sbjct: 172 GQDLNGHQAGAGERPWTDYAKGNDCTNENCKRRGQYLEAAAELLVEDLEYMVAQWAPDGD 231

Query: 240 ATKDLMK-DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
             + L++ D    LN ++ GM SL+  ELAGER+ + L  +  E E DCFSDNT+ S+  
Sbjct: 232 YRQQLLQEDEQTVLNKMLFGMGSLALGELAGERIKVALTANSTEDEHDCFSDNTHNSHYY 291

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHD-LISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
           +  G+ + Y G Y   +GE      + D L+ + + +L  + +  F+ T +    +  RA
Sbjct: 292 NAKGVANLYFGSYTNADGETTRVVGLRDLLLVNGHADLIADADRAFAATQQSMAAMVTRA 351

Query: 358 ENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEP 404
           EN E+FDQMI+  N  G  ++ + IN L+ +T ++  + +AL + + 
Sbjct: 352 ENGEAFDQMIAPGNTSGAALLNDAINRLVEETAAIESMALALGIEQL 398


>gi|300021838|ref|YP_003754449.1| peptidase M75, Imelysin [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523659|gb|ADJ22128.1| Peptidase M75, Imelysin [Hyphomicrobium denitrificans ATCC 51888]
          Length = 427

 Score =  450 bits (1158), Expect = e-124,   Method: Composition-based stats.
 Identities = 166/401 (41%), Positives = 246/401 (61%), Gaps = 7/401 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
            T +++   +   A +  P V  + + + Y  +A A Y D+L  A+ LD AI+  +  P+
Sbjct: 11  ATGLALAGAVARPAFADAPAV--KDITKTYGDLAEAMYSDSLAKAKDLDKAIDAFLAAPD 68

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVD-SSYGKEN 122
               + A+  W  ARIPY Q+E +RFGNKIVD W+  VN+WPLDEG IDYVD +SYG   
Sbjct: 69  ATTQKAAQDAWKAARIPYMQTEGFRFGNKIVDDWEGNVNSWPLDEGLIDYVDKASYGDAK 128

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           EEN LYTANIIAN  + +  K +D S I   ++ +L+ A  +++N+ TGYH IEFLLWGQ
Sbjct: 129 EENPLYTANIIANKSVRLGPKVLDASKIDKTVIAQLNSALEVESNVGTGYHAIEFLLWGQ 188

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           +L       G RP +DFD+ NCT  +C RR +YLK  S +L+ DL EM   W   G A +
Sbjct: 189 NLHGTSAGAGERPASDFDLKNCTHDNCDRRRDYLKAASSLLIDDLSEMAGNWKAGGAARE 248

Query: 243 DLMK-DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
            L K D NA L++I+TG+ SLSY ELAGERM LG++LHDPE+  DCFS+NT+ S+  D +
Sbjct: 249 ALSKQDANAQLSTILTGIGSLSYGELAGERMKLGVLLHDPEEAHDCFSNNTHNSHYYDQV 308

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI- 360
           G+I  + G+Y       + GASI +L      + A+ +++   NT    + +K +A++  
Sbjct: 309 GMIEIWNGKYDGA--TAVSGASIAELARAKAPDAAKRVDEAMENTKAKLNAIKVKADSGE 366

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
             ++QM++  N  GNK++ + ++ L+ Q  ++  +  AL+L
Sbjct: 367 MGYNQMLAAGNDAGNKLILDGVDALVAQARAVEAVVAALNL 407


>gi|330957925|gb|EGH58185.1| putative lipoprotein [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 324

 Score =  427 bits (1098), Expect = e-117,   Method: Composition-based stats.
 Identities = 131/317 (41%), Positives = 178/317 (56%), Gaps = 5/317 (1%)

Query: 93  IVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISP 152
           I+D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ 
Sbjct: 1   IIDDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITA 59

Query: 153 DLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRR 211
           D L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+  G   TGGH  R
Sbjct: 60  DKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYLEGAGATGGHNDR 119

Query: 212 RVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELA 268
           R  YLK V+ +LVSDLEEM   W     D        +   +GL  ++ GM SLS  ELA
Sbjct: 120 RRAYLKAVTDLLVSDLEEMSGNWRAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELA 179

Query: 269 GERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLI 328
           GERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L+
Sbjct: 180 GERMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLV 239

Query: 329 SHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQ 388
           +  +      +     +T      + D A   E FDQ+I+  N  GN++VR+ I  L+ Q
Sbjct: 240 AKVDPATDATLRADLDDTQAKLQAIVDHASKGEHFDQLIASGNTAGNQVVRDAIAALVKQ 299

Query: 389 TESLRKIRIALDLIEPN 405
           T ++ +    L + + N
Sbjct: 300 TGAIEQAAGKLGITDLN 316


>gi|160896972|ref|YP_001562554.1| putative iron-regulated protein [Delftia acidovorans SPH-1]
 gi|160362556|gb|ABX34169.1| putative iron-regulated protein [Delftia acidovorans SPH-1]
          Length = 428

 Score =  417 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 123/399 (30%), Positives = 203/399 (50%), Gaps = 37/399 (9%)

Query: 15  SHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
           +    +  ++S+ +V+++Y T+ HA Y D++  A+T+  AI   +  P+++ L  AR  W
Sbjct: 56  TVQQPVKKSLSVAEVVKHYGTLVHANYSDSISSAKTMQKAIAAFLAAPSEQGLNQARKAW 115

Query: 75  IRARIPYQQSEVYRFGNKIVD---TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
           + AR  Y Q+E +RF    +D     + ++NAWP+DE ++DYV+ +            A 
Sbjct: 116 LDAREYYGQTEAFRFYAGPIDNDQGPEGQINAWPMDESYVDYVEGNP----------NAG 165

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
           II N K            I+   L +L+  +G + N++TG+H IEF+LWGQDL    + P
Sbjct: 166 IINNRK----------EAITKKRLAELNEHDG-EENVSTGWHAIEFMLWGQDLND--KGP 212

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG--QATKDLMKDIN 249
           G RPYTDF  G     +  RR EYLKVV+ +L+ DL+ +   W P           K  +
Sbjct: 213 GARPYTDFVDGK--KSNADRRREYLKVVTALLIEDLQSVADQWKPGSPKNFRAQFEKKPD 270

Query: 250 AGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTG 309
             L  I  G+ SLS  ELAGER+ + L   D E E  CFSDNT+   + +  GI++ + G
Sbjct: 271 DALRRIFVGLGSLSRGELAGERLEVALASRDQEDEHSCFSDNTHRDAVTNAQGILNVWQG 330

Query: 310 EYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI-S 368
            Y R++G ++ G  I D ++  +  LA     + + +++    +         FDQ I  
Sbjct: 331 SYKRLDGSELQGPGIKDWVASKDSALADRTTRQITQSVQAAQAIPA------PFDQAIQG 384

Query: 369 ENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRV 407
             +      ++  I+ L+ Q++ L +   A+ + + N V
Sbjct: 385 ARDSASRAKIQATIDSLVQQSKDLVEAANAVGITQLNLV 423


>gi|83643091|ref|YP_431526.1| putative iron-regulated protein [Hahella chejuensis KCTC 2396]
 gi|83631134|gb|ABC27101.1| uncharacterized iron-regulated protein [Hahella chejuensis KCTC
           2396]
          Length = 459

 Score =  415 bits (1068), Expect = e-114,   Method: Composition-based stats.
 Identities = 151/440 (34%), Positives = 228/440 (51%), Gaps = 42/440 (9%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           F   + +       A S    V  ++V+ ++A +AHA Y D+L  A  L+ +I+  + TP
Sbjct: 11  FAVPLLMSACAGHQASSTSQVVEPKQVVDHFANMAHAMYADSLQAATQLNKSIDVFLATP 70

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRF---------------GNKIVDTWDKKVNAWPLD 107
            + NL+ A+  + +AR+PYQQSEV RF               G   +D W+ +VNAWPLD
Sbjct: 71  TQANLDAAKAAYAQARVPYQQSEVLRFDVENGHVTEGLDADGGLASIDAWEGQVNAWPLD 130

Query: 108 EGFIDYVDSSYGKENEENNLYTANIIANSK-IIVNEKEIDLSIISPDLLRKLHRANGIDT 166
           E  IDYV  SY  E         NII ++    V  + ID+S I+P+L+  ++   G + 
Sbjct: 131 EALIDYVSGSYEGEYN----SPKNIINSTGVFTVGGQSIDISTITPELIAGMNEIGGAEA 186

Query: 167 NITTGYHVIEFLLWGQDLKTNVREPGNRP----YTDFDIGNCTGGH-------CRRRVEY 215
           N+T+G H IEFLLWGQDL       G RP    YTD   G CT G        C+RR +Y
Sbjct: 187 NVTSGVHAIEFLLWGQDLNGTGPGAGARPVSDYYTDSSQGACTSGDKKSDYKICQRRAQY 246

Query: 216 LKVVSKILVSDLEEMMKAWGPDGQATKDLMKDI----NAGLNSIITGMTSLSYNELAGER 271
           LK  + +LVSDL+ M   W P   A K  +++       GL  I+  M  ++  ELA ER
Sbjct: 247 LKAAADLLVSDLQAMEAEWTPAAGAKKGTLRNDFLTRGDGLQRILDSMGDMAIGELASER 306

Query: 272 MNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN 331
           M + ++    E E DCFSD T+ +  N+ +G++ +Y G Y R++G  + G SI DL++H+
Sbjct: 307 MKVAILFGSTEDEHDCFSDLTHIAIYNNAMGVVDAYRGSYARLDGSVVSGPSIADLVAHH 366

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAEN---IESFDQMISENNPEGNKIVRNLINDLITQ 388
           N  L Q++++  S        + D+AE     + FDQ++   + E  K+V +    L++ 
Sbjct: 367 NPALKQQMDEHMSLIESRMRAIVDKAEAKSGGKKFDQLVG-GSAEDKKLVLDAAAALVSL 425

Query: 389 TESLRKIRI---ALDLIEPN 405
            E L +      AL L E +
Sbjct: 426 EEPLSEGVSKVLALSLQEFD 445


>gi|262197051|ref|YP_003268260.1| peptidase M75, Imelysin [Haliangium ochraceum DSM 14365]
 gi|262080398|gb|ACY16367.1| Peptidase M75, Imelysin [Haliangium ochraceum DSM 14365]
          Length = 441

 Score =  398 bits (1024), Expect = e-109,   Method: Composition-based stats.
 Identities = 133/419 (31%), Positives = 193/419 (46%), Gaps = 48/419 (11%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           T   I       A   V  VS  +V+++YATI HA Y+DAL  A  L S I+  +  P  
Sbjct: 44  TTPDIDAGADVDAAPPVAQVSRAEVVEHYATIVHANYKDALDRALHLQSTIDLFLAEPTA 103

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD---KKVNAWPLDEGFIDYVDSSYGKE 121
              E  +  W+ AR+PY QSE YRF    +D  D    ++NAWP+DE ++DYV     +E
Sbjct: 104 SRFETVKRAWLEARVPYGQSEAYRFYEGPIDDADGPEGQLNAWPMDEAYVDYVIDPQTEE 163

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGI-----------DTNITT 170
                     I+ + +            I+ + L  L+                +  ++T
Sbjct: 164 TI-----ITGIVNDPE----------REITKEALASLNEGGEGDIFDGGDNFDPEKAVST 208

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDF---DIGNCTGGHCRRRVEYLKVVSKILVSDL 227
           GYH IEFLLWGQDL      PG RP+ D+   D  + T  +  RR EYLKVV+++L+ DL
Sbjct: 209 GYHAIEFLLWGQDLND--EAPGERPFQDYLASDDPDATAPNGERRGEYLKVVTELLIDDL 266

Query: 228 EEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQE 284
             ++ AW P   D         D +  L  +++G+  LS  EL  ERM++ L   D E E
Sbjct: 267 SGLVDAWAPDTADNYRASFTGGDPDDALRDVLSGIGVLSKGELGAERMDVALRSLDQEDE 326

Query: 285 IDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFS 344
             CFSDNT+     +  GI + Y G Y       + G SI DL+   +  L  E+   F 
Sbjct: 327 HSCFSDNTHVDIAMNAQGIQNVYLGRY-----SYLSGPSISDLVRQEDPALDAEMRAAFE 381

Query: 345 NTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
            ++     +         FDQ I     EG  +V   +N L  Q+E++ ++  AL L  
Sbjct: 382 KSLAAVQAIP------VPFDQNIDAQGSEGWNLVNEAVNALFDQSETIIEVGEALGLGN 434


>gi|326318038|ref|YP_004235710.1| peptidase M75, Imelysin [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323374874|gb|ADX47143.1| Peptidase M75, Imelysin [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 409

 Score =  394 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 122/401 (30%), Positives = 197/401 (49%), Gaps = 37/401 (9%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           +         + +   V  +YA + HA YED L  ART+ +AI+     P+ + L  AR 
Sbjct: 38  VAQAGGKQATSATPAAVAAHYAVLVHANYEDTLNAARTMQAAIKAFTARPSAETLAEARK 97

Query: 73  QWIRARIPYQQSEVYRFGNKIVDT---WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
            W+ AR  Y Q+E +RF    +D     + ++NAWP+DE    YVDS  G+ +       
Sbjct: 98  TWLAAREFYGQTEAFRFYGGPIDDDKGPEGQLNAWPMDES---YVDSVEGRPDSG----- 149

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
                    +VN+++     I+   L   +   G + N+ TG+H IEF LWGQDL     
Sbjct: 150 ---------LVNDRKF---AITKKNLAAQNERGG-EENVATGWHAIEFFLWGQDLSET-- 194

Query: 190 EPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKD 247
            PG+R + DF  G   G +  RR +YL VV+ +L+ DL  ++KAW P          +K 
Sbjct: 195 GPGDRNFEDFVDGK--GRNADRRRQYLNVVTDLLIDDLASLVKAWDPKTPNNYRAKFVKG 252

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSY 307
               +  ++ G+ SLS  ELAGER+ + L   D E E  CFSDNT+   + + +GI + +
Sbjct: 253 GQESVRKMLVGLGSLSRGELAGERLEVALNSQDQEDEHSCFSDNTHRDAVTNALGIRNVW 312

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD-QM 366
            GEY R +G  + GAS+ DL++  +  LA     + + ++K    ++        FD ++
Sbjct: 313 LGEYRRADGSLVQGASLRDLVAAKDAALADRTTQQIAASVKAAEGIQA------PFDREI 366

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRV 407
           I   +  G   ++  I+ L  Q++ L +   A+ + +   V
Sbjct: 367 IGGKDAPGRLRIQKTIDSLTQQSKDLVEAANAIGITKLTLV 407


>gi|124007535|ref|ZP_01692240.1| insulin-cleaving metalloproteinase outer membrane protein
           [Microscilla marina ATCC 23134]
 gi|123987018|gb|EAY26774.1| insulin-cleaving metalloproteinase outer membrane protein
           [Microscilla marina ATCC 23134]
          Length = 392

 Score =  393 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 129/410 (31%), Positives = 184/410 (44%), Gaps = 42/410 (10%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           + F+ +++                 + +VL+ YA IAH  Y D+      L ++I+  V 
Sbjct: 10  LVFVMLLNACKKKEETTPPTPDATQVAEVLETYAKIAHQSYSDSYDKVVALKTSIDAFVA 69

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD----TWDKKVNAWPLDEGFIDYVDS 116
            P++   + A+  W  AR PY Q+EV+RF    +D      +  +NAWPLDE FIDYV  
Sbjct: 70  NPDQAKFDAAKQAWKDAREPYGQTEVFRFYEGPIDNSATGPEGAINAWPLDENFIDYVAG 129

Query: 117 SYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIE 176
           +           TA II +              I    LR  +   G + NI+ GYH IE
Sbjct: 130 N----------ATAGIINDLT----------QTIDAATLRGNNEKGG-EKNISIGYHAIE 168

Query: 177 FLLWGQDLK--TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW 234
           FLLWGQD     +    G R +TD+     T  +  RR  YL V   +L+ DL+ +  AW
Sbjct: 169 FLLWGQDTNPGGDYSNAGQRAFTDY----TTATNADRRKTYLHVTIDLLLEDLKTVRDAW 224

Query: 235 GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYA 294
                     + D N  +  I+TGM SLS  ELAGERM + L  HD E E  CFSDNT+ 
Sbjct: 225 AEGASYRTSFVADGNKSIVRILTGMGSLSEAELAGERMKVALFNHDQEDEHSCFSDNTHR 284

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
             + +  GI + Y G Y       + G  I  L+   ++ L  +I  +   T      ++
Sbjct: 285 DIVTNAQGIYNVYWGTYGS-----VTGKGIASLVEVVDKELYAQIKTELEATKAATLAIQ 339

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEP 404
                   FD+ IS+ N  GN+ V   I  L  QT S+  I   L+L   
Sbjct: 340 A------PFDKEISQGNTAGNQRVEVAITALRAQTRSIESIAQKLNLGNL 383


>gi|124266651|ref|YP_001020655.1| iron-regulated protein A [Methylibium petroleiphilum PM1]
 gi|124259426|gb|ABM94420.1| iron-regulated protein A, putative [Methylibium petroleiphilum PM1]
          Length = 399

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 121/382 (31%), Positives = 192/382 (50%), Gaps = 37/382 (9%)

Query: 32  NYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGN 91
           +YA + HA YED+L  AR L  A+   V TP+ + L  AR +W+ AR  Y Q+E +RF  
Sbjct: 47  HYAVLVHANYEDSLQAARALQQAVVAFVATPSAEALAEARKRWLAAREFYGQTEAFRFYG 106

Query: 92  KIVDT---WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
             +D     + ++NAWP+DE F+D V    G          + +I N K ++++K     
Sbjct: 107 GPIDDDKGPEGRINAWPMDESFVDGVQGKPG----------SGLIGNRKFVISKKN---- 152

Query: 149 IISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGH 208
                 L   +   G + NI TG+H IEFLLWGQD       PG+R + DF  G     +
Sbjct: 153 ------LAAQNERGG-EENIATGWHAIEFLLWGQDRSET--GPGDRSFEDFVDGKAP--N 201

Query: 209 CRRRVEYLKVVSKILVSDLEEMMKAWGP--DGQATKDLMKDINAGLNSIITGMTSLSYNE 266
             RR +YL VV+++L+ DL  ++KAW P   G       +     +  I+ G+ SLS  E
Sbjct: 202 ADRRRQYLTVVTELLIDDLAGLVKAWAPATKGNYRARFEQGGKESVRKILVGLGSLSRGE 261

Query: 267 LAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD 326
           LAGER+ + L   D E E  CFSDNT+   +N+  GI + + G Y+R +G  + GAS+ +
Sbjct: 262 LAGERLEVALNSQDQEDEHSCFSDNTHRDAVNNAKGIENVWLGRYVRADGSTLQGASLRE 321

Query: 327 LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI-SENNPEGNKIVRNLINDL 385
           L++  +  LA+    + + ++     ++        FD+ I    +  G + ++  I  L
Sbjct: 322 LVAEKDAALAERGTRQIAASVAAAEAIQA------PFDREIVGAKDAPGRQRIQKTIASL 375

Query: 386 ITQTESLRKIRIALDLIEPNRV 407
             Q++ L     A+ + +   V
Sbjct: 376 TQQSKDLVAAANAVGITKLTLV 397


>gi|93006910|ref|YP_581347.1| hypothetical protein Pcryo_2086 [Psychrobacter cryohalolentis K5]
 gi|92394588|gb|ABE75863.1| imelysin. Metallo peptidase. MEROPS family M75 [Psychrobacter
           cryohalolentis K5]
          Length = 482

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 142/442 (32%), Positives = 218/442 (49%), Gaps = 42/442 (9%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           +       S   S      ++++L +YA +AHA Y+D+L  A+ L SA+ T V TP + N
Sbjct: 43  VETAEKTASKTSSAADKAHMDRLLISYADMAHAAYKDSLEMAKLLQSAVNTYVETPTQAN 102

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIV-----------DTWDKKVNAWPLDEGFIDYVD 115
           L+ A+  +  AR PY Q+EV+RF    V           D+W+ +VNAWPLDE  IDYV 
Sbjct: 103 LDAAKAAYKAARQPYSQTEVFRFDEGFVTANDNRNIGSTDSWEGQVNAWPLDEALIDYVS 162

Query: 116 SSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVI 175
           + Y  E    +    NII +  I V   + D S I+P+LL +++   G ++N+TTGYH I
Sbjct: 163 ADYEGEYNSKD----NIINSDSISVGSLKQDTSTITPELLAEMNEIGGSESNVTTGYHAI 218

Query: 176 EFLLWGQDLKTNVREPGNRPYTDFD--IGNCTGGH--------CRRRVEYLKVVSKILVS 225
           EF+LWGQD        GNRP++D+    G CT G         C RR +YLK  +++LV 
Sbjct: 219 EFMLWGQDTNGVAEGAGNRPFSDYLMTDGQCTSGESVNPEASICERRGQYLKAATQLLVD 278

Query: 226 DLEEMMKAWGPDGQAT---KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPE 282
           DL  M   W PD + T     + +  +  L  I+  M SL+  ELA +R+ +  +    E
Sbjct: 279 DLTAMEAQWQPDSENTLRSDMMARRDSNSLRQIMYQMGSLALGELASQRIQVAFVTGSTE 338

Query: 283 QEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD-LISHNNRNLAQEIND 341
            E +CFSD T+ SY N+  GI + + G Y  + G+ + G  + + LI   N   A ++  
Sbjct: 339 DEHECFSDLTHLSYANNARGIQNVFNGSYKTVAGKTVGGYGLKNYLIDTGNTEAADKLAA 398

Query: 342 KFSNTMKDFHILKDRAEN-IESFDQMISE---------NNPEGNKI---VRNLINDLITQ 388
            F+     F+++ ++ E      DQMI+          +  E NK    +   I  L   
Sbjct: 399 DFAKVEAAFNVIVEKGEKENIKIDQMIATVGQASKHGVSAEEQNKRRGWIETSITSLQEL 458

Query: 389 TESLRKIRIALDLIEPNRVIGN 410
           T  +     A+ +   +   G+
Sbjct: 459 TAGIENAAKAVGIDNLDADAGS 480


>gi|332529697|ref|ZP_08405651.1| iron-regulated protein A [Hylemonella gracilis ATCC 19624]
 gi|332040718|gb|EGI77090.1| iron-regulated protein A [Hylemonella gracilis ATCC 19624]
          Length = 418

 Score =  388 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 124/424 (29%), Positives = 205/424 (48%), Gaps = 52/424 (12%)

Query: 4   ITIISIVFTLPSHALS--------IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAI 55
           ++ ++     P+H  +            V+ + V+ +YAT+ HA YED L+ A  L  ++
Sbjct: 25  LSSLNAAAQTPAHTPAGKVETAAAPAAAVTAKTVVAHYATLVHANYEDTLLAALELQKSV 84

Query: 56  ETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT---WDKKVNAWPLDEGFID 112
              +  P++  LE AR  W+ AR  Y Q+E +RF    +D     + ++NAWP+DE ++D
Sbjct: 85  RAFIAAPSQARLEAARKAWLDAREVYGQTEAFRFYGGPIDDEEGPEGRINAWPMDESYVD 144

Query: 113 YVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGY 172
            VD   G          + +I + K            I+   L + +  +G + NI TG+
Sbjct: 145 GVDGKPG----------SGLINDRKF----------KITKASLSEANEKDG-EENIATGW 183

Query: 173 HVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMK 232
           H IEF+LWGQDL  N   PG R +TDF  G     +  RR  YL VV+ +L+ DL  +++
Sbjct: 184 HAIEFMLWGQDLDDN--GPGQRAHTDFVDGKTP--NADRRRLYLNVVTDLLIDDLRFLVQ 239

Query: 233 AWGP-----DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDC 287
           AW P              +  +  +  II G+ SLS  EL+GERM + L   D E E  C
Sbjct: 240 AWTPAKAGAKKNYRVTFEQGGSESVRKIIVGLGSLSRGELSGERMEVALNTQDQEDEHSC 299

Query: 288 FSDNTYASYLNDVIGIISSYTGEYIRMNGEK----IHGASIHDLISHNNRNLAQEINDKF 343
           FSDNT+   + +  GI + + G Y R  G K    + G S+  L++  ++ LA  +  + 
Sbjct: 300 FSDNTHRDIVANATGIQNVWLGSYKRRPGAKGPQTLEGPSLRALVAAKDKALADRVTAQI 359

Query: 344 SNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           + ++ D   +         FD+ I + +P G  +++  I  L+ Q++ L +   A+ + +
Sbjct: 360 AQSVADAERIPA------PFDRAILDGSP-GQPLIKKTIASLVEQSKLLVESASAIGITQ 412

Query: 404 PNRV 407
              V
Sbjct: 413 LTLV 416


>gi|149927624|ref|ZP_01915877.1| iron-regulated protein A, putative [Limnobacter sp. MED105]
 gi|149823678|gb|EDM82906.1| iron-regulated protein A, putative [Limnobacter sp. MED105]
          Length = 389

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 115/406 (28%), Positives = 198/406 (48%), Gaps = 37/406 (9%)

Query: 9   IVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLE 68
           +     +     V   S + V++ Y  + +A Y D+++ A+ L S+I+  +  P++  LE
Sbjct: 14  VAGLALAFCNVAVAAPSDQDVVKGYGQLVYANYTDSVIAAQKLQSSIDAFLKAPSEAGLE 73

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDT---WDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
            A+  W+ AR  Y Q+E +RF    +D     + ++NAWP+DE ++DYV  +        
Sbjct: 74  AAKKAWLNAREFYGQTEAFRFYGGPIDDENGPEGQINAWPMDESYVDYVQGN-------- 125

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
               +  I N +  ++   +                 G + NI TG+H IEFLLWGQDL 
Sbjct: 126 --ARSGFINNPEFKISRDALIEEN-----------ERGGEENIATGWHAIEFLLWGQDLN 172

Query: 186 TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG--QATKD 243
            N   PG RPYTD+  G   G +  RR  YL+ ++ +L+ DL+ +  AW P        +
Sbjct: 173 EN--GPGQRPYTDYVKGK--GQNAERRATYLREITALLIHDLQTVQSAWAPKKPDNFRAN 228

Query: 244 LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
             KD    +  I+ G+ SLS  ELAGER+ + L   D E E  CFSDNT+   + +  GI
Sbjct: 229 FEKDGKESIRKILVGLGSLSRGELAGERLEVALFSQDQEDEHSCFSDNTHRDAVTNAQGI 288

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESF 363
           ++ +TG Y + +G  +   S+ +L+      +A++   +  N++K    ++        F
Sbjct: 289 LNVWTGTYKQADGAVLKVPSLAELVGARAPEVAKKTTQQIQNSVKAASAIQA------PF 342

Query: 364 D-QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVI 408
           D ++I   N  G + V+  ++ L+ Q+  L +   A+ + +    +
Sbjct: 343 DREIIGGANAPGPQRVKATVDSLVEQSTLLVESANAIGITQLTLTL 388


>gi|71066359|ref|YP_265086.1| imelysin [Psychrobacter arcticus 273-4]
 gi|71039344|gb|AAZ19652.1| imelysin. Metallo peptidase. MEROPS family M75 [Psychrobacter
           arcticus 273-4]
          Length = 480

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 141/439 (32%), Positives = 216/439 (49%), Gaps = 42/439 (9%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           T +       S   S      ++++L +YA +AHA Y+DAL  A+ L +A+ T V TP +
Sbjct: 41  TPVETAEKTGSKTSSAAGQAHMDRLLISYADMAHAAYKDALETAKILQTAVNTYVETPTQ 100

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIV-----------DTWDKKVNAWPLDEGFIDY 113
            NL+ A+  +  AR PY Q+EV+RF    V           D+W+ +VNAWPLDE  IDY
Sbjct: 101 ANLDAAKAAYKAARQPYSQTEVFRFDEGFVTANEQRKIASTDSWEGQVNAWPLDEALIDY 160

Query: 114 VDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYH 173
           V ++Y  +    +    NII +  I V   + D S I+P+LL ++    G + N+TTGYH
Sbjct: 161 VSTNYEGKYNSQD----NIINSDSITVGSIKQDTSTITPELLAEMTEIGGSEANVTTGYH 216

Query: 174 VIEFLLWGQDLKTNVREPGNRPYTDFD--IGNCTGGH--------CRRRVEYLKVVSKIL 223
            IEF+LWGQD        GNRP++D+    G CT G         C RR +YLK  +++L
Sbjct: 217 AIEFMLWGQDTNGVAEGAGNRPFSDYLTTDGQCTSGESKNPEASVCERRGQYLKAATQLL 276

Query: 224 VSDLEEMMKAWGPDGQAT---KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHD 280
           V DL  M   W PD + T     + +     L+ I+  M SL+  ELA +R+ +  +   
Sbjct: 277 VDDLTAMEAEWQPDSENTLRSDIMARKDKNSLHQIMYQMGSLALGELASDRIQVAFVTGS 336

Query: 281 PEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD-LISHNNRNLAQEI 339
            E E +CFSD T+ SY N+  GI + + G+Y  + G+ I G  + + L+   N   A ++
Sbjct: 337 TEDEHECFSDLTHLSYANNARGIQNVFNGDYKTVAGKTIGGYGLKNYLVDTGNTEAADKL 396

Query: 340 NDKFSNTMKDFHILKDRAEN-IESFDQMISE---------NNPEGNKI---VRNLINDLI 386
              F+     F+++ ++ E      DQMI+             E NK    +   I  L 
Sbjct: 397 AADFAKVEAAFNVIVEKGEKENIKIDQMIATVGQGIKQGVTAEEQNKRRGWIETSITSLQ 456

Query: 387 TQTESLRKIRIALDLIEPN 405
             T  +     A+ +   +
Sbjct: 457 ELTAGIENAAKAVGIDNLD 475


>gi|332968652|gb|EGK07705.1| iron-regulated protein A [Psychrobacter sp. 1501(2011)]
          Length = 484

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 145/433 (33%), Positives = 214/433 (49%), Gaps = 41/433 (9%)

Query: 15  SHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
             A       S+ K+L NYA +A A YED+L  A+ L  A++  +  P + NLE AR  +
Sbjct: 54  GTATVAGDEASVNKLLTNYADMAQAAYEDSLTEAKKLQQAVDVFIADPTEANLEAARAAY 113

Query: 75  IRARIPYQQSEVYRFGNK-----------IVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
             AR PY Q+E++RF               VD W+ +VNAWPLDE  IDYV   Y  E  
Sbjct: 114 KAARQPYSQTEIFRFDEGFVTANDKRALGSVDGWEGQVNAWPLDEALIDYVSEGYAGEYN 173

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
             +    NII +  I V   E D   I+PDLL +++   G + N+TTGYH IEFLLWGQD
Sbjct: 174 SKD----NIINSDHITVGSVEQDTKNITPDLLAEMNEIGGSEANVTTGYHAIEFLLWGQD 229

Query: 184 LKTNVREPGNRPYTDFDIGN-CTGGH--------CRRRVEYLKVVSKILVSDLEEMMKAW 234
                   GNRP TD+     CT G         C +R +YLK  +++LV+DL  M+  W
Sbjct: 230 NNGTAEGAGNRPVTDYMTNEQCTSGEGNTVDASVCAKRGQYLKAATQLLVNDLTTMVAEW 289

Query: 235 GPDGQAT---KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDN 291
            P+ + T     + +  N  +  +   M SL+  ELA ERM +  +    E E +CFSD 
Sbjct: 290 QPNSENTLRSDLMARSSNNAVRQLFYQMGSLALGELASERMQVAFVTGSTEDEHECFSDL 349

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD-LISHNNRNLAQEINDKFSNTMKDF 350
           T+ SY N+  GI + + G+Y  ++G  +    I   LI    +  A ++  +F+   K F
Sbjct: 350 THLSYANNARGIDNVFKGQYKTVSGSTVGNYGIKQFLIDAGQQEAADKLEAEFNKVEKSF 409

Query: 351 HILKDRAE-NIESFDQMISE---------NNPEGNKI---VRNLINDLITQTESLRKIRI 397
             + ++ E N    DQMI+          +  E NK    V + INDL + T+++     
Sbjct: 410 DTIVEQGEKNGIKVDQMIATVGQASKHNVSAEEQNKRRGWVESAINDLKSLTDAIEYSAK 469

Query: 398 ALDLIEPNRVIGN 410
           ++ +   +   G+
Sbjct: 470 SIGIENLDADTGS 482


>gi|313676340|ref|YP_004054336.1| peptidase m75, imelysin [Marivirga tractuosa DSM 4126]
 gi|312943038|gb|ADR22228.1| Peptidase M75, Imelysin [Marivirga tractuosa DSM 4126]
          Length = 386

 Score =  385 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 125/402 (31%), Positives = 190/402 (47%), Gaps = 33/402 (8%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            +  ++  L   + S    +S ++V++NYA I +A Y DA   A  L   I+     P++
Sbjct: 4   ALSIVILVLFLFSCSTKQEISKKEVVENYANIVYANYLDAHEHALALRREIKHFTENPSQ 63

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDT---WDKKVNAWPLDEGFIDYVDSSYGKE 121
              +  +  W+  R  Y Q+E +RF    +D     + ++NAWPLDE +IDYV S     
Sbjct: 64  NGFDRTKEAWLLTRESYGQTEAFRFYGGPIDGENGPEGQLNAWPLDEAYIDYVAS----- 118

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
                   ANII + +            I+ D +  ++   G +TN+++GYH IEFLLWG
Sbjct: 119 ----ENNNANIINSPET--------FPEITADFIASMNE-KGSETNVSSGYHAIEFLLWG 165

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG-Q 239
           QDL       G R YTD+  G   T  +  RR  YL   + +LVSDL+ +M+ W P+   
Sbjct: 166 QDLSD-GPGAGERKYTDYIDGEEATAKNANRRKTYLLETANLLVSDLKSVMEEWAPNQQN 224

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
                + + +  +  I++G+  LS  ELAGERM +   L   E E  CFSDNT+   + +
Sbjct: 225 YRATFISNPDQSIEKIVSGLGKLSKGELAGERMFVAYDLRSKEDEHSCFSDNTHRDIVAN 284

Query: 300 VIGIISSYTGEYIRM-NGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
             GI + Y G+Y    N   I G SI+DL+      LA+E+    +N + D   ++    
Sbjct: 285 ATGIQNVYLGKYKTFRNDSTISGPSIYDLVKQQEEALAEELKQTIANGLADSKKIEA--- 341

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
               FDQ I   N EG K +   I+    Q + L        
Sbjct: 342 ---PFDQQI--KNEEGRKQIAKTISLFRKQGDLLAASASKFG 378


>gi|254448122|ref|ZP_05061585.1| insulin-cleaving metalloproteinase outer membrane protein [gamma
           proteobacterium HTCC5015]
 gi|198262248|gb|EDY86530.1| insulin-cleaving metalloproteinase outer membrane protein [gamma
           proteobacterium HTCC5015]
          Length = 462

 Score =  385 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 146/450 (32%), Positives = 223/450 (49%), Gaps = 50/450 (11%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +S+         +      ++ +L N A++A+A Y D++  A+ L SAIETLV  P 
Sbjct: 8   LVALSLAVLSACSPSAEEKKAEIQAILSNDASMAYAAYSDSVTTAQQLQSAIETLVKAPT 67

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVD-------------TWDKKVNAWPLDEGF 110
             +L  A+  WI+AR PY Q+EVYRF    +D               + ++NAWPL E  
Sbjct: 68  DTHLSEAKSAWIKAREPYGQTEVYRFREGPIDALKGDGTLGTEGDGPEGEINAWPLGEAL 127

Query: 111 IDYVDSSY----GKENEEN-NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGID 165
           IDYV ++     G ++ EN     A+IIA++ I +N +++D +I   + L     ANG +
Sbjct: 128 IDYVAATPPIADGVDHAENFPAVNASIIADTSIPLNGEDLDSTI---ETLAAFQEANGDE 184

Query: 166 TNITTGYHVIEFLLWGQDLKTN--------VREPGNRPYTDFDIGN-CT----------G 206
            N+ TGYH IEFLLWGQDL              PG RP +D+     CT          G
Sbjct: 185 ANVATGYHAIEFLLWGQDLNQGQAQWGKQRDNSPGQRPVSDYAQNEQCTVDAQGNTDSSG 244

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNE 266
             C+RR  YL+ V++ LV DL  +  AW P     +  +      L S++  M  LS+ E
Sbjct: 245 KICQRRAIYLRAVAQKLVDDLSRVRDAWAPQSPLRQQYIDGGKHSLASVLESMGRLSFGE 304

Query: 267 LAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR----MNGEKIHGA 322
           LAGER+N+ L     E E  CFSDNT+   L +  GI +SY G+Y       +   + G 
Sbjct: 305 LAGERINIALTQDSQEDEHSCFSDNTHRDILLNAKGIQNSYLGQYGNTTLYTDATAVSGD 364

Query: 323 SIHDLISHN-NRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN-----NPEGNK 376
           SI  L+    +  LA+++    ++T      +   A++   FDQ I+       +P+ N+
Sbjct: 365 SIDALLRKRGHTELAKQLKGALAHTQSLAQAIDQTAQSGTPFDQQIAGGEIDPKHPKANQ 424

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPNR 406
            +R+LI  L+ QTE + +   AL+L   + 
Sbjct: 425 TIRDLIQALVAQTELIEQAIAALELTADDL 454


>gi|148653942|ref|YP_001281035.1| hypothetical protein PsycPRwf_2145 [Psychrobacter sp. PRwf-1]
 gi|148573026|gb|ABQ95085.1| Uncharacterized iron-regulated protein-like protein [Psychrobacter
           sp. PRwf-1]
          Length = 486

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 143/428 (33%), Positives = 218/428 (50%), Gaps = 41/428 (9%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
                S+ K+L +YA +A A YED+L  A+ L +A++ LV  P ++NLE A+  +  AR 
Sbjct: 61  AGDEASVNKLLTSYADMAQAAYEDSLSEAKKLQAAVDALVANPTQQNLEAAQAAYKAARQ 120

Query: 80  PYQQSEVYRFGNK-----------IVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
           PY Q+EV+RF               +D W+ +VNAWPLDE  IDYV   Y  E    +  
Sbjct: 121 PYSQTEVFRFDEGFVGKDDKRAIGSIDGWEGQVNAWPLDEALIDYVADGYAGEYNSKD-- 178

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
             NII + KI V     D   I+P+LL +++   G + N+TTGYH IEFLLWGQDL    
Sbjct: 179 --NIINSDKITVGSTSQDTKTITPELLAEMNEIGGSEANVTTGYHAIEFLLWGQDLNGVG 236

Query: 189 REPGNRPYTDFDIGN-CTGGH--------CRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
              G RP TD+   + CT G         C +R EYLK  +++LV+DL +M+  W P+ +
Sbjct: 237 EGAGQRPVTDYMANDSCTSGEGNSAEAAVCAKRGEYLKAATQLLVNDLTDMVAQWQPNTE 296

Query: 240 AT---KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASY 296
            T     + +  +  +  I   M SL+  ELA ERM +  +    E E +CFSD T+ SY
Sbjct: 297 NTLRSDLMARSSDNAVRQIFYQMGSLALGELASERMQVAFVTGSTEDEHECFSDLTHLSY 356

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHD-LISHNNRNLAQEINDKFSNTMKDFHILKD 355
            N+  GI + + G+Y  ++G  +    I   LI    ++ A++++  F      F+ + +
Sbjct: 357 ANNARGIANIFNGQYKTVSGSTVGDYGIKQYLIDAGQKDSAEQLDAAFKKVEASFNTIAE 416

Query: 356 RAE-NIESFDQMISE---------NNPEGNKI---VRNLINDLITQTESLRKIRIALDLI 402
           + E N    DQMI+          +  E NK    + + INDL + T+ L     ++ + 
Sbjct: 417 QGEKNGIKIDQMIATVGQATKQGVSAEEQNKRRGWMESAINDLKSLTDVLESSAKSIGID 476

Query: 403 EPNRVIGN 410
             +   G+
Sbjct: 477 NLDADTGS 484


>gi|218515129|ref|ZP_03511969.1| hypothetical protein Retl8_16281 [Rhizobium etli 8C-3]
          Length = 293

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 141/274 (51%), Positives = 191/274 (69%), Gaps = 1/274 (0%)

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
           AN+IAN  I ++ K++D S ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL    
Sbjct: 2   ANVIANKTIKIDGKDVDASKLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTG 61

Query: 189 REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDI 248
              GNR  TD+D+ NCT G+C RR EYLK  S +LVSDL+EM   W PDG A K++  D 
Sbjct: 62  PGAGNRLATDYDLKNCTHGNCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAAAKNVEADP 121

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
            AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YT
Sbjct: 122 KAGLVAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYT 181

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
           G Y R++G K+ G S+HDL++  ++ L  E+  K + T+   + +  R E +E +DQMI+
Sbjct: 182 GNYTRVDGTKLSGPSLHDLVAAKDKALDAELEGKLNKTLDAMNAMAKRGETVEKYDQMIA 241

Query: 369 ENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
           E N +GN +V+  ++ LI QT+S++++  ALDL 
Sbjct: 242 EGNKDGNAVVQAAVDGLIDQTKSIQRVIAALDLG 275


>gi|120610605|ref|YP_970283.1| putative iron-regulated protein [Acidovorax citrulli AAC00-1]
 gi|120589069|gb|ABM32509.1| putative iron-regulated protein [Acidovorax citrulli AAC00-1]
          Length = 407

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 114/382 (29%), Positives = 188/382 (49%), Gaps = 37/382 (9%)

Query: 32  NYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGN 91
           +YA + HA Y DAL  A+T+ +AI      P+ + L  AR  W+ AR  Y Q+E +RF  
Sbjct: 55  HYAVLVHANYADALAAAKTMQAAIRAFTAKPSAETLAEARKTWLAAREFYGQTEAFRFYG 114

Query: 92  KIVDT---WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
             +D     + ++NAWP+DE ++D V+              A ++ + K           
Sbjct: 115 GPIDDDKGPEGQINAWPMDESYVDSVEGRP----------DAGLVNDRKFA--------- 155

Query: 149 IISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGH 208
            I+   L   +   G + N+ TG+H IEF LWGQDL      PG+R   DF  G   G +
Sbjct: 156 -ITKKNLAAQNERGG-EENVATGWHAIEFFLWGQDLSET--GPGDRNVDDFVDGK--GKN 209

Query: 209 CRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDINAGLNSIITGMTSLSYNE 266
             RR +YL VV+ +L+ DL  +++AW P          ++     +  ++ G+ SLS  E
Sbjct: 210 ADRRRQYLNVVTDLLIDDLSFLVQAWDPKVPNNYRAKFVRGGQESVRKMLVGLGSLSRGE 269

Query: 267 LAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD 326
           LAGER+ + L   D E E  CFSDNT+   + + +GI + + GEY R +G  + GAS+ D
Sbjct: 270 LAGERLEVALNSQDQEDEHSCFSDNTHRDAVTNALGIRNVWLGEYKRADGSLVKGASLRD 329

Query: 327 LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD-QMISENNPEGNKIVRNLINDL 385
           L++  +  LA     + + +++    ++        FD ++I   +  G   ++  I+ L
Sbjct: 330 LVAAKDAALAGRTTRQIAASVEAAEGIQA------PFDREIIGGKDAPGRLRIQKTIDSL 383

Query: 386 ITQTESLRKIRIALDLIEPNRV 407
             Q++ L +   A+ + +   V
Sbjct: 384 TQQSKDLVEAANAIGITKLTLV 405


>gi|121729789|ref|ZP_01682225.1| anthranilate synthase component II [Vibrio cholerae V52]
 gi|121628464|gb|EAX60954.1| anthranilate synthase component II [Vibrio cholerae V52]
          Length = 289

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 118/286 (41%), Positives = 165/286 (57%), Gaps = 5/286 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQ 283
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTED 289


>gi|88859144|ref|ZP_01133785.1| hypothetical protein PTD2_09069 [Pseudoalteromonas tunicata D2]
 gi|88819370|gb|EAR29184.1| hypothetical protein PTD2_09069 [Pseudoalteromonas tunicata D2]
          Length = 475

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 134/425 (31%), Positives = 202/425 (47%), Gaps = 52/425 (12%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V+ + V++  A  A+A Y D+L+ A+ L   +   V  P+ ++   A+  W+ AR PY Q
Sbjct: 52  VTTQDVIKTNAQHAYAVYADSLIAAKALKEQLAIFVANPSDESFSLAKKAWLAAREPYGQ 111

Query: 84  SEVYRFGNKIVDTW----------------DKKVNAWPLDEGFIDYVDSSYGKENEENN- 126
           SEV+RF    +D                  +  +NAWPL E  IDY     G +N EN  
Sbjct: 112 SEVFRFREGPIDNLTQDAAGNWVLAPEAGPEGAINAWPLAEALIDYTQDMDGLQNPENPS 171

Query: 127 --LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
                 NIIA+             +I    ++        + N+T+GYH IEFLLWGQDL
Sbjct: 172 TLPAGGNIIADID--------SFPVIDKATIQAQFERGDDEANVTSGYHAIEFLLWGQDL 223

Query: 185 KTNVR-------EPGNRPYTDF-----DIGNCTGGH-------CRRRVEYLKVVSKILVS 225
             +           G R  +DF      +G CT G        C RR +YL   + +L+ 
Sbjct: 224 NADGTYTANRDYSAGYRKASDFYTVGNQMGQCTSGEAGAANVICIRRSQYLLAAADLLID 283

Query: 226 DLEEMMKAWGPD-GQATKDLMKDI--NAGLNSIITGMTSLSYNELAGERMNLGLILHDPE 282
           DL+ ++ AW P  G   +  +K+      L  I+ GM  LSY ELAGERM++ L     E
Sbjct: 284 DLKSVVDAWTPGTGFHYQAFIKEETQKQSLAKILEGMGRLSYGELAGERMSIALRTDSQE 343

Query: 283 QEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD-LISHNNRNLAQEIND 341
            E  CFSDNT+     +  GI +++ G+Y+R +GE + GASI++ L+      LA ++  
Sbjct: 344 DEHSCFSDNTHRDIFLNAKGIQNTFNGQYVRFDGEVLQGASIYNLLVVAGKPELANKLRG 403

Query: 342 KFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
              +TM    ++   A+   SFD  I +  PE    V N I  L TQT+ ++++  AL +
Sbjct: 404 ALEDTMAKAAVIDTTAKLGYSFDVQIQQ--PELKGAVTNTIEALKTQTQVIKEVIEALGV 461

Query: 402 IEPNR 406
              + 
Sbjct: 462 TTGDL 466


>gi|121605456|ref|YP_982785.1| putative iron-regulated protein [Polaromonas naphthalenivorans CJ2]
 gi|120594425|gb|ABM37864.1| putative iron-regulated protein [Polaromonas naphthalenivorans CJ2]
          Length = 400

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 123/410 (30%), Positives = 193/410 (47%), Gaps = 39/410 (9%)

Query: 1   MYFITIISIVFTLPSHALSIVPN--VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETL 58
           ++  +  ++  T P+ A    P   VS   V  +YA +  A Y D L  A+T+  AI+  
Sbjct: 13  LFPASQTAMAQTAPAPAGVTAPAGAVSFNAVASHYAALVEASYADTLTAAKTMQQAIDAF 72

Query: 59  VTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT---WDKKVNAWPLDEGFIDYVD 115
             +P+  +L  AR  W+ AR  Y Q+E +RF    +D     + ++NAWP+DE ++D V+
Sbjct: 73  AKSPSADSLAAARKAWLAAREFYGQTEAFRFYGGPIDDANGPEGRINAWPMDESYVDGVN 132

Query: 116 SSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVI 175
           S  G          + +I   K            IS   L   +   G + NI TG+H I
Sbjct: 133 SKPG----------SGLINKRKFA----------ISKKALAAQNERGG-EENIATGWHAI 171

Query: 176 EFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG 235
           EFLLWGQD+      PG+R + DF  G     +  RR +YL  V+++LV DL  + K W 
Sbjct: 172 EFLLWGQDVSET--GPGDRSFEDFVDGKKP--NADRRRQYLTTVTELLVDDLSGVAKQWA 227

Query: 236 PD--GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTY 293
           P           K     +  I+ G+ SLS  ELAGER+ + L   D E E  CFSDNT+
Sbjct: 228 PGVKTNYRAKFEKGGQESVRKILLGLGSLSRGELAGERLEVALNSQDQEDEHSCFSDNTH 287

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
              +N+  GI + + GEY R +   + GAS+ DL++  +  LA+    + + ++     +
Sbjct: 288 RDVVNNARGIQNVWLGEYKRADDSVLKGASLRDLVAVKDAGLAERTTKQITGSVVAAEGI 347

Query: 354 KDRAENIESFDQMI-SENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
           +        FD+ I    +  G   ++  I  L  Q++ L     A+ + 
Sbjct: 348 QA------PFDREIVGAKDAAGRLRIQKTIASLTQQSKDLAASAKAVGIT 391


>gi|149921138|ref|ZP_01909596.1| hypothetical protein PPSIR1_24909 [Plesiocystis pacifica SIR-1]
 gi|149818025|gb|EDM77484.1| hypothetical protein PPSIR1_24909 [Plesiocystis pacifica SIR-1]
          Length = 375

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 131/398 (32%), Positives = 202/398 (50%), Gaps = 44/398 (11%)

Query: 10  VFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
             +    + + +    +  V +NYA I  A Y DA M A  L +AI+T V  P++ NL  
Sbjct: 11  ACSTDEPSDTPLSADEVAPVAENYADIVAANYADARMTAEALATAIDTFVGDPSEANLTA 70

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIV----DTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
           AR  W+ AR PY Q+EV+RF +  +    D  + ++NAWP+DE +IDYVD          
Sbjct: 71  AREAWLAAREPYGQTEVFRFYDGPIDNPTDGPEGQLNAWPMDEAYIDYVDG--------- 121

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
            +  A II +              I+P+LL +L+ A G +TNI++GYH +EFLLWGQDL 
Sbjct: 122 -MPDAGIINDLATY--------PDITPELLAELNEAGG-ETNISSGYHAVEFLLWGQDL- 170

Query: 186 TNVREPGNRPYTDFD-IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
            +   PG RP TD+   GN T  +  RR  YL+    +L+ DLE +  AW   G      
Sbjct: 171 -SADGPGARPATDYLTDGNGTAMNQDRRAAYLQAAVTLLIEDLEGLETAWA--GSYRDSF 227

Query: 245 M-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           + +     +  I+ GM SLS  ELAGERM + L   + E E  CFSDNT+   + + +GI
Sbjct: 228 VGEAPEEIVRRILLGMGSLSGAELAGERMEVALETQEQEDEHSCFSDNTHRDVVTNALGI 287

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESF 363
            + Y G Y  ++     G S++DL++  + +LA  + D+ + ++     +         F
Sbjct: 288 QNVYLGRYGALD-----GQSVYDLVAARDADLADRLRDEIAASVSAAEAIPA------PF 336

Query: 364 DQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           D+ I ++     + V+  I+ L  Q +S+       D+
Sbjct: 337 DRAIVDD----VESVQATIDALRVQADSIADAAALFDI 370


>gi|88803059|ref|ZP_01118586.1| hypothetical protein PI23P_10715 [Polaribacter irgensii 23-P]
 gi|88781917|gb|EAR13095.1| hypothetical protein PI23P_10715 [Polaribacter irgensii 23-P]
          Length = 413

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 115/388 (29%), Positives = 190/388 (48%), Gaps = 25/388 (6%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           +I   V  ++ + NY  I  A Y DAL     L +A++T V TPN+   + A+  W+ +R
Sbjct: 35  TIAIEVKKKEFVTNYTNIVFASYADALNKLNELKTAVDTFVATPNENTFQTAKDTWLASR 94

Query: 79  IPYQQSEVYRFGNKIVDTWDKK----VNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
            PY Q+E YRF +  +D  + +    +NAWPLDE  IDYV +  G ++  ++    NII 
Sbjct: 95  EPYGQTEAYRFYDGPIDGGEGEPEGYINAWPLDEALIDYVTTGTGGQDLSDDRQ--NIIN 152

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD-LKTNVREPGN 193
           N +   +        ++ + L++L   +  ++N+T G+H IEFLLWGQD  + + +  G 
Sbjct: 153 NKEKYPS--------LTKETLKELSGYDSNESNVTVGFHAIEFLLWGQDNTQPSEKMAGQ 204

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK-DINAGL 252
           R  TDF     T  +  RR EYL  V+ +LV D++ ++  W P    +   +    +  +
Sbjct: 205 RALTDF----TTATNAVRRGEYLVAVTALLVDDVKSVVDQWKPGASYSSSFLAMSSDDAI 260

Query: 253 NSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYI 312
             I+TG   LS  ELAGERM + +   + E E  CFSDNT+     +   I +   G Y 
Sbjct: 261 TKILTGAAKLSKGELAGERMAVAVENQNQEDEHSCFSDNTHRDVYLNAKSIDNIIHGSYK 320

Query: 313 RMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD-QMISENN 371
             +G  + G S+ D+++  N + A  +    S  M    ++         FD Q++ E  
Sbjct: 321 NTDGSIVSGTSLLDILALVNNDEATALTATASEVMNKVTVIFTIG----YFDNQLMDETL 376

Query: 372 PEGNKIVRNLINDLITQTESLRKIRIAL 399
              N  + + +  L  Q + L +   ++
Sbjct: 377 DNFNNPIMSAVLTLRKQGDELAQAGKSI 404


>gi|119944460|ref|YP_942140.1| uncharacterized iron-regulated protein [Psychromonas ingrahamii 37]
 gi|119863064|gb|ABM02541.1| uncharacterized iron-regulated protein [Psychromonas ingrahamii 37]
          Length = 429

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 133/426 (31%), Positives = 200/426 (46%), Gaps = 46/426 (10%)

Query: 2   YFITIISIVFT-LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +F +     F     H  +    VS  +V  NY  +A+A YED+L  A  L + I  L+ 
Sbjct: 14  FFCSTAFAAFADKAEHRSASSTQVSESEVKANYVKMAYAAYEDSLNSALYLQNNIGKLLA 73

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRF--------------GNKIVDTWDKKVNAWPL 106
           +P++  L  A+  +  ARIPYQQ+E+ R+              G   VD W+ +VNAWPL
Sbjct: 74  SPSEGQLLQAKAAYKLARIPYQQTEIMRWDTDITITAELDKDGGPASVDQWEGQVNAWPL 133

Query: 107 DEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDT 166
           DE  IDYV  +            A II                I+PD L   +   G + 
Sbjct: 134 DEQAIDYVQGN----------ANAGIINKKN---------GPAINPDYLIAQNGMGG-EA 173

Query: 167 NITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI---GNCTGGHCRRRVEYLKVVSKIL 223
           N+TTG+H IEFLLWGQDL       G R   DF     G C+  +C RR  YL+  S++L
Sbjct: 174 NVTTGFHAIEFLLWGQDLNGTNAGAGQRNVNDFQTDLSGKCSVNNCDRRRTYLQAASQLL 233

Query: 224 VSDLEEMMKAWGPDGQATKDLMK----DINAGLNSIITGMTSLSYNELAGERMNLGLILH 279
           V+DL EM   W       +  +       + G+  I+  M S++ +ELA  RMN GL   
Sbjct: 234 VADLREMRDQWSATASRQQGTLAYNFLASDDGIRYILFAMKSMATDELASARMNEGLDGL 293

Query: 280 DPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEI 339
           DPEQE DCFSD ++ +   +   I +++ G Y    G+ + GAS+ D I   +  + ++ 
Sbjct: 294 DPEQEHDCFSDLSHLAIYYNFQAIRNAFYGGYQNTMGQYVSGASLGDYIHQQSPAIFKQF 353

Query: 340 NDKFSNTMKDFHILKDRAENIES---FDQMISENNPE-GNKIVRNLINDLITQTESLRKI 395
           +D+F++  K+  I+ D  E I +   FDQ+I +           N +  L+    +   +
Sbjct: 354 DDQFNDIEKNMKIVFDAGERINNPIRFDQIIGQAETAPQRTAAFNAVYQLVDLQFAFNDL 413

Query: 396 RIALDL 401
           +    L
Sbjct: 414 QALFSL 419


>gi|149910670|ref|ZP_01899307.1| uncharacterized iron-regulated protein [Moritella sp. PE36]
 gi|149806297|gb|EDM66273.1| uncharacterized iron-regulated protein [Moritella sp. PE36]
          Length = 425

 Score =  355 bits (910), Expect = 9e-96,   Method: Composition-based stats.
 Identities = 137/411 (33%), Positives = 204/411 (49%), Gaps = 44/411 (10%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
               V+ + V  NY  +AHA Y D+L  A TL + +ETL+  P  +NL+NA+  +  AR+
Sbjct: 30  ATITVTEQDVKDNYIMMAHAAYADSLTTALTLQAKVETLLAAPTVQNLDNAKEAYKLARV 89

Query: 80  PYQQSEVYRF--------------GNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
           PYQQSE+ R+              G   VD W+ +VNAWPLDE  IDYV+ +        
Sbjct: 90  PYQQSEILRWDTDITINAGLDKDGGLNSVDEWEGQVNAWPLDEQAIDYVEGNE------- 142

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
                    NS II  +   D   I+ D L   +   G + N+TTG+H IEFLLWGQDL 
Sbjct: 143 ---------NSGIINQKNGAD---ITIDYLIAQNGVGG-EANVTTGFHAIEFLLWGQDLN 189

Query: 186 TNVREPGNRPYTDFDI---GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
                 G R   DF +   G C+  +C RR +YL VV+++LV DL  M   W      TK
Sbjct: 190 GTKAGAGERSVNDFQMDKSGTCSASNCDRRRDYLNVVTQLLVDDLTAMTAEWTEQAADTK 249

Query: 243 DLMKD----INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
             + +       G+  ++  M +++ +ELA  RMN GL   DPEQE DCFSD ++ +   
Sbjct: 250 GTLANNFKTSADGIRYMLFAMKAMATDELASARMNEGLEGLDPEQEHDCFSDLSHVAIYY 309

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           ++  + + + G Y  ++GEK+ GAS+ D I+  N  L ++ +D  +   K+  ++ +  E
Sbjct: 310 NLQSVRNVFYGSYQTIDGEKVSGASLADFINQQNPALFKQFDDALNAIEKNMLVVYNAGE 369

Query: 359 NIES--FDQMIS-ENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
             E   FDQ+I   ++    K     +  L+    S   +   L L   N 
Sbjct: 370 QAEPIRFDQIIGQADDAPEKKAAYAAVYQLVDLQSSFNSVEELLSLQALNL 420


>gi|110637086|ref|YP_677293.1| imelysin [Cytophaga hutchinsonii ATCC 33406]
 gi|110279767|gb|ABG57953.1| imelysin, Metallo peptidase, MEROPS family M75 [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 410

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 116/421 (27%), Positives = 189/421 (44%), Gaps = 44/421 (10%)

Query: 1   MYFITIISIVFTLPSHA----LSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIE 56
           +Y + I   V T                   KV++NYA I +A Y+DAL+ A+ L +   
Sbjct: 14  LYILAIAIAVTTFSCKKNKEDEPAPSGSEQAKVVENYANIVYATYDDALITAKNLRAKAA 73

Query: 57  TLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT-------WDKKVNAWPLDEG 109
             V +P++  LE  R  +I +R PY QSE +RF +  +D         +  +N+WPL+E 
Sbjct: 74  DFVASPSEAGLEEVRAAYIASRTPYIQSEAFRFYSGPIDQDLGGGLTIESSINSWPLEEV 133

Query: 110 FIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNIT 169
           +IDYV               A II +   + +   ID ++I    L    +    + +++
Sbjct: 134 YIDYVVGD----------ANAGIIND---VAHFPTIDKNVI----LENNQKEGAGENSVS 176

Query: 170 TGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG--NCTGGHCRRRVEYLKVVSKILVSDL 227
           +GYH +EFLLWGQDL      PG+R YTD+ +   + T  +  RR +YL     +++ +L
Sbjct: 177 SGYHAVEFLLWGQDLSET--GPGDRKYTDYLVNSDDATNLNQARRGQYLLACIDLIIDNL 234

Query: 228 EEMMKAWGPDG--QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHD----P 281
           + + +AW            + D    + + + G+   + +EL+ ERM + L         
Sbjct: 235 QTLKEAWKSGNASNYRAGFIADPKGSIGNFLKGVIGYADDELSVERMQVALDTEGDAERQ 294

Query: 282 EQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEIND 341
           EQE  CFSD TY   +    GI + Y GEY+R++G  + G S+ DL+   +  L   +  
Sbjct: 295 EQEQSCFSDQTYNDIILGQKGIKNVYVGEYVRIDGTIVSGMSVSDLVKAADPKLDSTVRA 354

Query: 342 KFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           K  +T      +         FD  I   N  G   V+N IN L  +    +     +  
Sbjct: 355 KIYDTDIKVAAIHA------PFDNEILTANTAGTIRVQNAINALHVEAAQYKNAANKIGY 408

Query: 402 I 402
           +
Sbjct: 409 L 409


>gi|218659024|ref|ZP_03514954.1| hypothetical protein RetlI_04866 [Rhizobium etli IE4771]
          Length = 242

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 126/239 (52%), Positives = 166/239 (69%), Gaps = 1/239 (0%)

Query: 134 ANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
               I ++ K++D S ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       G
Sbjct: 4   PTKTIKIDGKDVDASKLTPEFLSGTLQEAGGIEANVATGYHAIEFLLWGQDLNGTSPGAG 63

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGL 252
           NRP TD+D+ NCT G+C RR EYLK  S +LVSDL+EM  +W PDG ATK++  D  AGL
Sbjct: 64  NRPATDYDLKNCTHGNCDRRAEYLKSASTLLVSDLQEMTDSWKPDGAATKNVEADPKAGL 123

Query: 253 NSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYI 312
            +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y 
Sbjct: 124 VAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYT 183

Query: 313 RMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENN 371
           R++G K+ G S+HDL++  ++ L  E+  K + T+   + +  R E +E +DQMI+E N
Sbjct: 184 RVDGTKLSGPSLHDLVAAKDKALDAEMEGKLNKTLDAMNAMAKRGETVEKYDQMIAEGN 242


>gi|157737979|ref|YP_001490663.1| hypothetical protein Abu_1746 [Arcobacter butzleri RM4018]
 gi|157699833|gb|ABV67993.1| conserved hypothetical protein [Arcobacter butzleri RM4018]
          Length = 451

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 126/445 (28%), Positives = 202/445 (45%), Gaps = 60/445 (13%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKV--------LQNYATIAHAKYEDALMCARTLDS 53
             +  +S+V +L   + +   N  ++KV        L+ YA IA   Y +AL  A+ L  
Sbjct: 7   KVLLSVSVVASLALTSYAATNNNEVKKVEVAKQASILEAYANIALDNYTNALKDAKNLKV 66

Query: 54  AIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD-----------TWDKKVN 102
           AI+     P ++N + A+  W+ +R  Y  +E++R  N  +D             + ++N
Sbjct: 67  AIDKFAKAPTQENFDAAKKAWLDSRESYGSTEIFRLSNGPIDAEEGWIADAYGALEGQIN 126

Query: 103 AWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRAN 162
           AWPLDE  IDY   + GK    N + T           + KE+D++ I+ D L  L+  N
Sbjct: 127 AWPLDENMIDYTVDAEGKLTSGNIIDTVGKFNPGG--EDSKEVDVTKITVDALTDLNE-N 183

Query: 163 GIDTNITTGYHVIEFLLWGQD----------LKTNVREPGNRPYTDFDIGNCTGGHCRRR 212
           G + N++TGYH IEFLLWGQD          +       G RP TDF     T  + +RR
Sbjct: 184 GGEANVSTGYHAIEFLLWGQDQDYANFMDDNVTKGPMTAGQRPLTDF----TTDKNSQRR 239

Query: 213 VEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK----------------DINAGLNSII 256
           + YLK  S+ LV DLE +  AW  + +  + L +                D    L  II
Sbjct: 240 LAYLKASSEKLVKDLETVTSAWKKEVKGNQGLYQAALLGKLKGKDKDKNIDQKEALKQII 299

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM     +ELA ER+ + ++    E E  CFSDNT+   + +  G  +  T  Y   NG
Sbjct: 300 AGMGVFIKSELANERIAVAVLTPSEEDEHSCFSDNTHRDLVKNYEGFKNVLTATY---NG 356

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
           +K +G S+ D +   ++   + I    S+  +    +   A+    FD  I  ++ E +K
Sbjct: 357 KK-YGKSLFDAV---DKETKERIEKLMSSIEEKIESVDKIAKTEAHFDYQIRPDH-EQSK 411

Query: 377 IVRNLINDLITQTESLRKIRIALDL 401
           ++  L N+L    + +  +  A  +
Sbjct: 412 VITKLKNELRKLGDEMVNVASANGI 436


>gi|296271911|ref|YP_003654542.1| Peptidase M75, Imelysin [Arcobacter nitrofigilis DSM 7299]
 gi|296096086|gb|ADG92036.1| Peptidase M75, Imelysin [Arcobacter nitrofigilis DSM 7299]
          Length = 451

 Score =  342 bits (878), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 121/441 (27%), Positives = 200/441 (45%), Gaps = 55/441 (12%)

Query: 1   MYFITIISIVFTLPSHALSIVPN---VSLEKVLQNYATIAHAKYEDALMCARTLDSAIET 57
           +  +T I++         +  PN   V    +L+ YA IA   Y +AL  A+ L+ AI  
Sbjct: 11  LSVVTAIALTGCATGTNAASTPNKEVVKSNTILEAYANIALDSYTNALNDAKALEKAINK 70

Query: 58  LVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD-----------TWDKKVNAWPL 106
               P +K L+ A+  W+ +R  Y Q+E +R  N  +D           + + ++NAWPL
Sbjct: 71  FAANPTEKTLQEAKDAWLTSRETYGQTESFRLSNGPIDAEEGWIAKDYGSLEGQINAWPL 130

Query: 107 DEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDT 166
           DE  IDY   + GK+   N + T           + K +D++ I+P+ + +L+   G + 
Sbjct: 131 DENMIDYTIDANGKKTSGNIIDTVGKFNPGG--EDAKAVDVTKITPEAISELNEDGG-EA 187

Query: 167 NITTGYHVIEFLLWGQD----------LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYL 216
           N+ +GYH +EFLLWGQD          +       G RP +DF     +     RR+EYL
Sbjct: 188 NVASGYHAVEFLLWGQDQDYSNFLKDSITHGPLTAGQRPLSDF----TSSVDAPRRLEYL 243

Query: 217 KVVSKILVSDLEEMMKAWGPDGQATKDLMK----------------DINAGLNSIITGMT 260
           K  S+ +VSDLE +  AW  +   TK L +                  N  L  II GM 
Sbjct: 244 KSASQKIVSDLEIVTSAWAKNLNGTKGLYRAAILDQLKGDNASKNISRNDALKQIIAGMG 303

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
               +ELA ER+ + ++    E E  CFSDNT+     +     +  T  Y   +G+K +
Sbjct: 304 VFMKSELANERIAVAVLTPSEEDEHSCFSDNTHRDIAMNYQSFKNILTSTY---DGKK-Y 359

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
           G S+ D +  + +    +I    S+  +   ++   A+  E FD  I   +P  +K++  
Sbjct: 360 GPSLLDKVDGSAKA---KIEKLMSSIEEKIALIDKTAKTKEHFDYQIKPTSPM-SKVIVK 415

Query: 381 LINDLITQTESLRKIRIALDL 401
           L N++    +++  +  A  +
Sbjct: 416 LKNEMRKLGDTMVDVASANGI 436


>gi|254423159|ref|ZP_05036877.1| hypothetical protein S7335_3313 [Synechococcus sp. PCC 7335]
 gi|196190648|gb|EDX85612.1| hypothetical protein S7335_3313 [Synechococcus sp. PCC 7335]
          Length = 410

 Score =  342 bits (877), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 108/410 (26%), Positives = 177/410 (43%), Gaps = 49/410 (11%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +T        P+    +     L   +++YA + +  Y  +   A  +  AI T +  PN
Sbjct: 31  VTPTVAPTVAPAADPLLAQAGDLTPYIESYAELVYRTYRSSKADAVMMQRAIATFLDNPN 90

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVD---------TWDKKVNAWPLDEGFIDYV 114
               + A+  W  AR  Y Q+E +RF    +D           + ++NAWP++E FIDYV
Sbjct: 91  VDTHQAAKAAWTEARQSYLQTEAFRFYEGPIDFIDLETGEEGPEGRINAWPMNEAFIDYV 150

Query: 115 DSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHV 174
                          + +I +    ++         + ++L     ++  + ++TTG+H 
Sbjct: 151 QGK----------ADSGVINDPSFEIS---------TANVLENDQVSD--EADVTTGWHA 189

Query: 175 IEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW 234
           IEFLLWGQD       PG R Y DF  G    G+  RR EYL +V+  L+ DL  +   W
Sbjct: 190 IEFLLWGQDFN--ADGPGQRSYEDFVAGK---GNNDRRREYLNLVTDQLIEDLTFLETEW 244

Query: 235 GP--DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNT 292
            P  D    + + +D    L  ++T + +LS  E+A ERM + L   D E E  CFSD T
Sbjct: 245 QPGSDNYRAEFVAQDPQETLGKVLTSLATLSAFEMASERMAVSLDSGDQEDEHSCFSDTT 304

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHI 352
           Y  ++ +  GI + Y  +Y         G  + +L++     L Q++      T      
Sbjct: 305 YQDFVFNAAGIRNVYFADY-----GDYQGIGLDELLASVAPELNQQMIAALDQTQTTIAQ 359

Query: 353 LKDRAENIESFDQ-MISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           +         FDQ ++S    E   +V + I  L  Q E + ++  AL +
Sbjct: 360 IST------PFDQVLVSPPGSEERAVVESAIVALEDQAELIVEVGSALGV 403


>gi|158336553|ref|YP_001517727.1| iron-regulated protein [Acaryochloris marina MBIC11017]
 gi|158306794|gb|ABW28411.1| iron-regulated protein, putative [Acaryochloris marina MBIC11017]
          Length = 405

 Score =  341 bits (876), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 110/393 (27%), Positives = 177/393 (45%), Gaps = 49/393 (12%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
              NV L   ++NYA +    Y+DA   A  +  AI   +  PN+ + + A+  W++AR 
Sbjct: 42  AAKNVDLTPYVENYAEVVFRNYQDARTQAAMMQVAITAFLDNPNETSHKAAQDAWVQARQ 101

Query: 80  PYQQSEVYRFGNKIVD---------TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
            Y Q+E +RF    +D           + ++NAWP++E FIDYV               +
Sbjct: 102 SYLQTEAFRFYEGPIDFVDAKTGEEGPEGRINAWPMNEAFIDYVKEKP----------DS 151

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
            +I N K  ++   I             +     + ++TTG+H IEFLLWGQD       
Sbjct: 152 GLINNPKFEISIAAI-----------MENDQVTDEADVTTGWHAIEFLLWGQDFN--NEG 198

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT--KDLMKDI 248
           PG R + DF        +  RR +YL +V++ LVSDL  +   W P+ +    K L  D 
Sbjct: 199 PGQRSFEDFIPNQ---NNNDRRRQYLTLVTEQLVSDLTFLETEWKPNAENYRAKFLKGDP 255

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
            A +  I T + +LS  E+A ERM + L   + E E  CFSD TY  ++ +  GI + Y 
Sbjct: 256 KATVGKIFTALATLSAFEMASERMTVALDSGNQEDEHSCFSDTTYQDFVFNAKGISNVYF 315

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
           G+Y         G    +L++  N +L Q+I    + T +    +       + FDQ+++
Sbjct: 316 GDYAGY-----QGKGFDELLAQMNPDLNQKITAALTTTEESASQID------QPFDQVLA 364

Query: 369 -ENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
                     V  ++  L  Q E+ +++   L 
Sbjct: 365 SAQGSPQRAEVEAVVTALENQGEAFKELGPVLG 397


>gi|315637720|ref|ZP_07892923.1| imelysin superfamily protein [Arcobacter butzleri JV22]
 gi|315477999|gb|EFU68729.1| imelysin superfamily protein [Arcobacter butzleri JV22]
          Length = 451

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 124/445 (27%), Positives = 200/445 (44%), Gaps = 60/445 (13%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKV--------LQNYATIAHAKYEDALMCARTLDS 53
             +  +S+V +L   + +   N  ++KV        L+ YA IA   Y +AL  A+ L  
Sbjct: 7   KVLLSVSVVASLALTSYAATNNNEVKKVEVAKQASILEAYANIALDNYTNALKDAKNLKV 66

Query: 54  AIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD-----------TWDKKVN 102
           AI+     P ++N + A+  W+ +R  Y  +E++R  N  +D             + ++N
Sbjct: 67  AIDKFAKAPTQENFDAAKKAWLDSRESYGSTEIFRLSNGPIDAEEGWIADAYGALEGQIN 126

Query: 103 AWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRAN 162
           AWPLDE  IDY   + GK    N + T           + KE+D++ I+ D L  L+  N
Sbjct: 127 AWPLDENMIDYTVDAEGKLTSGNIIDTVGKFNPGG--EDSKEVDVTKITVDALTDLNE-N 183

Query: 163 GIDTNITTGYHVIEFLLWGQD----------LKTNVREPGNRPYTDFDIGNCTGGHCRRR 212
           G + N++TGYH IEFLLWGQD          +       G RP TDF     T  + +RR
Sbjct: 184 GGEANVSTGYHAIEFLLWGQDQDYANFMDDNVTKGPMTAGQRPLTDF----TTDKNSQRR 239

Query: 213 VEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK----------------DINAGLNSII 256
           + YLK  S+ LV DLE +  AW  + +  + L +                D    L  II
Sbjct: 240 LAYLKASSEKLVKDLETVTSAWKKEIKGNQGLYQAALLGKLKGKDKDKNIDQKEALKQII 299

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM     +ELA ER+ + ++    E E  CFSDNT+   + +  G  +  T  Y   NG
Sbjct: 300 AGMGVFIKSELANERIAVAVLTPSEEDEHSCFSDNTHRDLVKNYEGFKNVLTATY---NG 356

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
           +K +G S+ D +   ++   + I    S+  +    +   A+    FD  I  ++ +   
Sbjct: 357 KK-YGKSLFDAV---DKETKERIEKLMSSIEEKIESVDRIAKTEAHFDYQIRPDHEQSKV 412

Query: 377 IVRNLINDLITQTESLRKIRIALDL 401
           ++  L N+L    + +  +  A  +
Sbjct: 413 LI-KLKNELRKLGDEMVNVASANGI 436


>gi|150025534|ref|YP_001296360.1| lipoprotein precursor [Flavobacterium psychrophilum JIP02/86]
 gi|149772075|emb|CAL43551.1| Probable lipoprotein precursor [Flavobacterium psychrophilum
           JIP02/86]
          Length = 390

 Score =  336 bits (862), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 131/394 (33%), Positives = 193/394 (48%), Gaps = 38/394 (9%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
             ++ V NV+ ++V++NYA IA+  Y+ A   A  L SAI T  TTP + N +NA+ +W 
Sbjct: 26  AVVAPVKNVTKKEVIENYANIAYENYKKAYDDAVILKSAITTFTTTPTQVNFDNAKNKWK 85

Query: 76  RARIPYQQSEVYRFGNKIVDTW---DKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            AR  Y  +E +RF N  +D     +  +N+WPLDE FIDYV          N    A I
Sbjct: 86  VARESYGTTEAFRFANGPIDNTTGPESFLNSWPLDENFIDYV----------NGAPNAGI 135

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL-KTNVREP 191
           + N  +          II+  +L++ +   G + NI+ GYH IEFLLWGQDL   +V +P
Sbjct: 136 VNNEAL--------FPIITKSVLKEQNELGG-EKNISVGYHAIEFLLWGQDLTAPSVNKP 186

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK-DINA 250
           G RPYTD+ I   T  +  RR  YL   S +L  +L E++  W   G      +    N 
Sbjct: 187 GQRPYTDYIIAGGTAANQARRTAYLVACSDLLTDNLLEVVNQWKVGGAYRTTFLGLPENE 246

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
            L ++  G+T+L   EL  ERM + L   D E E  CFSDNT+   + ++ G+I+ Y G+
Sbjct: 247 ALKNMYLGITTLISAELPVERMEVALGNADQEDEHSCFSDNTHRDIILNLQGVINVYQGK 306

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
           Y  ++     GAS+ DL+S  N     E N   + ++   + L         FD  IS  
Sbjct: 307 YGSID-----GASLEDLVSQANVQANTETNASIALSLTKANALF------NPFDLAISGG 355

Query: 371 --NPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
             + EG K V+           +L      + +I
Sbjct: 356 ATSVEGAK-VKLAAMQFKDLGSNLLNGATKIGII 388


>gi|301166521|emb|CBW26097.1| putative exported protein [Bacteriovorax marinus SJ]
          Length = 441

 Score =  331 bits (849), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 135/438 (30%), Positives = 207/438 (47%), Gaps = 67/438 (15%)

Query: 3   FITIISIVFTLPSHALSIVPNVSL---EKVLQNYATIAHAKYEDALMCARTLDSAIETLV 59
            +T   + F+L +HA+      +     +V+ NY+ +A   Y D+L  AR L S I   V
Sbjct: 29  LLTSAVVAFSLQAHAVKAPYKNNESLNREVISNYSDLALLNYNDSLQGARALKSEIAKFV 88

Query: 60  TTPNK------KNLENARLQW-IRARIPYQQSEVYRFGNKIVD----------------- 95
               K      K  +  +  W + AR+PY QSE++RF N  +D                 
Sbjct: 89  KLAKKGSKLASKQYDIVKKTWSLEARMPYGQSEIFRFYNGPIDFEPIDDGVTTYLESINF 148

Query: 96  -TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
              +  +NAWPLDE +IDYV              TA ++ N  I           ++ D+
Sbjct: 149 EGVEGLMNAWPLDEIYIDYVKED----------STAGLVNNRNI----------KLTKDV 188

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
           L  ++   G + NI+TGYH IEFLLWGQD   ++   G RPYTD+  G  T  +  RR E
Sbjct: 189 LVSMNEREG-EKNISTGYHAIEFLLWGQD--RSIDTAGQRPYTDYVDGG-TAKNQDRRRE 244

Query: 215 YLKVVSKILVSDLEEMMKAW--GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERM 272
           YL ++  +L   L  +   W  G     T+ L +D N+ L  I T M S++ +EL  ER+
Sbjct: 245 YLSLLIDLLDDHLSTVTNQWQVGEKNYRTEFLKRDSNSVLTDIFTSMISMAGDELKSERI 304

Query: 273 NLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEK-IHGASIHDLISHN 331
               +L D E+E  CFSD T      + +G+ + Y G+Y+  N  K I+G  I+DL++  
Sbjct: 305 ENAFLLEDQEEEHSCFSDQTINDIYTNALGVKNIYFGDYVAHNSSKSINGKGINDLVAFV 364

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAENIE--------SFDQMISENNPEGNKIVRNLIN 383
           N  L Q I  KF +   + +    ++ N +         FD+ ++ N  E    ++N+I+
Sbjct: 365 NPELDQAITKKFDSLFNNINFFYKKSRNGQVQIGSIETPFDRALTTNKVE----IQNIID 420

Query: 384 DLITQTESLRKIRIALDL 401
           DL +  E LR+    L L
Sbjct: 421 DLGSIDELLREAASELGL 438


>gi|319778642|ref|YP_004129555.1| Iron-regulated protein A precursor [Taylorella equigenitalis MCE9]
 gi|317108666|gb|ADU91412.1| Iron-regulated protein A precursor [Taylorella equigenitalis MCE9]
          Length = 476

 Score =  331 bits (848), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 115/421 (27%), Positives = 190/421 (45%), Gaps = 53/421 (12%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           +     L+NYA IA   Y DAL  A+TL  AI+     P ++ L+ A+  W+ +R  Y  
Sbjct: 60  IDEHAALENYANIAIKYYSDALKDAQTLQKAIKDFTANPTEETLKAAKDAWLMSRETYGL 119

Query: 84  SEVYRFGNKIVD-----------TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
           +E  R  N  +D             + ++NAWPLDE  IDY   + G     N + +   
Sbjct: 120 TEALRLSNGPIDAEEGWVAETYGNLESQINAWPLDEFMIDYTIDAKGNRTSGNIIDSTGK 179

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD--------- 183
              +    + KE+D++ I+P++L +L+  NG + N+ TGYH IEFLLWGQD         
Sbjct: 180 FKPTGD--DSKEVDITTITPEVLTELNE-NGGEANVATGYHAIEFLLWGQDQDYNSIVED 236

Query: 184 -LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
            + +     G RP TD+           RR +YL  V+  LV+DL+ ++ AW  +    K
Sbjct: 237 KIASGPMTAGQRPLTDY----TEDKFKDRRKDYLNAVTDKLVNDLQVLVNAWSTERDGAK 292

Query: 243 DLMK----------------DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEID 286
            L +                + +  +  I++G+     +ELA ER+ + ++    E E  
Sbjct: 293 GLYRQALLGELKGEEASKNIETDVAIKQILSGLGVFIKSELANERIAVAVLTPSEEDEHS 352

Query: 287 CFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNT 346
           CFSDNT+     +  G +    G+    NG+   G S +D +   N+     I+   ++ 
Sbjct: 353 CFSDNTHRDIDQNFKGWLDFLKGQ---TNGKS-TGVSFYDSLGKENKA---NIDKLIADV 405

Query: 347 MKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL--DLIEP 404
            K    +   A+    FD  I  +N   NK + ++ N +    + +  +  +L  DL E 
Sbjct: 406 EKRIADMNAVAQKEMHFDYQILPSNEAYNKNIVSMKNQMRRLGDQMIVVAKSLHIDLTED 465

Query: 405 N 405
           +
Sbjct: 466 D 466


>gi|327403671|ref|YP_004344509.1| peptidase M75, Imelysin [Fluviicola taffensis DSM 16823]
 gi|327319179|gb|AEA43671.1| Peptidase M75, Imelysin [Fluviicola taffensis DSM 16823]
          Length = 394

 Score =  330 bits (847), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 113/415 (27%), Positives = 186/415 (44%), Gaps = 42/415 (10%)

Query: 1   MYFITIISIVFTL----PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIE 56
           ++ +   +IV       P    S         +   YA +A A Y+D+      L +A  
Sbjct: 8   IFLVASATIVACKKDKDPVVDTSDQYAQQKSDIKVTYAKMAFAVYKDSYTATVALQTACH 67

Query: 57  TLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTW----DKKVNAWPLDEGFID 112
            L  +P++ NL+ A+  W+ AR  Y  SE++RF +  +D      +  +NAWP+DE ++D
Sbjct: 68  ALADSPSQANLDAAKDAWLDAREVYGLSEIFRFVDGPIDNTNDGPEGLINAWPMDENYVD 127

Query: 113 YVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGY 172
           YV               + II +   +VN   ID S I      + +   G +T I++GY
Sbjct: 128 YVLGDP----------NSGIIND---LVNYPTIDASTIV-----QANEVGG-ETKISSGY 168

Query: 173 HVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMK 232
           H +EFLLWGQDL       G RPYTD+     T  +  RR  YLK V  +LVS L+++  
Sbjct: 169 HAVEFLLWGQDLSNT--SAGQRPYTDYLTTGGTALNQARRATYLKTVVDLLVSALDQVKD 226

Query: 233 AWGP--DGQATKDLMK-DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFS 289
           AW P   G         D    L  +   M  L+ +ELAGER+ +       E E  CFS
Sbjct: 227 AWDPAITGSYCHTFQGLDNETALRKMFNSMRVLAGDELAGERIYVAYENSSQEDEHSCFS 286

Query: 290 DNTYASYLNDVIGIISSYTGEYIRM--NGEKIHGASIHDLISHNNRNLAQEINDKFSNTM 347
           DNT+     + + + + Y G Y     +   ++G ++ DL++  +      + ++F+ TM
Sbjct: 287 DNTHRDIYLNALAVENLYKGTYTSTINSANSVNGYALEDLVNAIDAGKNSLLINRFATTM 346

Query: 348 KDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
               ++       + FDQ I+         V +++  L  +   L  + +   ++
Sbjct: 347 TRISMMY------QPFDQAITL--QAERPKVLDVVTSLQQEQADLDGVALLFSIV 393


>gi|148244805|ref|YP_001219499.1| hypothetical protein COSY_0663 [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326632|dbj|BAF61775.1| conserved hypothetical protein [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 436

 Score =  322 bits (826), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 118/442 (26%), Positives = 198/442 (44%), Gaps = 54/442 (12%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           + F+  + IV +  S  LS      +  +L  YA IA   Y DAL  A+ L   ++    
Sbjct: 10  ISFVLTVVIVISAASVFLSGN---EINPLLITYANIATINYTDALNDAKKLGIKLKDFTI 66

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD---TW-------DKKVNAWPLDEGF 110
            P  + + NA+  W+ AR  Y Q+E +R  N  +D    W       + ++NAWPLDE  
Sbjct: 67  NPTIETMGNAKAAWLNARESYSQTEAFRLSNGPIDAEEGWHTSYGAPEGRLNAWPLDENM 126

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           IDY  ++ G++   N + T +I        N   ID+SII+ D+L  L+  NG + N+TT
Sbjct: 127 IDYTTNAKGRKTSGNIIDTPDIFNPGG--ENPLVIDVSIITSDVLVALNE-NGGNANVTT 183

Query: 171 GYHVIEFLLWGQDLKTNVRE----------PGNRPYTDFDIGNCTGGHCRRRVEYLKVVS 220
           GYHVIEFLLWGQD                  G RP  D+ I      +  RR +YL   +
Sbjct: 184 GYHVIEFLLWGQDQDYTNFIKDSVTHGALLAGQRPLADYTI----NVNADRRKQYLNAAA 239

Query: 221 KILVSDLEEMMKAWGPDG--QATKDLMK---------DINAGLNSIITGMTSLSYNELAG 269
            +++SDLE +  AW           L+          ++   L  I +G+     +ELA 
Sbjct: 240 SLIISDLESITSAWADGDSTNYKAALLGQNSDVTKNINVKVALKQIFSGLGIFIKSELAN 299

Query: 270 ERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLIS 329
           ER+ + ++    E E  CFSDNT+     +  G  +   G Y   +    +G ++ D  +
Sbjct: 300 ERIAMAVLTPSEEDEHSCFSDNTHRDITQNFQGFKNLLFGTYNGFD----YGVALID--A 353

Query: 330 HNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQT 389
             ++    ++    ++     + +   A+    FD  I  N+ +  + ++ L N+L    
Sbjct: 354 MKDK---TKLMGLIASVNTKINQMNTLAQVSRHFDYQIHPNDSQARQ-IKILKNELRAIG 409

Query: 390 ESLRKIRIALDLIEPNRVIGNV 411
           + +  +  +  +   +  +GN+
Sbjct: 410 DQMIYVAKSNGI---DLTVGNI 428


>gi|118602702|ref|YP_903917.1| putative iron-regulated protein A [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
 gi|118567641|gb|ABL02446.1| imelysin, Metallo peptidase, MEROPS family M75 [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 435

 Score =  321 bits (822), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 114/430 (26%), Positives = 187/430 (43%), Gaps = 48/430 (11%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            I+    V  + S   + + +  +  +L  YA IA A Y DAL  A+TL   ++     P
Sbjct: 8   IISSALTVVMVISITSTFLSSEEVSPLLITYANIATANYTDALNDAKTLKEKLKYFTNRP 67

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVD---TW-------DKKVNAWPLDEGFID 112
               +ENA+  W+ AR  Y Q E +R  N  +D    W       + ++NAWPLDE  ID
Sbjct: 68  TIVLMENAKAAWLNARESYGQIEAFRLSNGPIDAEEGWHTSYGAPEGQLNAWPLDENMID 127

Query: 113 YVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGY 172
           Y  ++ GK+   N + T  ++       N   ID+S I+P +L  L+  NG D N+ TGY
Sbjct: 128 YTTNAKGKKTTGNIIDTKGMLNLGG--ENPLAIDVSTITPSVLAALNE-NGGDANVATGY 184

Query: 173 HVIEFLLWGQD-------LKTNVRE---PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKI 222
           H IEFLLWGQD                  G R  +D+ I      +  RR +YL   + +
Sbjct: 185 HAIEFLLWGQDQDYTNFMKDGVTNGALVAGQRALSDYTI----NANADRRKQYLNAAASL 240

Query: 223 LVSDLEEMMKAWGPDG--QATKDLMK---------DINAGLNSIITGMTSLSYNELAGER 271
           +VSDLE M+ AW           L+          D    L  I +G+     +ELA ER
Sbjct: 241 IVSDLESMVLAWADGDSTNYKAALLGKNSDVTKNIDTKVALKQIFSGLGVFIKSELANER 300

Query: 272 MNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN 331
           + + ++    E E  CFSDNT+     +  G  +   G Y  ++        +  + +  
Sbjct: 301 IAVAVLTPSEEDEHSCFSDNTHRDITQNFQGFKNLLFGTYNSVD------YGVAPIDAMK 354

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTES 391
           ++    ++    ++     + +   A+    FD  I  N+ +  + ++ L N+L    + 
Sbjct: 355 DK---TKLMSLIASVNAKINQMNTLAQVSRHFDYQIRLNDTQSRQ-IKKLKNELRAIGDQ 410

Query: 392 LRKIRIALDL 401
           +  +  +  +
Sbjct: 411 MIYVAKSNGV 420


>gi|330721293|gb|EGG99378.1| Iron-regulated protein A precursor [gamma proteobacterium IMCC2047]
          Length = 251

 Score =  320 bits (819), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 107/237 (45%), Positives = 147/237 (62%), Gaps = 4/237 (1%)

Query: 18  LSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA 77
            S       + ++ +YA +AHA ++DAL+ A+ L  A + L+  P++K L  AR  W ++
Sbjct: 14  SSATMAADEQAIVSHYADLAHAVFDDALITAQQLQQATDALLANPSEKTLAAARDAWKQS 73

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV S Y  E   N   T NII+  +
Sbjct: 74  RVPYQQSEVFRFGNPVVDDWEGQLNAWPLDEGLIDYVASDYHYE-LGNEGATINIISKEE 132

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYT 197
           + V  + ID+S ++PDLL  L+   G + N+ TGYH IEFLLWGQDL  N    G RPYT
Sbjct: 133 LNVGGEVIDVSNLTPDLLASLNELAGSEANVATGYHAIEFLLWGQDLYGNNAGAGERPYT 192

Query: 198 DFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG--QATKDLMKDINAG 251
           DF +G  CTGG+C RR +YL+  S++LV DL  M+  W  D       +L+     G
Sbjct: 193 DFVVGEGCTGGNCDRRGDYLRAASQLLVDDLAYMVDEWSADKQDNYRAELLSGDGEG 249


>gi|254785012|ref|YP_003072440.1| peptidase, imelysin family [Teredinibacter turnerae T7901]
 gi|237684511|gb|ACR11775.1| peptidase, imelysin family [Teredinibacter turnerae T7901]
          Length = 484

 Score =  318 bits (815), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 120/420 (28%), Positives = 183/420 (43%), Gaps = 54/420 (12%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
           +  KVL   A IA A Y D++  ++ L +AI T    P + NL+ A++ W+ +R PY Q+
Sbjct: 52  NARKVLNTNADIAFAAYSDSVDTSKALQTAIATFKAEPTQANLDAAKIAWLVSREPYGQT 111

Query: 85  EVYRFGNKIV--------DTWDKKVNAWPLDEGFIDYVDSSY---GKENEENNLYTANII 133
           EVYRF    +        D  +  +NAWPL E  IDY  S       + E ++ Y     
Sbjct: 112 EVYRFRLSPIDSTDYQNEDGPEGDINAWPLGEALIDYTVSGSDFGADQTEVSSAYPTIGY 171

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNV----- 188
               II ++  ID      D L       G +  + +GYH IEF+LWGQDL T+      
Sbjct: 172 PQENIINSDVAID------DALFAAVADVGDERGVISGYHAIEFMLWGQDLNTDGSADTE 225

Query: 189 ------------REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP 236
                          G+RP +DF     T  +  RR+++++VV+  LV+DLE +   W  
Sbjct: 226 DDREMSTGGNILNSGGHRPLSDF----TTDANAARRMQFMEVVAAKLVADLEAVRDGWAV 281

Query: 237 DGQATKDLMKDINAG-----LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDN 291
                               +  I+ GM +LS  ELAGERM +       E E  CFSDN
Sbjct: 282 GSSYRTAFTTVNTETQAVNRMAEILFGMGTLSTAELAGERMQIAFSSGSQEDEHSCFSDN 341

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGE----------KIHGASIHDLISHN-NRNLAQEIN 340
           T+     D  G+ +SY G Y   + +           ++G  I D ++ + N  L  +++
Sbjct: 342 THRDVWLDAEGVSNSYYGVYAGYDSDLDGTDDVTTRAVNGYGIDDYLNESGNSALDDKVS 401

Query: 341 DKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
              S T  ++  +   A     FD +I +     +  V   I  L  QT    +I +A+ 
Sbjct: 402 TALSVTATNYEAIDASARAGTPFDNLIMDEARASDNPVAKTILSLTEQTLRFAEIAVAIG 461


>gi|289677765|ref|ZP_06498655.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae FF5]
          Length = 234

 Score =  296 bits (757), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 99/214 (46%), Positives = 129/214 (60%), Gaps = 4/214 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+
Sbjct: 22  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTII 81

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 82  DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 140

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 141 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGHNDRRR 200

Query: 214 EYLKVVSKILVSDLEEMMKAWGPD--GQATKDLM 245
            YLK V+ +LVSDLEEM   W P         L 
Sbjct: 201 AYLKAVTDLLVSDLEEMSGNWKPGVPDNYRATLE 234


>gi|257486397|ref|ZP_05640438.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 212

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 109/204 (53%), Gaps = 3/204 (1%)

Query: 205 TGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTS 261
           TGGH  RR  YLK V+ +LVSDLEEM   W     D        +   +GL  ++ GM S
Sbjct: 1   TGGHNDRRRAYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRKMLFGMGS 60

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G
Sbjct: 61  LSLGELAGERMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSG 120

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
            S+  L++  +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ 
Sbjct: 121 PSLSSLVAKVDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDA 180

Query: 382 INDLITQTESLRKIRIALDLIEPN 405
           I  L+ QT ++ +    L + + N
Sbjct: 181 IAALVKQTGAIEQAAGKLGITDLN 204


>gi|45656611|ref|YP_000697.1| putative lipoprotein [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
 gi|45599846|gb|AAS69334.1| putative lipoprotein [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
          Length = 440

 Score =  257 bits (656), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 87/423 (20%), Positives = 158/423 (37%), Gaps = 59/423 (13%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT--PNKKNLENARLQWIRAR 78
            P  +  +V+  Y  + +  Y+ +   A    +A+        P   +  N +  ++ AR
Sbjct: 42  QPTATRAQVVDRYLQLGYESYDQSYKDAVAFQTAVTAFAANNNPTAADHINLKNLYVVAR 101

Query: 79  IPYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFID-YVDSSYGK 120
             Y  +E +RF +  +D  D                   +N WPLDE  ID Y++++  +
Sbjct: 102 ASYLTTEAFRFSSGPIDNVDILGCGSNADGSGDEECEGLINGWPLDESAIDNYINNNAAQ 161

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
           +     +  AN  A +   V++ +                    +T +T G+H IE++LW
Sbjct: 162 QPTYAAILAANGDAGANNAVDQDD--------------------ETALTVGWHAIEYILW 201

Query: 181 GQDLKTNV--REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           GQDL      +  G R   D   G   G    RR  Y+K V+  LV  L+ +   +    
Sbjct: 202 GQDLFNGGINQISGQRNIAD-LTGASPGTVGGRRRTYMKAVTDGLVLQLKLIRDQFEDGA 260

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
           + +  L  + +A +  I  G+      E  GER+  G      E+E  CFSD T A +  
Sbjct: 261 RYSDGLKSNPDAAVTYIFQGLGKFIAGEWGGERLT-GTFGGQQEEEHSCFSDTTKADFYY 319

Query: 299 DVIGIISSYTGEYIRMNGEKIH-GASIHDLISHNN------RNLAQEINDKFSNTMKDFH 351
           +   +++ + G Y    G     G  + +L    N      +  A       + + +   
Sbjct: 320 NAQSVLNIWNGSYELKKGTVTSTGPGLKNLFGTFNVPGIGFQATAARDTFCINLSEQTAD 379

Query: 352 ILKDR----AENIESFDQMISENNPEGNKI--VRNLINDLITQTESLRKIRIALDLIEPN 405
                          +DQ+I   + E   +  V+  I D + +T  +      + +   +
Sbjct: 380 PNYTTSCKPGSLTGRYDQIIRNTDNEYQILFDVQKFIGDKMKKT--ITDAAKTIGISITD 437

Query: 406 RVI 408
             I
Sbjct: 438 FSI 440


>gi|62184293|gb|AAW65730.1| LruB [Leptospira interrogans serovar Pomona]
          Length = 439

 Score =  257 bits (656), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 86/422 (20%), Positives = 149/422 (35%), Gaps = 58/422 (13%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT--PNKKNLENARLQWIRAR 78
            P  +  +V+  Y  + +  Y+ +   A    +A+        P   +  N +  ++ AR
Sbjct: 42  QPTATRAQVVDRYLQLGYESYDQSYKDAVAFQTAVTAFAANNNPTAADHINLKNLYVVAR 101

Query: 79  IPYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFIDYVDSSYGKE 121
             Y  +E +RF +  +D  D                   +N WPLDE  ID   ++ G  
Sbjct: 102 ASYLTTEAFRFSSGPIDNVDILGCGSNADGSGDEECEGLINGWPLDESAIDNYIANAGNA 161

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
                +   N  AN                             +T +T G+H IE++LWG
Sbjct: 162 TTYAAILATNGDAN--------------------ANNADDQDDETALTVGWHAIEYILWG 201

Query: 182 QDLKTNV--REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           QDL      +  G R   D   G   G    RR  Y+K V+  LV  L+ +   +    +
Sbjct: 202 QDLFNGGINQISGQRNIAD-LTGASPGTVGGRRRAYMKAVTDGLVLQLKLIRDQFEDGAR 260

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
            +  L  + +A +  I  G+      E  GER+  G      E+E  CFSD T A +  +
Sbjct: 261 YSDGLKSNPDAAVTYIFQGLGKFIAGEWGGERLT-GTFGGQQEEEHSCFSDTTKADFYYN 319

Query: 300 VIGIISSYTGEYIRMNGEKIH-GASIHDLISHNN------RNLAQEINDKFSNTMKDFHI 352
              +++ + G Y    G     G  + +L    N      +  A       + + +    
Sbjct: 320 AQSVLNIWNGSYELKKGTVTSTGPGLKNLFGTFNVPGIGFQATAARDTFCINLSEQTADP 379

Query: 353 LKDR----AENIESFDQMISENNPEGNKI--VRNLINDLITQTESLRKIRIALDLIEPNR 406
                         +DQ+I   + E   +  V+  I D + +T  +      + +   + 
Sbjct: 380 NYTTSCKPGSLTGRYDQIIRNTDNEYQILFDVQKFIGDKMKKT--ITDAAKTIGISITDF 437

Query: 407 VI 408
            I
Sbjct: 438 SI 439


>gi|24216168|ref|NP_713649.1| hypothetical protein LA_3469 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|24197416|gb|AAN50667.1| putative lipoprotein [Leptospira interrogans serovar Lai str.
           56601]
          Length = 440

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 88/422 (20%), Positives = 155/422 (36%), Gaps = 57/422 (13%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT--PNKKNLENARLQWIRAR 78
            P  +  +V+  Y  + +  Y+ +   A    +A+        P   +  N +  ++ AR
Sbjct: 42  QPTATRAQVVDRYLQLGYESYDQSYKDAVAFQTAVTAFAANNNPTAADHINLKNLYVVAR 101

Query: 79  IPYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFIDYVDSSYGKE 121
             Y  +E +RF +  +D  D                   +N WPLDE  ID    +Y   
Sbjct: 102 ASYLTTEAFRFSSGPIDNVDILGCGSNADGSGDEECEGLINGWPLDESAID----NYINN 157

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
           N    +  AN++A +         +                  +T +T G+H IE++LWG
Sbjct: 158 NNAAQMTYANVLAVNGNAGANGGANDDD--------------DETALTVGWHAIEYILWG 203

Query: 182 QDL-KTNVRE-PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           QDL    V +  G R   D      T GH  +R  Y+K V+  LV  L+ +   +    +
Sbjct: 204 QDLFNGGVNQISGQRTVADLSGAAGTDGH--KRRTYMKAVTDGLVLQLKLIRDQFEDGAR 261

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
            +  L  + +A +  I  G+      E  GER+  G      E+E  CFSD T A +  +
Sbjct: 262 YSDGLKSNPDAAVTYIFQGLGKFIAGEWGGERLT-GTFGGQQEEEHSCFSDTTKADFYYN 320

Query: 300 VIGIISSYTGEYIRMNGEKIH-GASIHDLISHNN------RNLAQEINDKFSNTMKDFHI 352
              +++ + G Y    G     G  + +L    N      +  A       + + +    
Sbjct: 321 AQSVLNIWNGSYELKKGTVTSTGPGLKNLFGTFNVPGIGFQATAARDTFCINLSEQTADP 380

Query: 353 LKDR----AENIESFDQMISENNPEGNKI--VRNLINDLITQTESLRKIRIALDLIEPNR 406
                         +DQ+I   + E   +  V+  I D + +T  +      + +   + 
Sbjct: 381 NYTTSCKPGSLTGRYDQIIRNTDNEYQILFDVQKFIGDKMKKT--ITDAAKTIGISITDF 438

Query: 407 VI 408
            I
Sbjct: 439 SI 440


>gi|257486398|ref|ZP_05640439.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 234

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 76/170 (44%), Positives = 105/170 (61%), Gaps = 1/170 (0%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L + ++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 66  NMVSAVFDDAETGAKKLSTVVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 125

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y +    N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 126 DDWEGQVNAWPLDEGLIDYVAKDY-QHALGNPGATANIIANTEIQVGEDKVDVKEITSEK 184

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNC 204
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G  
Sbjct: 185 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAG 234


>gi|153823899|ref|ZP_01976566.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae B33]
 gi|126518577|gb|EAZ75800.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae B33]
          Length = 186

 Score =  245 bits (625), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 73/180 (40%), Positives = 109/180 (60%), Gaps = 1/180 (0%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IA+A Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSTILASLTLTTSASFAAAPTQAQVVEHYADIAYAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183


>gi|116331852|ref|YP_801570.1| Iron-regulated lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116125541|gb|ABJ76812.1| Iron-regulated lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 438

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 81/333 (24%), Positives = 131/333 (39%), Gaps = 45/333 (13%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA--RLQW 74
           A+ + P  +  +V+  Y  + +  Y+ +   A  L +A+       N    ++A  +  +
Sbjct: 38  AVGLQPTATKAQVVDRYLRLGYESYDQSYKDAVNLQTAVTAFAANANPSAADHANLKNLY 97

Query: 75  IRARIPYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFIDYVDSS 117
           I AR  Y  +E +RF +  +D  D                   +N+WPLDE  ID   ++
Sbjct: 98  IIARASYLVTEAFRFSSGPIDNVDVLGCGSNADGSGEEECEGLINSWPLDESAIDNYVAA 157

Query: 118 YGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEF 177
            G +      Y A + AN     N   ID                  +T IT G+H IE+
Sbjct: 158 AGAQTT----YAAILAANGNAEANNGAID---------------GDDETAITVGWHAIEY 198

Query: 178 LLWGQDLK--TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG 235
           +LWGQDL         G R   +    N  G        Y+K V+  LV  L  +   + 
Sbjct: 199 ILWGQDLSNGGVNEIAGQRTANELANANANGARR---RAYMKAVTDGLVLQLGLIRDQFA 255

Query: 236 PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYAS 295
              + +  L  + NA + +I  G+      E  GER+  G      E+E  CFSD T A 
Sbjct: 256 DGSRYSDALKSNPNAAITAIFQGLGKFIAGEWGGERLT-GTFDGQQEEEHSCFSDTTKAD 314

Query: 296 YLNDVIGIISSYTGEYIRMNGEKIH-GASIHDL 327
           +  +   +++ ++G Y    G     G  +  L
Sbjct: 315 FYYNAQSVLNIWSGSYELKKGTVTSTGPGLRSL 347


>gi|116327535|ref|YP_797255.1| Iron-regulated lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116120279|gb|ABJ78322.1| Iron-regulated lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 438

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 82/333 (24%), Positives = 132/333 (39%), Gaps = 45/333 (13%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA--RLQW 74
           A+ + P  +  +V+  Y  + +  Y+ +   A  L +A+       N    ++A  +  +
Sbjct: 38  AVGLQPTATKAQVVDRYLRLGYESYDQSYKDAVNLQTAVTAFAANANPSAADHANLKNLY 97

Query: 75  IRARIPYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFIDYVDSS 117
           I AR  Y  +E +RF +  +D  D                   +N+WPLDE  ID   ++
Sbjct: 98  IIARASYLVTEAFRFSSGPIDNVDVLGCGSNADGSGEEECEGLINSWPLDESAIDNYVAA 157

Query: 118 YGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEF 177
            G +      Y A + AN     N   ID                  +T IT G+H IE+
Sbjct: 158 AGAQTT----YAAILAANGNAEANNGAID---------------GDDETAITVGWHAIEY 198

Query: 178 LLWGQDLK--TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG 235
           +LWGQDL         G R   +F   N  G        Y+K V+  LV  L  +   + 
Sbjct: 199 ILWGQDLSNGGVNEIAGQRTANEFANANANGARR---RAYMKAVTDGLVLQLGLIRDQFA 255

Query: 236 PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYAS 295
              + +  L  + NA + +I  G+      E  GER+  G      E+E  CFSD T A 
Sbjct: 256 DGSRYSDALKSNPNAAITAIFQGLGKFIAGEWGGERLT-GTFDGQQEEEHSCFSDTTKAD 314

Query: 296 YLNDVIGIISSYTGEYIRMNGEKIH-GASIHDL 327
           +  +   +++ ++G Y    G     G  +  L
Sbjct: 315 FYYNAQSVLNIWSGSYELKKGTVTSTGPGLRSL 347


>gi|127511610|ref|YP_001092807.1| putative lipoprotein [Shewanella loihica PV-4]
 gi|126636905|gb|ABO22548.1| putative lipoprotein [Shewanella loihica PV-4]
          Length = 382

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 85/408 (20%), Positives = 152/408 (37%), Gaps = 87/408 (21%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
           F+  + AL  + N+S E +++ Y+T+A             L  A +TLV TP + NLE A
Sbjct: 37  FSFDADAL--IVNLSDEVIVKGYSTLA--------DRGEALLQATQTLVATPTQANLEAA 86

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           +  W  AR P++Q E + FG       D  +++WPL                        
Sbjct: 87  QSAWKAARQPWEQGESHIFGPVDSLGIDPHLDSWPL------------------------ 122

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
           N      +++N    D   I            G + ++  G+H +EFLL+G  +  NV+ 
Sbjct: 123 NTTDLKTVLINSSGFDAETIK-----------GWNDDV-QGFHTMEFLLFGDGMDDNVK- 169

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-----GPDGQATKDLM 245
                     I   T        +YL  ++++     +++  AW     G  G+A  +L+
Sbjct: 170 ---------QIDELTAN----ERDYLMGLAEVFRDYTKQLADAWLVSHDGQSGKAYGELL 216

Query: 246 KDINAGLNSIIT-----------GMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDN 291
           K      N+  +           GM  +     N    +     L   D  +    +S N
Sbjct: 217 KSPGVDGNTFYSSQVGVLEELIKGMIGIVDEVGNGKIADPFGGSLASADTSKVESQYSWN 276

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH 351
           +   + +++IG+ + Y GE+     +      I D +   +  LA  I  +    +   H
Sbjct: 277 SLTDFSDNIIGVRNVYQGEFTGEADK----QGIIDFVRAADSELASRIAAEIDAAILQIH 332

Query: 352 ILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            +     +   F Q I   +  G   ++  ++ L T   SL    + L
Sbjct: 333 AI--EGTDKMPFRQAI--KDEAGRARIQKAVDALATLQASLENQVLPL 376


>gi|157376924|ref|YP_001475524.1| putative lipoprotein [Shewanella sediminis HAW-EB3]
 gi|157319298|gb|ABV38396.1| putative lipoprotein [Shewanella sediminis HAW-EB3]
          Length = 384

 Score =  233 bits (594), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 82/403 (20%), Positives = 151/403 (37%), Gaps = 85/403 (21%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            A  ++ N++ + ++  YAT+A        M   +L  A +TLV TP + NL  A+  W 
Sbjct: 42  AATEMITNLTDDVIVSGYATLA--------MKGESLLLATQTLVNTPTQANLLAAQEAWK 93

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR P++Q E + FG       D  +++WPL                        N    
Sbjct: 94  AARQPWEQGESHIFGPVDSLGIDPHLDSWPL------------------------NTTDL 129

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
           + ++ N    D   I            G + ++  G+H +E+LL+G  +  N +      
Sbjct: 130 TTVLANNSGFDAETIK-----------GWNDDV-QGFHTMEYLLFGDGIADNEK------ 171

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-----GPDGQATKDLMKDINA 250
                I + T        EYL  ++++     + +  AW     G  G+A  +L+K   +
Sbjct: 172 ----AIADLTTAEN----EYLMGLAEVFRDYTKVLDDAWQVSHDGQSGKAYGELVKSPGS 223

Query: 251 GLNSIIT-----------GMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDNTYASY 296
             N+  +           GM  +     N    +   + L   D  +    +S N+   +
Sbjct: 224 DGNTFYSSQVGVIQELVNGMIGIVDEVGNGKIADPFGVSLETADTSKVESQYSWNSLTDF 283

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDR 356
            ++++G+ + Y GE    + +      I D +   +  LA  +  +  + +     +   
Sbjct: 284 SDNIVGVRNVYQGELTGASDK----QGIVDFVKAADATLAARVGSEIDDAIIKIQAI--S 337

Query: 357 AENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
             N   F Q IS+   EG   V+  I+ L     SL    + L
Sbjct: 338 GTNNMPFRQAISD--VEGRARVQTAIDALSKLQTSLESDILPL 378


>gi|167625435|ref|YP_001675729.1| putative lipoprotein [Shewanella halifaxensis HAW-EB4]
 gi|167355457|gb|ABZ78070.1| putative lipoprotein [Shewanella halifaxensis HAW-EB4]
          Length = 382

 Score =  232 bits (593), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 75/403 (18%), Positives = 148/403 (36%), Gaps = 85/403 (21%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            A  +V N++ + ++  Y+ +A             +  A +TLV TP + NL  A+  W 
Sbjct: 40  SATEMVTNLTDDVIVAGYSNLAL--------RGAAMLQATQTLVATPTQANLLAAQEAWK 91

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR P++Q E + FG       D  +++WPL                        N    
Sbjct: 92  AARQPWEQGESHIFGPVDSLGIDPHLDSWPL------------------------NTTDL 127

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
           + ++ N    D   I            G + ++  G+H +E+LL+G  +  N +      
Sbjct: 128 TTVLANNTGFDADTIK-----------GWNDDV-QGFHTMEYLLFGDGVADNTKTISEL- 174

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-----GPDGQATKDLMKDINA 250
                             +YL  ++++     + +  AW     G  G+A  +L+K+  A
Sbjct: 175 -------------TTNERDYLMGLAEVFRDYTKTLDDAWLISHDGQSGKAYGELLKNSGA 221

Query: 251 GLNSIIT-----------GMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDNTYASY 296
             N+  +           GM  +     N    +     +   D  +    +S N+   +
Sbjct: 222 DGNTFYSSEVGVVEELVNGMIGIVDEVGNGKIADPFGESIDKADTSKVESQYSWNSLTDF 281

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDR 356
            +++IG+ + Y GE      +      I D ++  N  LA  +  +  + +   + +   
Sbjct: 282 SDNIIGVRNVYLGELEGNADK----QGIIDFVNAANPALATRVKTEIDDAITKINAI--A 335

Query: 357 AENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
             N   F Q IS+++  G   +++ ++ L     SL    + L
Sbjct: 336 GANNMPFRQAISDSD--GRVRIQSAVDALTKLQASLESDVLPL 376


>gi|212636778|ref|YP_002313303.1| iron-regulated protein A [Shewanella piezotolerans WP3]
 gi|212558262|gb|ACJ30716.1| Iron-regulated protein A precursor [Shewanella piezotolerans WP3]
          Length = 382

 Score =  232 bits (591), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 78/408 (19%), Positives = 149/408 (36%), Gaps = 78/408 (19%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
           + P+       +    +++ N    +  A Y D       +  A +TLV TP + NLE A
Sbjct: 27  STPTTEPDNSFSFDATEMVTNLTEDVIVAGYNDLADEGEAMLLATQTLVATPTQANLEAA 86

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           +  W  AR P++Q E + FG       D  +++WPL                        
Sbjct: 87  QDAWKAARQPWEQGESHIFGPVDSMGIDPHLDSWPL------------------------ 122

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
           N I  + ++      D   I              + ++  G+H +E+LL+G  +  N + 
Sbjct: 123 NTIDLTTVLSTTTGFDAETIKS-----------WNDDV-QGFHTMEYLLFGDGVADNTK- 169

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-----GPDGQATKDLM 245
                     I   T        +YL  ++++     +++  AW        G+A  +L+
Sbjct: 170 ---------AIAELTAN----ERDYLMGLAEVFRDYTKDLDDAWVVSHDASSGKAYGELL 216

Query: 246 KDINAGLNSIIT-----------GMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDN 291
           K+  +  N+  +           GM  +     N    +     +   D  +    +S N
Sbjct: 217 KNPGSDGNTFYSSNVGVVEELINGMIGIVDEVGNGKIADPFGESVSSADTSKVESQYSWN 276

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH 351
           +   + N++IG+ + Y GE      +      I D ++  +++LA  +  +  N +    
Sbjct: 277 SLTDFSNNIIGVRNVYQGELTGAADK----QGIVDFVAAADKDLATRVGTEIDNAILTIQ 332

Query: 352 ILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            +     N   F Q IS+   EG K ++  ++ L     SL    + L
Sbjct: 333 AI--EGSNDMPFRQAISD--TEGRKRIQTAVDALSKLQTSLESDVLPL 376


>gi|153824178|ref|ZP_01976845.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae B33]
 gi|126518300|gb|EAZ75525.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae B33]
          Length = 193

 Score =  226 bits (577), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 66/184 (35%), Positives = 97/184 (52%), Gaps = 4/184 (2%)

Query: 226 DLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPE 282
           DLE M K W     D    + L +    GL  ++ GM SLS  ELAGERM + L  +  E
Sbjct: 2   DLEWMEKQWASGEKDNYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTE 61

Query: 283 QEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDK 342
            E DCFSDNT+ S+  +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +
Sbjct: 62  DEHDCFSDNTHNSHYYNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQ 121

Query: 343 FSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           F         L   AE N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +
Sbjct: 122 FEAARTQVGELVTAAEKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGI 181

Query: 402 IEPN 405
              N
Sbjct: 182 DNLN 185


>gi|115380169|ref|ZP_01467199.1| iron-regulated protein A [Stigmatella aurantiaca DW4/3-1]
 gi|310820630|ref|YP_003952988.1| iron-regulated protein a [Stigmatella aurantiaca DW4/3-1]
 gi|115362826|gb|EAU62031.1| iron-regulated protein A [Stigmatella aurantiaca DW4/3-1]
 gi|309393702|gb|ADO71161.1| Iron-regulated protein A [Stigmatella aurantiaca DW4/3-1]
          Length = 366

 Score =  223 bits (569), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 75/416 (18%), Positives = 147/416 (35%), Gaps = 80/416 (19%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLV 59
           +   + + +V            +   ++++ ++A  +    Y+        LD+A   L 
Sbjct: 11  LALTSALVLVSCSDDEGSGPTDSTFDKQIVVHFADDVIVPTYQQLAARLEALDTASNALA 70

Query: 60  TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYG 119
            +P+ + L  AR  W  AR+P++QSE + FG      +D  +++WP++   +D V +   
Sbjct: 71  ASPSAERLTAARDAWFAARVPWEQSEGFLFGPVDSFGYDPAMDSWPVNRSDLDAVLA--- 127

Query: 120 KENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
                N  +                      +P+ +  L            G+H +E+LL
Sbjct: 128 ----GNAPF----------------------TPEYVGNLEE-------TLKGFHTVEYLL 154

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           + +D  T       +   DF           R  EYLK ++  L +    +  AW     
Sbjct: 155 FARDPSTGA----EKTVQDF---------TPREFEYLKAITLQLKNIGAALSNAWTQTVD 201

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGL----------------ILHDPEQ 283
                 +++ AG     +G TS    + AGE M  G+                   DPE 
Sbjct: 202 GRPP-YRNVFAGAGD--SGNTSYPSVQTAGEEMVGGIVNILDEVANGKIADPYDAKDPEL 258

Query: 284 EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKF 343
               F+ N+ + + N++  + ++Y G    + G    G S+ D +   N  L   I  + 
Sbjct: 259 VESQFAYNSLSDFSNNIRSVQNAYLG---HLPGATAKGPSLADFVKDANPELDTRIRQEL 315

Query: 344 SNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
           ++ +     +       E F + I + N      +      +     + +     L
Sbjct: 316 TDAITALSRIP------EPFRESIRDPNSADE--IEAAQEAIRKAQNTFQSDVAPL 363


>gi|294139363|ref|YP_003555341.1| hypothetical protein SVI_0592 [Shewanella violacea DSS12]
 gi|293325832|dbj|BAJ00563.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 339

 Score =  216 bits (549), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 71/399 (17%), Positives = 151/399 (37%), Gaps = 85/399 (21%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
           ++ N++ + ++  Y+T+A        +    +  A +TLV    + NL  A+  W  AR 
Sbjct: 1   MITNLTDDVIISGYSTLA--------IKGEEMFLASQTLVANKTQANLLAAQEAWKAARQ 52

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKII 139
           P++Q E + FG       D  +++WPL+   +  V +        N+ ++A+ I      
Sbjct: 53  PWEQGESHIFGPVDSLGIDPHLDSWPLNTTDLKTVLTD-------NSGFSADTI------ 99

Query: 140 VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
                                  G + ++  G+H +E+LL+G  +  N ++  +   +  
Sbjct: 100 ----------------------KGWNDDV-QGFHTMEYLLFGDGVADNQKDVADLTMS-- 134

Query: 200 DIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-----GPDGQATKDLMKDINAG--- 251
                         EYL  +S++     + +  +W     G  G+A  +L+K+       
Sbjct: 135 ------------EAEYLMGLSEVFRDYTKTLDDSWLISHDGQTGKAYGELVKNPGTADNT 182

Query: 252 --------LNSIITGMTSLS---YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
                   +  ++ GM  +     N    +         D  +    +S N+   + +++
Sbjct: 183 FYASQVGVIQELVNGMIGIVDEVGNGKIADPFGTSAATADTSKVESQYSWNSLTDFSDNI 242

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           IG+ + Y GE    + +      I D +   +  LA  ++ +  + +     +K    N 
Sbjct: 243 IGVRNVYQGELTGASDK----QGIIDFVKAGDEALALRVSSEIDDAIIKIQAIK--GSNN 296

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
             F Q I++   EG   ++  ++ L     SL    + L
Sbjct: 297 MPFRQAIAD--AEGRVRIQTAVDALSKLQASLESDVVPL 333


>gi|157960499|ref|YP_001500533.1| putative lipoprotein [Shewanella pealeana ATCC 700345]
 gi|157845499|gb|ABV85998.1| putative lipoprotein [Shewanella pealeana ATCC 700345]
          Length = 383

 Score =  216 bits (549), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 77/403 (19%), Positives = 149/403 (36%), Gaps = 85/403 (21%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            A  +V N++ + ++  Y+ +A        +    +  A +TLV TP + NLE A+  W 
Sbjct: 41  SATDMVANLTDDVIVAGYSNLA--------VRGEAMLQATQTLVATPTQANLEAAQAAWK 92

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR P++Q E + FG       D  +++WPL                        N    
Sbjct: 93  AARQPWEQGESHIFGPVDSLGIDPHLDSWPL------------------------NTTDL 128

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
           + ++ N    D   I            G + ++  G+H +E+LL+G  +  N +      
Sbjct: 129 TTVLANNAGFDAETIK-----------GWNDDV-QGFHTMEYLLFGDGVADNTKTISELT 176

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-----GPDGQATKDLMKDINA 250
                             +YL  ++++     + +  AW     G +G+A  +L+K+  A
Sbjct: 177 V--------------NERDYLMGLAEVFRDYTKTLDDAWLISHDGQNGKAYGELLKNSGA 222

Query: 251 GLNSIIT-----------GMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDNTYASY 296
             N+  +           GM  +     N    +     L   D  +    +S N+   +
Sbjct: 223 DGNTFYSSEVGVVEELVNGMIGIVDEVGNGKIADPFGESLAKADTSKVESQYSWNSLTDF 282

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDR 356
            ++++G+ + Y GE      +      I D +   N  LA  + D+  + +     +   
Sbjct: 283 SDNIVGVRNVYLGELEGNADK----QGIIDFVDAANPELATRVKDEIDDAISKIEAI--A 336

Query: 357 AENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            +N   F Q IS+   +G   ++  ++ L     SL    + L
Sbjct: 337 GDNNMPFRQAISD--ADGRVRIQTAVDALTKLQASLESDVLPL 377


>gi|170725155|ref|YP_001759181.1| putative lipoprotein [Shewanella woodyi ATCC 51908]
 gi|169810502|gb|ACA85086.1| putative lipoprotein [Shewanella woodyi ATCC 51908]
          Length = 381

 Score =  215 bits (548), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 74/402 (18%), Positives = 144/402 (35%), Gaps = 84/402 (20%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            A  ++ N++ + ++  YA++A             +  A +TLV+   + NL  A+  W 
Sbjct: 40  AATEMITNLTDDVIVSGYASLA--------TKGEEMLLATQTLVSNKTQANLLAAQEAWK 91

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR+P++Q E + FG       D  +++WPL                        N    
Sbjct: 92  AARLPWEQGESHIFGPVDSLGIDPHLDSWPL------------------------NTTDL 127

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
           + ++ +    D   I            G + ++  G+H +E+LL+G  +  N +      
Sbjct: 128 TTVLASNAGFDAETIK-----------GWNDDV-QGFHTMEYLLFGDGVADNEK------ 169

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP----DGQATKDLMKDINAG 251
                I   T        EYL  ++++     + +  AW       G+A  +L+K   + 
Sbjct: 170 ----AIAELTQA----ESEYLMGLAEVFRDYTKTLDDAWQVSHDGSGKAYGELVKTPGSE 221

Query: 252 LNSIIT-----------GMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
            N+  +           GM  +     N    +         D  +    +S N+   + 
Sbjct: 222 GNTFYSSQVGVIEELINGMIGIVDEVGNGKIADPFGTSAATADTSKVESQYSWNSLTDFS 281

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
           +++IG+ + Y GE      +      I D +   +  LA  +  +  + +     +    
Sbjct: 282 DNIIGVRNVYQGELTGAADK----QGIIDFVKAADEVLALRVGSEIDDAIIKIKAI--SG 335

Query: 358 ENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            N   F Q IS+   EG   V+  ++ L     SL    + L
Sbjct: 336 SNNMPFRQAISD--AEGRVRVQTAVDALTKLQTSLESDVLPL 375


>gi|313106900|ref|ZP_07793103.1| Insulin-cleaving metalloproteinase outer membrane [Pseudomonas
           aeruginosa 39016]
 gi|310879605|gb|EFQ38199.1| Insulin-cleaving metalloproteinase outer membrane [Pseudomonas
           aeruginosa 39016]
          Length = 188

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 56/184 (30%), Positives = 92/184 (50%), Gaps = 6/184 (3%)

Query: 230 MMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEID 286
           M   W     D    K   + ++ GL  +  GM SLS  ELAGERM + L  +  E E D
Sbjct: 1   MAGQWKAGVADNYRAKLEAEPVDTGLRKMFFGMGSLSLGELAGERMKVALEANSTEDEHD 60

Query: 287 CFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNT 346
           CFSD+T+ +   +   I + Y GEY R++G  + G S+ DL++  +      +    ++T
Sbjct: 61  CFSDDTHHTLFFNGKSIRNIYLGEYKRIDGSVVKGPSLADLVAKADAAANDTLKADLADT 120

Query: 347 MKDFHILKDRAEN-IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL--IE 403
                 + D AE     FDQMI+ +N +G + +R+ I  L+ QT ++ +    L +  ++
Sbjct: 121 EAKLQAIVDSAEKDGVHFDQMIAPDNKDGQQKIRDAIAALVKQTGAIEQAAGKLGIQDLK 180

Query: 404 PNRV 407
           P+  
Sbjct: 181 PDNA 184


>gi|91792084|ref|YP_561735.1| putative lipoprotein [Shewanella denitrificans OS217]
 gi|91714086|gb|ABE54012.1| imelysin. Metallo peptidase. MEROPS family M75 [Shewanella
           denitrificans OS217]
          Length = 387

 Score =  209 bits (533), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 70/405 (17%), Positives = 141/405 (34%), Gaps = 87/405 (21%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            A +++ N++ E ++  YA +A             L  A + L+ + ++ +L  A+  W 
Sbjct: 42  AATAMITNLTQEVIVTGYADLA--------AKGSELVLATQKLINSTSQADLVAAQDAWK 93

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR P++Q E + FG     + D  +++WPL                        N    
Sbjct: 94  AARQPWEQGESHIFGPVDSLSIDPHLDSWPL------------------------NTTDL 129

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
           S  +      D   I              + ++  G+H +E+LL+G  +  N ++     
Sbjct: 130 STQLTTAAGFDAETIKS-----------WNDDV-QGFHTMEYLLFGDGVADNTKDISELT 177

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG-------PDGQATKDLMKDI 248
                          +  EYL  ++++     + +  AW         + +   +L+   
Sbjct: 178 V--------------KEREYLIALAQVFRDHAKTLDDAWQINHKPDDANAKPYAELLSQP 223

Query: 249 N-----------AGLNSIITGMTSLS---YNELAGERMNLGLILHDPEQEIDCFSDNTYA 294
                       A +  +I GM  +     N    +     +   D  +    +S N+  
Sbjct: 224 GVDGNTVYSSELAVIEELINGMIGIVDEVGNGKISDPFGDSITSADTSKVESQYSWNSLT 283

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
            + N++ G+ + Y GE+     +      + D +S  + NLA  +  +  + +     + 
Sbjct: 284 DFANNIQGVRNVYQGEFTGNTDK----QGVKDFVSAADANLAVRVASEIDDAIIKIQAI- 338

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
               N   F Q I + N  G   ++  I+ L     SL    I L
Sbjct: 339 -SGSNSMPFRQAIKDAN--GRVRIQTAIDALTKLKTSLESDVIPL 380


>gi|163749167|ref|ZP_02156417.1| putative lipoprotein [Shewanella benthica KT99]
 gi|161331237|gb|EDQ02126.1| putative lipoprotein [Shewanella benthica KT99]
          Length = 388

 Score =  204 bits (518), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 73/404 (18%), Positives = 148/404 (36%), Gaps = 85/404 (21%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            A  ++ N++ + ++  Y+ +A        +    L  A +TLV    ++NL   +  W 
Sbjct: 44  AATEMITNLTDDVIVSGYSALA--------IKGDELLQATQTLVNNKTQENLLAVQDAWK 95

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR P++Q E + FG     + D  +++WPL                  N +   +++AN
Sbjct: 96  AARQPWEQGESHIFGPVDSLSIDPHLDSWPL------------------NTVDLISVLAN 137

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
                N    D   I            G + +I  G+H +E+LL+G  +  N +   +  
Sbjct: 138 -----NTGGFDADTIK-----------GWNDDI-QGFHTMEYLLFGDGVADNEKIVADLT 180

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG------PDGQATKDLMKDIN 249
            T                EYL  ++++ +S  + +  AW           A  + +K+  
Sbjct: 181 TT--------------ETEYLMGLAEVFLSYTKTLDDAWQISHDGQTGSYAYGEFVKNPG 226

Query: 250 AG-----------LNSIITGMTSLS---YNELAGERMNLGLILHDPEQEIDCFSDNTYAS 295
                        +  ++ GM ++     N    +     +   D       +S N+   
Sbjct: 227 TEWNNIYASQVGVIEELVNGMIAIVDEVGNGKIADPFGTSIATADTSLVESQYSWNSLTD 286

Query: 296 YLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKD 355
           + +++IG+ + Y GE    + +      I D +   +  LA  +  +  + +     +K 
Sbjct: 287 FSDNIIGVRNVYQGELTGASDK----QGIVDFVMAADVTLAARVGSEIDDAIIKIQAIK- 341

Query: 356 RAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
              N   F Q I++   +G   ++  I+ L     SL    + L
Sbjct: 342 -GSNNMPFRQAIAD--ADGRVKIQTAIDALSKLQASLTDEVLPL 382


>gi|289677764|ref|ZP_06498654.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae FF5]
          Length = 148

 Score =  199 bits (507), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 48/140 (34%), Positives = 75/140 (53%)

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+ 
Sbjct: 1   ERAGERMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLS 60

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
            L++  +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L
Sbjct: 61  SLVAKADPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAAL 120

Query: 386 ITQTESLRKIRIALDLIEPN 405
           + QT ++ +    L + + N
Sbjct: 121 VKQTGAIEQAAGKLGITDLN 140


>gi|330721294|gb|EGG99379.1| Iron-regulated protein A precursor [gamma proteobacterium IMCC2047]
          Length = 161

 Score =  197 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 57/157 (36%), Positives = 95/157 (60%), Gaps = 4/157 (2%)

Query: 255 IITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRM 314
           ++ GM SL+  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y G Y R+
Sbjct: 1   MLFGMGSLALGELAGERMKVALEANSAEDEHDCFSDNTHFSHFYNAQGIRNVYFGSYSRV 60

Query: 315 NGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE--NIESFDQMISENNP 372
           +G ++ G S+ +L++  +++ A +    F  T     ++ DRAE  N   FDQMI+E N 
Sbjct: 61  DGSELTGPSLAELVAAKSKDAAAQAQAAFDKTSTSLQVMVDRAEAKNGMKFDQMIAEGNA 120

Query: 373 EGNKIVRNLINDLITQTESLRKIRIALDL--IEPNRV 407
           EG +I+RN I  L+ +T+++ ++   +D+  ++P+  
Sbjct: 121 EGEEIIRNAIVALVEETQAIERVAQVIDVSNLQPDTA 157


>gi|42522171|ref|NP_967551.1| Iron-regulated protein A precursor [Bdellovibrio bacteriovorus
           HD100]
 gi|39574702|emb|CAE78544.1| Iron-regulated protein A precursor [Bdellovibrio bacteriovorus
           HD100]
          Length = 361

 Score =  196 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 79/400 (19%), Positives = 151/400 (37%), Gaps = 83/400 (20%)

Query: 25  SLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           + ++++ + +  +  A Y D       L +A++ L  + N++NL+ A+  W  ARIP++ 
Sbjct: 22  TNKEIINHVSYNVILATYNDLATKTAELSAAVDALAASTNQENLDKAQAAWRAARIPWES 81

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           SE + FG       D  ++ WPL++  +D V SS                          
Sbjct: 82  SESFLFGPVDSLGIDPLLDTWPLNKLDLDSVMSSNR------------------------ 117

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
                 I+ DL+R L       TN+  G+H +E+LL+G    +N +              
Sbjct: 118 -----KITVDLVRALG------TNL-QGFHTLEYLLFGDGKVSNTKPA------------ 153

Query: 204 CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG----PDGQAT-------------KDLMK 246
                  +++EYLK  +++L     E+  AW     P+  A               +   
Sbjct: 154 --ASLTAKQLEYLKASAQLLAEHTAELAHAWTTNYDPENPAAPGYVKVISTPGLNNEFYS 211

Query: 247 DINAGLNSIITGMTSLSYNELAGERMN--LGLILHDPEQE--IDCFSDNTYASYLNDVIG 302
              A +   + GM  +  +E+A  +M+  +G  +           F+ N+   + +++  
Sbjct: 212 SERAVMEEFVQGMMGIV-DEVANGKMSDPMGADIGSANMALVESPFAWNSLKDFQHNIRS 270

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           + S YTG Y         G  +  L+   + +LA  +     N +     ++        
Sbjct: 271 VYSIYTGHYKNN-----KGPGVKALVEKVDASLAARVEADILNCIALIEAIRPAG--GGD 323

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDL 401
           F Q I   +  G    +  I  L     +L  ++   LD+
Sbjct: 324 FGQAIFTKD--GRARTQAAIEALNALHATLESEVLPTLDM 361


>gi|114561991|ref|YP_749504.1| putative lipoprotein [Shewanella frigidimarina NCIMB 400]
 gi|114333284|gb|ABI70666.1| putative lipoprotein [Shewanella frigidimarina NCIMB 400]
          Length = 387

 Score =  193 bits (491), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 66/405 (16%), Positives = 139/405 (34%), Gaps = 87/405 (21%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            A  ++ N++ + ++  YA +A       L     L S +        + +L  A+  W 
Sbjct: 43  VATEMITNLTDDVIVAGYADLAAKGDALLLATQTLLTSTV--------QADLVAAQNAWK 94

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR P++Q E + FG     + D  +++WPL                        N    
Sbjct: 95  SARQPWEQGESHIFGPVDSLSIDPHLDSWPL------------------------NTTDL 130

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
              + N    D   I            G + ++  G+H +E+LL+G  + +N +   +  
Sbjct: 131 QTQLANSNGFDADTIK-----------GWNDDV-QGFHTMEYLLFGDGVNSNTKLIADLS 178

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG-------PDGQATKDLMKDI 248
                          +  EYL  ++++      ++  AW         + +   +L+K  
Sbjct: 179 --------------TKEREYLIALAEVFRDYTTQLDDAWQVSHNPQDANAKPYAELLKTP 224

Query: 249 NAGLNSIIT-----------GMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDNTYA 294
               N+I +           GM  +     N    +     L   D  +    +S N+  
Sbjct: 225 GDATNTIYSSQLAVIEELINGMIGIVDEVGNGKIADPFGESLTTADTSKVESQYSWNSLT 284

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
            + N++IG+ + Y GE+     +      + D ++  +  LA  +  +  + +     + 
Sbjct: 285 DFSNNIIGVRNVYQGEFTGGADK----QGLIDFVTAADATLATRVASEIDDAILKIQAI- 339

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
                   F Q I +   +G    +  ++ L     +L+   + L
Sbjct: 340 -SGSTSMPFRQAILD--ADGRARTQVAVDALTKLQTTLQSDVLPL 381


>gi|164454447|dbj|BAF96780.1| iron regulated protein [Shewanella livingstonensis]
          Length = 387

 Score =  193 bits (491), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 66/405 (16%), Positives = 139/405 (34%), Gaps = 87/405 (21%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            A  ++ N++ + ++  YA +A       L     L S +        + +L  A+  W 
Sbjct: 43  VATEMITNLTDDVIVAGYADLAAKGDALLLATQTLLTSTV--------QADLVAAQNAWK 94

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR P++Q E + FG     + D  +++WPL                        N    
Sbjct: 95  SARQPWEQGESHIFGPVDSLSIDPHLDSWPL------------------------NTTDL 130

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
              + N    D   I            G + ++  G+H +E+LL+G  + +N +   +  
Sbjct: 131 QTQLANSNGFDADTIK-----------GWNDDV-QGFHTMEYLLFGDGVNSNTKLIADLS 178

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG-------PDGQATKDLMKDI 248
                          +  EYL  ++++      ++  AW         + +   +L+K  
Sbjct: 179 --------------SKEREYLIALAEVFRDYTTQLDDAWQVSHNPQDANAKPYAELLKTP 224

Query: 249 NAGLNSIIT-----------GMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDNTYA 294
               N+I +           GM  +     N    +     L   D  +    +S N+  
Sbjct: 225 GDATNTIYSSQLAVIEELINGMIGIVDEVGNGKIADPFGESLTTADTSKVESQYSWNSLT 284

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
            + N++IG+ + Y GE+     +      + D ++  +  LA  +  +  + +     + 
Sbjct: 285 DFSNNIIGVRNVYQGEFTGGADK----QGLIDFVTAADATLATRVASEIDDAILKIQAI- 339

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
                   F Q I +   +G    +  ++ L     +L+   + L
Sbjct: 340 -SGSTSMPFRQAILD--ADGRARTQVAVDALTKLQTTLQSDVLPL 381


>gi|152999473|ref|YP_001365154.1| putative lipoprotein [Shewanella baltica OS185]
 gi|151364091|gb|ABS07091.1| putative lipoprotein [Shewanella baltica OS185]
          Length = 386

 Score =  182 bits (461), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 58/343 (16%), Positives = 120/343 (34%), Gaps = 79/343 (23%)

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R+P++Q E + FG     + D  +++WPL                        N      
Sbjct: 96  RLPWEQGESHIFGPVDSLSIDPHLDSWPL------------------------NTTDLQT 131

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYT 197
            +      D   I            G + ++  G+H IEFLL+G  +  N +        
Sbjct: 132 QLNTNSGFDAETIK-----------GWNDDV-QGFHTIEFLLFGDGVNGNTKPISQL--- 176

Query: 198 DFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD-------GQATKDLMKDINA 250
                        +  EYL  ++++     +++  AW  +        +   +L+K+   
Sbjct: 177 -----------TAKEREYLIALAEVFRDYTKQLDDAWQINHNPQDTAAKPYAELLKNPGV 225

Query: 251 GLNSIIT-----------GMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDNTYASY 296
             N+I +           GM ++     N    +     L   D  +    +S N+   +
Sbjct: 226 AGNTIYSSQLAVVEELINGMIAIVDEVGNGKIADPFGDSLATADTSKVESQYSWNSLDDF 285

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDR 356
            N++IG+ + Y GE+   +        I + ++  + NLA  ++ +  + +     +   
Sbjct: 286 ANNIIGVRNVYQGEFTGNSDR----QGIINFVAAADANLATRVSSEIDDAIIKIRAI--A 339

Query: 357 AENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
             N + F Q I ++   G   ++  ++ L     +L    I L
Sbjct: 340 GSNQQPFRQAIKDD--AGRARIQVAVDALTKLKTTLESDVIPL 380


>gi|71281563|ref|YP_267444.1| putative lipoprotein [Colwellia psychrerythraea 34H]
 gi|71147303|gb|AAZ27776.1| putative lipoprotein [Colwellia psychrerythraea 34H]
          Length = 381

 Score =  181 bits (460), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 66/377 (17%), Positives = 134/377 (35%), Gaps = 76/377 (20%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A Y++    A     A + L  T  ++NL  A+  W   R+ ++Q E + FG    
Sbjct: 50  DVIVAGYKNLNDEAAVYLLATQNLANTATEENLAAAQQAWKDVRVHWEQGESHIFGPVDA 109

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
            + D  ++ WPL+              + +  L T +    +++     ++         
Sbjct: 110 LSIDPHLDTWPLN------------TSDLQALLNTQSGFNATQLKAFNDDV--------- 148

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
                           G+H +EFLL+G  +  N +  G                     E
Sbjct: 149 ---------------QGFHTMEFLLFGDGVADNEKAIGEMTAL--------------ERE 179

Query: 215 YLKVVSKILVSDLEEMMKAWG-------PDGQATKDLMKDINAGL--------NSIITGM 259
           YL   +++  S  + +  AW         +  A KDL+   +  +          +I GM
Sbjct: 180 YLSAAAEVFKSHTQTLFDAWTVANDPNDANSPAYKDLLLTPDNEVYSSSLGVVQELINGM 239

Query: 260 TSLS---YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
             +     N    E     +   D  +    +S N+ A + +++ G+ + Y GE++    
Sbjct: 240 IGIVDEVGNGKISEPFGSSIDNIDTTKVESQYSWNSLADFTDNIQGVQNVYRGEFLGQAD 299

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
           +      I D ++  +  +A  ++ +  + +     +    +N   F Q I  N+ +   
Sbjct: 300 KT----GIIDFVTAADAAIATRVDTEIVDAIAAIKAV--AGDNDLPFRQAI--NDADARV 351

Query: 377 IVRNLINDLITQTESLR 393
            ++  I+ L T   SL 
Sbjct: 352 RIQTAIDKLTTLQTSLE 368


>gi|160874091|ref|YP_001553407.1| putative lipoprotein [Shewanella baltica OS195]
 gi|160859613|gb|ABX48147.1| putative lipoprotein [Shewanella baltica OS195]
 gi|315266324|gb|ADT93177.1| Peptidase M75, Imelysin [Shewanella baltica OS678]
          Length = 386

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 58/343 (16%), Positives = 119/343 (34%), Gaps = 79/343 (23%)

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R+P++Q E + FG     + D  +++WPL                        N      
Sbjct: 96  RLPWEQGESHIFGPVDSLSIDPHLDSWPL------------------------NTTDLQT 131

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYT 197
            +      D   I            G + ++  G+H IEFLL+G  +  N +        
Sbjct: 132 QLNTNSGFDAETIK-----------GWNDDV-QGFHTIEFLLFGDGVNGNTKPISQL--- 176

Query: 198 DFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG-------PDGQATKDLMKDINA 250
                        +  EYL  ++++     +++  AW           +   +L+K+   
Sbjct: 177 -----------TAKEREYLIALAEVFRDYTKQLDDAWQINHNPQDAAAKPYAELLKNPGV 225

Query: 251 GLNSIIT-----------GMTSL---SYNELAGERMNLGLILHDPEQEIDCFSDNTYASY 296
             N+I +           GM ++     N    +     L   D  +    +S N+   +
Sbjct: 226 AGNTIYSSQLAVVEELINGMIAIVDEVGNGKIADPFGDSLATADTSKVESQYSWNSLDDF 285

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDR 356
            N++IG+ + Y GE+   +        I + ++  + NLA  ++ +  + +     +   
Sbjct: 286 ANNIIGVRNVYQGEFTGNSDR----QGIINFVAAADANLATRVSSEIDDAIIKIRAI--A 339

Query: 357 AENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
             N + F Q I ++   G   ++  ++ L     +L    I L
Sbjct: 340 GSNQQPFRQAIKDD--AGRARIQVAVDALTKLKTTLESDVIPL 380


>gi|113953796|ref|YP_730707.1| Iron-regulated protein A precursor [Synechococcus sp. CC9311]
 gi|113881147|gb|ABI46105.1| Iron-regulated protein A precursor, putative [Synechococcus sp.
           CC9311]
          Length = 335

 Score =  177 bits (448), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 79/368 (21%), Positives = 153/368 (41%), Gaps = 70/368 (19%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
            ++   T  S A     +VS   V      +    Y+  +   + L+ A++ LV  PN  
Sbjct: 19  TVTSACTSQSQAGPTDQDVSSALV----NDVVIPSYKKLVSGTKKLNQALQVLVKDPNPA 74

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
           NL+ AR +W ++R  ++ +E + +G    + +D K++ WP                    
Sbjct: 75  NLKLARDEWKKSRNTWEVTETWAYGPAETEDFDPKLDDWP-------------------- 114

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
                         V++KE+  ++   D  ++  + N +DT    G+H IE++++G    
Sbjct: 115 --------------VSDKELAEALSEKDFTKE--KFNALDT-TGRGFHGIEYVIFGN--- 154

Query: 186 TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-GPDGQATKDL 244
                 G+ P    D+         +++ YL++  + L S+ ++++ AW GP+G    D+
Sbjct: 155 ------GDTPVEASDL-------TTQQLAYLRIAGENLKSNAKQLLAAWSGPEGFGKADV 201

Query: 245 MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
             D    +N I+ GM     +E++  ++   L     E E   FS NT A  L+++ G+ 
Sbjct: 202 EADPAKTVNDILEGMAGC-LDEVSNTKLGEALASGKGELE-STFSGNTGADVLSNLQGVQ 259

Query: 305 ----SSYTGEYIRMNGEKIHGASIHDLIS--HNNRNLAQEINDKFS--NTMKDFHILKDR 356
                S   EY +    ++      +L +     + L   +NDK    +T K   +L + 
Sbjct: 260 LAWEKSKIQEYAKTKDAELSNQLTVELQTALAQAKELPTRLNDKLDNGDTQKQVKMLMEA 319

Query: 357 AENIESFD 364
                +FD
Sbjct: 320 ISK--AFD 325


>gi|126725744|ref|ZP_01741586.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2150]
 gi|126704948|gb|EBA04039.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2150]
          Length = 171

 Score =  175 bits (444), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/163 (45%), Positives = 103/163 (63%), Gaps = 5/163 (3%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           +++   +I   L + AL+    V    VL  YA IA A Y D+L+ A+ L +A+  LV  
Sbjct: 3   HYLLTTAIAVGLATPALA----VETTDVLDTYADIAAANYGDSLITAQRLQTAVNALVAD 58

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ +NL  AR  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  
Sbjct: 59  PSAENLTAARAAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGP 118

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANG 163
           ++EN     N+IAN    ++ ++ID + I+P LL   L  A+ 
Sbjct: 119 SDENAFAALNVIANPTFTLSGQDIDATSITPALLEDTLQEADE 161


>gi|256841757|ref|ZP_05547263.1| iron-regulated protein A [Parabacteroides sp. D13]
 gi|256736651|gb|EEU49979.1| iron-regulated protein A [Parabacteroides sp. D13]
          Length = 403

 Score =  167 bits (423), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 70/391 (17%), Positives = 143/391 (36%), Gaps = 89/391 (22%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           LP+ + +      +  V+  +   +A   Y+D L       +A++  + + +K +L +A 
Sbjct: 41  LPADSGTKPTEDQMSAVVATFVDEVALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADAC 100

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W   R+P++QSE + FG   +   D  +++WPLD+  I+                   
Sbjct: 101 DAWRAVRVPWEQSEAFLFGVADLAQLDPSLDSWPLDKNGIE------------------E 142

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
           IIA  +       +D              A     N+  G+H  E +L+   L    R+ 
Sbjct: 143 IIATGEFSKISGAVD------------EDAEDGPQNL-RGFHTAEKMLF---LDGEPRDL 186

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW----------------- 234
              P+             +  +EYLK+VS+ ++SD +++   W                 
Sbjct: 187 ETSPF------------AKNELEYLKLVSERMLSDTQDLYNGWLKGLGTSDVPSSYAEAM 234

Query: 235 -GPDGQATKDLMKDINAGLNSIITGMTSLSY--NELAGERMNLGL--------ILHDPEQ 283
              DG A    + ++   +  ++ G   ++   NE+   ++   +           DP  
Sbjct: 235 KKHDGSAYS--IGNVYQAIELMLNGNNGMAGISNEVGSAKITDPVTAWNGSNKDATDPNN 292

Query: 284 -----EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQE 338
                    +S N+   Y N+++ I ++Y G    ++ E    +S+H L    N  L   
Sbjct: 293 PGVLAVESWYSWNSLDDYKNNIVSIKNAYFGG-RDLDEESASESSLHALTKMINPTLDSL 351

Query: 339 INDKFSNTMKDFHILKDRAENIESFDQMISE 369
           +  +   T+   + +         F   + +
Sbjct: 352 MVVQIDKTIDAINAI------GYPFRNNLGD 376


>gi|301310995|ref|ZP_07216924.1| imelysin superfamily [Bacteroides sp. 20_3]
 gi|300831058|gb|EFK61699.1| imelysin superfamily [Bacteroides sp. 20_3]
          Length = 403

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 69/391 (17%), Positives = 143/391 (36%), Gaps = 89/391 (22%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           LP+ + +      +  V+  +   +A   Y+D L       +A++  + + +K +L +A 
Sbjct: 41  LPADSGAKPTEDQMSAVVATFVDEVALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADAC 100

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W   R+P++QSE + FG   +   D  +++WPLD+  I+                   
Sbjct: 101 DAWRAVRVPWEQSEAFLFGVADLAQLDPSLDSWPLDKNGIE------------------E 142

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
           IIA  +       +D              A     N+  G+H  E +L+   L    R+ 
Sbjct: 143 IIATGEFSKISGAVD------------EDAEDGPQNL-RGFHTAEKMLF---LDGEPRDL 186

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW----------------- 234
              P+             +  +EYLK+VS+ ++SD +++   W                 
Sbjct: 187 ETSPF------------AKNELEYLKLVSERMLSDTQDLYNGWLKGLGTSDVPSSYAEAM 234

Query: 235 -GPDGQATKDLMKDINAGLNSIITGMTSLSY--NELAGERMNLGL--------ILHDPEQ 283
              DG A    + ++   +  ++ G   ++   NE+   ++   +           DP  
Sbjct: 235 KKHDGSAYS--IGNVYQAIELMLNGNNGMAGISNEVGSAKITDPVTAWNGSNKDATDPNN 292

Query: 284 -----EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQE 338
                    +S N+   Y N+++ I ++Y G    ++ +    +S+H L    N  L   
Sbjct: 293 PGVLAVESWYSWNSLDDYKNNIVSIKNAYFGG-RDLDEKSASESSLHALTKMINPTLDSL 351

Query: 339 INDKFSNTMKDFHILKDRAENIESFDQMISE 369
           +  +   T+   + +         F   + +
Sbjct: 352 MVVQIDKTIDAINAI------GYPFRNNLGD 376


>gi|150009201|ref|YP_001303944.1| putative iron-regulated protein A [Parabacteroides distasonis ATCC
           8503]
 gi|298377011|ref|ZP_06986965.1| imelysin superfamily protein [Bacteroides sp. 3_1_19]
 gi|149937625|gb|ABR44322.1| putative iron-regulated protein A precursor [Parabacteroides
           distasonis ATCC 8503]
 gi|298265995|gb|EFI07654.1| imelysin superfamily protein [Bacteroides sp. 3_1_19]
          Length = 403

 Score =  166 bits (420), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 70/391 (17%), Positives = 143/391 (36%), Gaps = 89/391 (22%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           LP+ + +      +  V+  +   +A   Y+D L       +A++  + + +K +L +A 
Sbjct: 41  LPADSGAKPTEDQMSAVVATFVDEVALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADAC 100

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W   R+P++QSE + FG   +   D  +++WPLD+  I+                   
Sbjct: 101 DAWRAVRVPWEQSEAFLFGVADLAQLDPSLDSWPLDKNGIE------------------E 142

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
           IIA  +       +D              A     N+  G+H  E +L+   L    R+ 
Sbjct: 143 IIATGEFSKISGAVD------------EDAEDGPQNL-RGFHTAEKMLF---LDGEPRDL 186

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW----------------- 234
              P+             +  +EYLK+VS+ ++SD +++   W                 
Sbjct: 187 ETSPF------------AKNELEYLKLVSERMLSDTQDLYNGWLKGLGTSDVPSSYAEAM 234

Query: 235 -GPDGQATKDLMKDINAGLNSIITGMTSLSY--NELAGERMNLGL--------ILHDPEQ 283
              DG A    + ++   +  ++ G   ++   NE+   ++   +           DP  
Sbjct: 235 KKHDGSAYS--IGNVYQAIELMLNGNNGMAGISNEVGSAKITDPVTAWNGSNKDATDPNN 292

Query: 284 -----EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQE 338
                    +S N+   Y N+++ I ++Y G    ++ E    +S+H L    N  L   
Sbjct: 293 PGVLAVESWYSWNSLDDYKNNIVSIKNAYFGG-RDLDEESASESSLHALTKMINPTLDSL 351

Query: 339 INDKFSNTMKDFHILKDRAENIESFDQMISE 369
           +  +   T+   + +         F   + +
Sbjct: 352 MVVQIDKTIDAINAI------GYPFRNNLGD 376


>gi|255015808|ref|ZP_05287934.1| putative iron-regulated protein A precursor [Bacteroides sp. 2_1_7]
          Length = 395

 Score =  165 bits (419), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 70/391 (17%), Positives = 143/391 (36%), Gaps = 89/391 (22%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           LP+ + +      +  V+  +   +A   Y+D L       +A++  + + +K +L +A 
Sbjct: 33  LPADSGTKPTEDQMSAVVATFVDEVALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADAC 92

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W   R+P++QSE + FG   +   D  +++WPLD+  I+                   
Sbjct: 93  DAWRAVRVPWEQSEAFLFGVADLAQLDPSLDSWPLDKNGIE------------------E 134

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
           IIA  +       +D              A     N+  G+H  E +L+   L    R+ 
Sbjct: 135 IIATGEFSKISGAVD------------EDAEDGPQNL-RGFHTAEKMLF---LDGEPRDL 178

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW----------------- 234
              P+             +  +EYLK+VS+ ++SD +++   W                 
Sbjct: 179 ETSPF------------AKNELEYLKLVSERMLSDTQDLYNGWLKGLGTSDVPSSYAEAM 226

Query: 235 -GPDGQATKDLMKDINAGLNSIITGMTSLSY--NELAGERMNLGL--------ILHDPEQ 283
              DG A    + ++   +  ++ G   ++   NE+   ++   +           DP  
Sbjct: 227 KKHDGSAYS--IGNVYQAIELMLNGNNGMAGISNEVGSAKITDPVTAWNGSNKDATDPNN 284

Query: 284 -----EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQE 338
                    +S N+   Y N+++ I ++Y G    ++ E    +S+H L    N  L   
Sbjct: 285 PGVLAVESWYSWNSLDDYKNNIVSIKNAYFGG-RDLDEESASESSLHALTKMINPTLDSL 343

Query: 339 INDKFSNTMKDFHILKDRAENIESFDQMISE 369
           +  +   T+   + +         F   + +
Sbjct: 344 MVVQIDKTIDAINAI------GYPFRNNLGD 368


>gi|262384087|ref|ZP_06077223.1| iron-regulated protein A [Bacteroides sp. 2_1_33B]
 gi|262294985|gb|EEY82917.1| iron-regulated protein A [Bacteroides sp. 2_1_33B]
          Length = 392

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 70/391 (17%), Positives = 143/391 (36%), Gaps = 89/391 (22%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           LP+ + +      +  V+  +   +A   Y+D L       +A++  + + +K +L +A 
Sbjct: 30  LPADSGAKPTEDQMSAVVATFVDEVALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADAC 89

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W   R+P++QSE + FG   +   D  +++WPLD+  I+                   
Sbjct: 90  DAWRAVRVPWEQSEAFLFGVADLAQLDPSLDSWPLDKNGIE------------------E 131

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
           IIA  +       +D              A     N+  G+H  E +L+   L    R+ 
Sbjct: 132 IIATGEFSKISGAVD------------EDAEDGPQNL-RGFHTAEKMLF---LDGEPRDL 175

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW----------------- 234
              P+             +  +EYLK+VS+ ++SD +++   W                 
Sbjct: 176 ETSPF------------AKNELEYLKLVSERMLSDTQDLYNGWLKGLGTSDVPSSYAEAM 223

Query: 235 -GPDGQATKDLMKDINAGLNSIITGMTSLSY--NELAGERMNLGL--------ILHDPEQ 283
              DG A    + ++   +  ++ G   ++   NE+   ++   +           DP  
Sbjct: 224 KKHDGSAYS--IGNVYQAIELMLNGNNGMAGISNEVGSAKITDPVTAWNGSNKDATDPNN 281

Query: 284 -----EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQE 338
                    +S N+   Y N+++ I ++Y G    ++ E    +S+H L    N  L   
Sbjct: 282 PGVLAVESWYSWNSLDDYKNNIVSIKNAYFGG-RDLDEESASESSLHALTKMINPTLDSL 340

Query: 339 INDKFSNTMKDFHILKDRAENIESFDQMISE 369
           +  +   T+   + +         F   + +
Sbjct: 341 MVVQIDKTIDAINAI------GYPFRNNLGD 365


>gi|86609711|ref|YP_478473.1| iron-regulated protein A [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558253|gb|ABD03210.1| putative iron-regulated protein A [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 410

 Score =  162 bits (411), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 66/343 (19%), Positives = 122/343 (35%), Gaps = 73/343 (21%)

Query: 14  PSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           P+  LS        ++L ++A  +    YE  +   + L  AI+  V  PN + L+ AR 
Sbjct: 76  PAVVLSPEQRFQDRQILLDFADQVVIPAYEQLVADTQALSQAIQAFVQDPNAQTLQAARQ 135

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W  ARI +++SE + FG       D  ++ WPL+E  +  V +S               
Sbjct: 136 AWSVARITWEESEAFAFGPAAYLGLDADLDEWPLNEVEVLEVLNS--------------- 180

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
                            ++P+ + +L            G+H + FLL+G D         
Sbjct: 181 --------------GDPLTPETVAELESGQ-------KGFHAVAFLLFGVD--------N 211

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG----QATKDLMKDI 248
           N+   DF           R  EYL  +  +L     +++K+W           ++ +K  
Sbjct: 212 NKSLQDF---------TERDREYLAALGPVLADTAAKLLKSWTEGVQGLPAFREEWVKAG 262

Query: 249 N---------AGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
                     A    I  G+  +  +EL   ++       +P      F+ ++   +  +
Sbjct: 263 EGSKSYLTLQAAAEEIAQGILGM-LDELGKVKIGEAFAQQNPFLLESRFAHHSLPEFQAN 321

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDK 342
           V  +  +Y G +         G  +   +   N NL  +I  +
Sbjct: 322 VRSVQYAYLGGFR-----DRKGRGLSQFVRDINPNLDSQIQSE 359


>gi|86607223|ref|YP_475986.1| iron-regulated protein A [Synechococcus sp. JA-3-3Ab]
 gi|86555765|gb|ABD00723.1| putative iron-regulated protein A [Synechococcus sp. JA-3-3Ab]
          Length = 410

 Score =  162 bits (410), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 66/343 (19%), Positives = 122/343 (35%), Gaps = 73/343 (21%)

Query: 14  PSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           P+  LS        ++L ++A  +    YE  +   + L  AI+  V  PN + L+ AR 
Sbjct: 76  PAVVLSPEQRFQDRQILLDFADQVVIPAYEQLVADTQALSQAIQAFVQDPNAQTLQAARQ 135

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W  ARI +++SE + FG       D  ++ WPL+E  +  V +S               
Sbjct: 136 AWSVARITWEESEAFAFGPAAYLGLDADLDEWPLNEVEVLEVLNS--------------- 180

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
                            ++P+ + +L            G+H + FLL+G D         
Sbjct: 181 --------------GDPLTPETVAELESGQ-------KGFHAVAFLLFGVD--------N 211

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG----QATKDLMKDI 248
           N+   DF           R  EYL  +  +L     +++K+W           ++ +K  
Sbjct: 212 NKSLQDF---------TERDREYLAALGPVLADTAAKLLKSWTEGVQGLPAFREEWVKAG 262

Query: 249 N---------AGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
                     A    I  G+  +  +EL   ++       +P      F+ ++   +  +
Sbjct: 263 EGSKSYLTLQAAAEEIAQGILGM-LDELGKVKIGEAFAQQNPFLLESRFAHHSLPEFQAN 321

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDK 342
           V  +  +Y G +         G  +   +   N NL  +I  +
Sbjct: 322 VRSVQYAYLGGFR-----DRKGRGLSQFVRDINPNLDSQIQSE 359


>gi|297567103|ref|YP_003686075.1| peptidase M75, Imelysin [Meiothermus silvanus DSM 9946]
 gi|296851552|gb|ADH64567.1| Peptidase M75, Imelysin [Meiothermus silvanus DSM 9946]
          Length = 425

 Score =  160 bits (406), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 82/400 (20%), Positives = 138/400 (34%), Gaps = 76/400 (19%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           + I+  V  L + A +       + +      +    Y + L   + L+ A  +L   P 
Sbjct: 1   MRILFAVVLLLASASAQADYPLAKSLADG---VILPTYTELLARLKGLEGAARSLKAKPT 57

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
             NLE AR  W  ARIPY+++E + FG   +  +D  ++ WP+D            +E  
Sbjct: 58  PANLEAARTAWRAARIPYERAEGFAFG--PIGDYDPLLDTWPID------------REGL 103

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
           E  L  +  ++ +       E+                         G+H +E+LLWG  
Sbjct: 104 EALLKGSQPLSAADFAKLPSEV------------------------RGFHAVEYLLWG-- 137

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT-- 241
           LK   +    RP               R ++Y+++ S  +V   +  + AW     A   
Sbjct: 138 LKGQKKAAQLRP---------------RELQYIELASADMVRQAKANLTAWQQGFYARFT 182

Query: 242 --KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
              DL K   A L+ II G+  +   E+A E++   L  +DP      FS N+   Y  D
Sbjct: 183 RPSDLYKSEAAALDEIIGGLVGII-AEIADEKLGNPLQANDPLVAESPFSGNSLEDYRQD 241

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
           + G    Y G            A I   I+  +      I   F    +    +      
Sbjct: 242 LEGARRYYLG-----GQPASQKAGIGGWIAAQDPGSHAAILRAFDIAKEALAAIPSPLSE 296

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
                   +   P+G   ++     L      L    + L
Sbjct: 297 --------ALQTPKGQARIKTAQAALQNLRGLLESRAVGL 328


>gi|94499739|ref|ZP_01306275.1| hypothetical protein RED65_14497 [Oceanobacter sp. RED65]
 gi|94427940|gb|EAT12914.1| hypothetical protein RED65_14497 [Oceanobacter sp. RED65]
          Length = 433

 Score =  149 bits (377), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 78/396 (19%), Positives = 144/396 (36%), Gaps = 91/396 (22%)

Query: 18  LSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA 77
           +     V+ E++L       + +  DAL  A+TLDS I +L+  PN  +LE ++  W +A
Sbjct: 36  VQAKAEVNSEQLLSAMNLYVYTQLSDALNKAQTLDSEITSLLHHPNPVSLEQSQNAWQQA 95

Query: 78  -----------RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
                      R+P  +   Y   N+  D   +++++WP++ G+IDY+            
Sbjct: 96  YEGYVKVSFLHRVPRFEKPQYYENNRTYDDIRQRIDSWPIEPGYIDYL------------ 143

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTN-------ITTGYHVIEFLL 179
                            +  LS I  DL  K+   N +D +        + G+H +EFLL
Sbjct: 144 ----------------PQYPLSGIVNDLTLKISLDNLVDQHGFSDPRYASIGFHPLEFLL 187

Query: 180 WGQDLKTNVRE------------------------PGNRPYTDFDIGNCTGG-------- 207
           + ++ + + ++                          +  + D DI +            
Sbjct: 188 FAENSERSAKDFIPQENSMEVVATEPEIQAETQAINSDAEHVDSDIKDIRHAQPVINGPQ 247

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGP-DGQATKDLMK-DINAGLNSIITGMTSLSYN 265
           +  RR +YL+++S  LV  L+ +   W P +G   K   + D  A + S+  G+      
Sbjct: 248 NHNRRRDYLRILSADLVKQLQALTDRWDPANGYYAKQWRQPDHAANVASLYQGLVDALQT 307

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           +L  +   +             F+    A+    + GI +    E               
Sbjct: 308 DLLEQHFQVLATQKPLYDLRSPFAQQDTANMQALLTGIENILLAE-----------NGFI 356

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
             I   +  LA +I  +F     D   L +  E +E
Sbjct: 357 KEIRLQDAELADKIKAQFERLKYDMKQLPNNWETLE 392


>gi|56750104|ref|YP_170805.1| Iron-regulated protein A [Synechococcus elongatus PCC 6301]
 gi|81300271|ref|YP_400479.1| imelysin [Synechococcus elongatus PCC 7942]
 gi|124907|sp|P12608|IRPA_SYNE7 RecName: Full=Iron-regulated protein A; Flags: Precursor
 gi|280209|pir||A43648 iron-regulated protein A - Synechococcus sp
 gi|154525|gb|AAA27316.1| iron-regulated protein [Synechococcus sp.]
 gi|56685063|dbj|BAD78285.1| Iron-regulated protein A precursor [Synechococcus elongatus PCC
           6301]
 gi|81169152|gb|ABB57492.1| imelysin. Metallo peptidase. MEROPS family M75 [Synechococcus
           elongatus PCC 7942]
          Length = 356

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 66/408 (16%), Positives = 145/408 (35%), Gaps = 94/408 (23%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
              ++ +F+      +++ N +++  +     +    Y      A  L+ A++T    P 
Sbjct: 29  CAGVATLFSACGQTQALITNQTIQGFVD---QVVVPSYVSVAAGATQLEQALQTYQQAPT 85

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
             NLE AR  W  AR  ++Q+E + FG    + +D  ++ WP+D   +    +   ++ E
Sbjct: 86  AANLEAARQAWRVARDRWEQTECFAFGPADSEGFDGAMDTWPIDRQGLKTAAAQPVEQRE 145

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
           ++                                             G+H IE LL+   
Sbjct: 146 DSR-------------------------------------------KGFHAIEELLFA-- 160

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQAT 241
                    +R                   ++L +++  L    + ++  W    D  A 
Sbjct: 161 --ATEPTLSDR-------------------QHLVILATDLTKQAQGLVTRWQQASDQPAY 199

Query: 242 KDLMKDI----------NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDN 291
           + ++             NA    I+ G+   S +E+A E++   L   +P++     S N
Sbjct: 200 RSVLLSAGSTDSAYPTLNAAGTEIVQGLVD-SLSEVASEKIGGPLETQEPDRFESFVSRN 258

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH 351
           T +   N+  G  + Y G+  R +G  +   S+   +   +  +AQ+++ +F+   +   
Sbjct: 259 TLSDLRNNWTGAWNVYRGQ--RSDG--VAAGSLQQRLQQQHPVIAQQLDQQFATARQALW 314

Query: 352 ILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            + +  E   +        +P G   V      +   +++L +  + L
Sbjct: 315 AIPEPIETNLA--------SPRGKVAVLTAQTAIAAVSDTLERQVLPL 354


>gi|332828530|gb|EGK01230.1| hypothetical protein HMPREF9455_02422 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 386

 Score =  144 bits (364), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 82/411 (19%), Positives = 138/411 (33%), Gaps = 107/411 (26%)

Query: 25  SLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTP--NKKNLENARLQWIRARIPY 81
              +VL+ Y   +    Y D    A TL  A++T  T+    + NL      W   RIP+
Sbjct: 38  DFTQVLKVYTDDVILPTYADMKNKAWTLYDAVQTFSTSTGRTQANLNAVCAAWRATRIPW 97

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
           +QSE   +G       D  +++WPL +G ID                   II +  I ++
Sbjct: 98  EQSESCLYGPADRLGLDPSLDSWPLKKGDID------------------KIINSGSITID 139

Query: 142 EKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
            K +D  +                     G+H IE+L++      N +     P +    
Sbjct: 140 -KIMDPGV--------------------HGFHTIEYLIF---SDGNPKVLSTTPLS---- 171

Query: 202 GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-------GPDGQATKDLMKDI------ 248
                      ++YL + ++ L +D   +  AW         D        +D       
Sbjct: 172 --------EAEIQYLVIATEYLRNDCIMLWAAWNGTQNISAKDQAVINTFDEDPTQYNFA 223

Query: 249 -----------------NAGLNSIITGMTSLSYNELAGERMN----LGLILHDPE---QE 284
                            +  +++II G   ++ +E+A +++     L L     E   + 
Sbjct: 224 YNFKNAITSSGVDLATMDDAIDNIIEGCAGIA-DEVAAQKIGAPRDLALDGRTDEAVLEV 282

Query: 285 IDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFS 344
              +S N+   Y N++I I +SY G   +    +    S+   +   N  L  EI     
Sbjct: 283 ESWYSWNSIDDYANNIISIRNSYFGGLNKTTSNR-SQHSMSVFVESKNAVLDAEITAAID 341

Query: 345 NTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKI 395
              K  +    R      F      NN  G K V   I+       S  KI
Sbjct: 342 KAYKAINEGMQR-----PF-----RNNLTGAK-VDAAIDACTDLQLSFEKI 381


>gi|313886593|ref|ZP_07820306.1| Imelysin [Porphyromonas asaccharolytica PR426713P-I]
 gi|332300889|ref|YP_004442810.1| Peptidase M75, Imelysin [Porphyromonas asaccharolytica DSM 20707]
 gi|312923949|gb|EFR34745.1| Imelysin [Porphyromonas asaccharolytica PR426713P-I]
 gi|332177952|gb|AEE13642.1| Peptidase M75, Imelysin [Porphyromonas asaccharolytica DSM 20707]
          Length = 381

 Score =  138 bits (349), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 61/407 (14%), Positives = 139/407 (34%), Gaps = 83/407 (20%)

Query: 15  SHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
           +  L       +++ ++    +    Y+     A  L    E L+  P+++ +  A  +W
Sbjct: 31  AKQLDPAQTALIKQFVEG---VVVPTYKSLADNAIELSGLCEELMKNPSQELVNKACKKW 87

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           + AR  ++ SE + +G       D  +++WPL +  +D                  NI+ 
Sbjct: 88  VSARAYWELSEAFLYGAAGDYNIDPHIDSWPLQKNQLD------------------NILK 129

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT------GYHVIEFLLWGQDLKTNV 188
           N                 DLL +L           +      G+H +E++++        
Sbjct: 130 N----------------KDLLDELKEEGPDAKGFASLGYGLLGFHAVEYMIF---RDGQP 170

Query: 189 REPGNRPYTDFDIGNCTGGHCRRRVEYLKVV-----------------SKIL--VSDLEE 229
           R+ G     +            R+   L+                   +++L  +   + 
Sbjct: 171 RKVGEITEPERIYNAAVAEDLARQAIRLEASWAGIDKVTADKKKTLEDAELLPTMDYGQL 230

Query: 230 MMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFS 289
           M+ A      +     K     L  I+ G + +S +E+   ++   +   +       +S
Sbjct: 231 MIAAGEQGNSSY----KSQKDALVQILQGASDIS-DEVGNTKITDPVNSGNVLDVESWYS 285

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
            N+   + +++  + ++Y   Y  ++G  +H  S+   ++  + +L +EI          
Sbjct: 286 WNSIEDFTDNLRSVRNAY---YGSLDGT-VHNHSLATYMAQQHPDLDKEIRTALD----- 336

Query: 350 FHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
            H +K  A     F   ++    E  K      N L+ Q ++  +  
Sbjct: 337 -HAIKTVAAMPAPFRNNLT---KEATKPAIEACNALLEQIDAAIEAV 379


>gi|294643044|ref|ZP_06720884.1| imelysin [Bacteroides ovatus SD CC 2a]
 gi|294810068|ref|ZP_06768739.1| imelysin [Bacteroides xylanisolvens SD CC 1b]
 gi|298482803|ref|ZP_07000986.1| iron-regulated protein A [Bacteroides sp. D22]
 gi|292641601|gb|EFF59779.1| imelysin [Bacteroides ovatus SD CC 2a]
 gi|294442672|gb|EFG11468.1| imelysin [Bacteroides xylanisolvens SD CC 1b]
 gi|298271003|gb|EFI12581.1| iron-regulated protein A [Bacteroides sp. D22]
          Length = 391

 Score =  133 bits (334), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 68/364 (18%), Positives = 133/364 (36%), Gaps = 71/364 (19%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             +       +  L+  +  Y   +    Y+D       L++A++ L T+ +  ++ NA 
Sbjct: 38  FNTPDSGTATDDELKAAVATYVDDVVIPTYQDMYNKVTALNTAVQKLSTSSSDNDVANAA 97

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W+ AR P+++SE + +G   ++  D  +++WPLD+G ID +  S   E+         
Sbjct: 98  DAWVAARKPWEKSEAFLYGPADLNKLDPSLDSWPLDKGGIDAILQSGNWEDAVGGDVDDG 157

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
             A +    N                             G+H  E+LL+         + 
Sbjct: 158 DDAPADAPQN---------------------------LRGFHTAEYLLF--------EDG 182

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ----ATKDLMKD 247
             +  TD D           ++ YLK V   +  D E ++K W         A KD MK 
Sbjct: 183 EAKKITDLD---------ANKIGYLKAVVGRMSKDTELLLKGWTEGKNLENGAYKDAMKA 233

Query: 248 INA--GLNSIITGMTSL---------SYNELAGERMNLGLI---LHDPEQ----EIDCFS 289
            N    +++I   +  +           NE+   ++   +      D E         +S
Sbjct: 234 PNGTYSISNIKQSVAMILNSDNGAEGIANEVGATKIGDPVDKWNSGDKEGGVLAVESWYS 293

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
            N+   Y +++  I ++Y   Y  ++G     AS+  ++   N  L   +  +   T+  
Sbjct: 294 WNSLDDYTDNIYSIRNAY---YGSLDGTVAS-ASLCSIMKKVNPTLNDMVVKQIQETITA 349

Query: 350 FHIL 353
            + +
Sbjct: 350 INDI 353


>gi|237713613|ref|ZP_04544094.1| iron-regulated protein A [Bacteroides sp. D1]
 gi|262406288|ref|ZP_06082837.1| iron-regulated protein A [Bacteroides sp. 2_1_22]
 gi|229446335|gb|EEO52126.1| iron-regulated protein A [Bacteroides sp. D1]
 gi|262354991|gb|EEZ04082.1| iron-regulated protein A [Bacteroides sp. 2_1_22]
          Length = 382

 Score =  132 bits (331), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 68/364 (18%), Positives = 133/364 (36%), Gaps = 71/364 (19%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             +       +  L+  +  Y   +    Y+D       L++A++ L T+ +  ++ NA 
Sbjct: 29  FNTPDSGTATDDELKAAVATYVDDVVIPTYQDMYNKVTALNTAVQKLSTSSSDNDVANAA 88

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W+ AR P+++SE + +G   ++  D  +++WPLD+G ID +  S   E+         
Sbjct: 89  DAWVAARKPWEKSEAFLYGPADLNKLDPSLDSWPLDKGGIDAILQSGNWEDAVGGDVDDG 148

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
             A +    N                             G+H  E+LL+         + 
Sbjct: 149 DDAPADAPQN---------------------------LRGFHTAEYLLF--------EDG 173

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ----ATKDLMKD 247
             +  TD D           ++ YLK V   +  D E ++K W         A KD MK 
Sbjct: 174 EAKKITDLD---------ANKIGYLKAVVGRMSKDTELLLKGWTEGKNLENGAYKDAMKA 224

Query: 248 INA--GLNSIITGMTSL---------SYNELAGERMNLGLI---LHDPEQ----EIDCFS 289
            N    +++I   +  +           NE+   ++   +      D E         +S
Sbjct: 225 PNGTYSISNIKQSVAMILNSDNGAEGIANEVGATKIGDPVDKWNSGDKEGGVLAVESWYS 284

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
            N+   Y +++  I ++Y   Y  ++G     AS+  ++   N  L   +  +   T+  
Sbjct: 285 WNSLDDYTDNIYSIRNAY---YGSLDGTVAS-ASLCSIMKKVNPTLNDMVVKQIQETITA 340

Query: 350 FHIL 353
            + +
Sbjct: 341 INDI 344


>gi|228471216|ref|ZP_04056029.1| putative iron-regulated protein A [Porphyromonas uenonis 60-3]
 gi|228307031|gb|EEK16113.1| putative iron-regulated protein A [Porphyromonas uenonis 60-3]
          Length = 372

 Score =  124 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 55/396 (13%), Positives = 124/396 (31%), Gaps = 100/396 (25%)

Query: 36  IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD 95
           +    Y+        L    + L+ +P+++ ++ A  +W+ AR  ++ SE   FG     
Sbjct: 40  VVVPTYKSLADNTIELSGICQELMKSPSQELVDKACKKWVEARAYWELSEAILFGAAGDY 99

Query: 96  TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLL 155
             D  +++WPL +  +D                  NI+ N                 DLL
Sbjct: 100 NIDPHIDSWPLQKNQLD------------------NILQN----------------KDLL 125

Query: 156 RKLHRANGIDTNITT------GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHC 209
            +L           +      G+H +E++++       V E                   
Sbjct: 126 DELKEEGADAKGFASLGYGLLGFHAVEYMIFRDGKARKVAE-----------------IT 168

Query: 210 RRRVEYLKVVSKILVSDLEEMMKAWG-----------------------------PDGQA 240
                Y   V++ L      +  +W                                G+ 
Sbjct: 169 EPERIYNAAVAEDLARQATRLEASWAGVDKITAAKKKTLEDAELLPTMDYGEIMIAAGEQ 228

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
                K        I+ G  S   +E+   ++   +   +       +S N+   + +++
Sbjct: 229 GNTTYKSQKDAFVQILQG-ASDITDEVGNTKITDPVNSGNVLDVESWYSWNSIEDFTDNL 287

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
             + ++Y   Y  ++G   H  S+   ++ ++  L +EI     N +K    +       
Sbjct: 288 RSVRNAY---YGSLDGTA-HKHSMASYMAQHHPELDKEIRSAIDNAIKTVAAMPA----- 338

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
             F   ++++     K   +  N L+ + ++  +  
Sbjct: 339 -PFRNNLTKDAT---KPAIDACNALLEKIDAAIEAV 370


>gi|160891081|ref|ZP_02072084.1| hypothetical protein BACUNI_03528 [Bacteroides uniformis ATCC 8492]
 gi|317480991|ref|ZP_07940071.1| iron-regulated protein A [Bacteroides sp. 4_1_36]
 gi|156859302|gb|EDO52733.1| hypothetical protein BACUNI_03528 [Bacteroides uniformis ATCC 8492]
 gi|316902884|gb|EFV24758.1| iron-regulated protein A [Bacteroides sp. 4_1_36]
          Length = 383

 Score =  123 bits (309), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 43/173 (24%), Positives = 71/173 (41%), Gaps = 30/173 (17%)

Query: 18  LSIVPNVSLEKVLQNYATIA-HAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
            +I  N +L+ +++NY  +     Y+D      TL  A+  L   P+    E A   WI 
Sbjct: 240 STINSNEALDPIVENYVNVVVLPTYKDLKEKNSTLYDAVVALANNPSNSAFETACNAWIT 299

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR P+++SE + FG       D  +++WPLD+  I                         
Sbjct: 300 AREPWEESEAFLFGPVDELGLDPNMDSWPLDQNAI------------------------V 335

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
           +I+ ++K  DL     D   K+  A  +      G+H +EFLL+       V+
Sbjct: 336 QILNSQKWGDLEWSEGDDDAKVESAQNV-----RGFHTLEFLLFKDGKPRTVK 383



 Score = 54.6 bits (130), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 62/171 (36%), Gaps = 28/171 (16%)

Query: 215 YLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAG---------LNSIITGMTSL 262
           Y++ V+ +L +D   +  +W      G +     K  N           +  +I G   +
Sbjct: 49  YMRNVAALLKADATNLYDSWNTSYKGGASFATSFKAHNGAYNFSSAWNCIEQVIDGCVEI 108

Query: 263 S--YNE-LAGERMNLGLILHDPEQ---EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
           S    E   G+  N  +  +  E        +S ++   Y N++  I ++Y   Y  ++G
Sbjct: 109 SNEVGETKIGDPYNKYMANNVTEALYAVESWYSWHSRDDYTNNIYSIRNAY---YGSLDG 165

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI 367
            K+   SI  L++  N  L  +++   +        +       + F   I
Sbjct: 166 -KVSDKSISKLVAGVNAELDMKVSAAITTAASAIQAIP------QPFRNNI 209


>gi|270294384|ref|ZP_06200586.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270275851|gb|EFA21711.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 383

 Score =  123 bits (309), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 43/173 (24%), Positives = 71/173 (41%), Gaps = 30/173 (17%)

Query: 18  LSIVPNVSLEKVLQNYATIA-HAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
            +I  N +L+ +++NY  +     Y+D      TL  A+  L   P+    E A   WI 
Sbjct: 240 STINSNEALDPIVENYVNVVVLPTYKDLKEKNSTLYDAVVALANNPSNSAFETACNAWIT 299

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR P+++SE + FG       D  +++WPLD+  I                         
Sbjct: 300 AREPWEESEAFLFGPVDELGLDPNMDSWPLDQNAI------------------------V 335

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
           +I+ ++K  DL     D   K+  A  +      G+H +EFLL+       V+
Sbjct: 336 QILNSQKWGDLEWSEGDDDAKVESAQNV-----RGFHTLEFLLFKDGKPRTVK 383



 Score = 56.2 bits (134), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 62/171 (36%), Gaps = 28/171 (16%)

Query: 215 YLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAG---------LNSIITGMTSL 262
           Y++ V+ +L +D   +  +W      G +     K  N           +  +I G   +
Sbjct: 49  YMRNVAALLKTDATNLYDSWNTSYKGGASFATSFKAHNGAYNFSSAWNCIEQVIDGCVEI 108

Query: 263 S--YNE-LAGERMNLGLILHDPEQ---EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
           S    E   G+  N  +  +  E        +S ++   Y N++  I ++Y   Y  ++G
Sbjct: 109 SNEVGETKIGDPYNKYMANNVTEALYAVESWYSWHSRDDYTNNIYSIRNAY---YGSLDG 165

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI 367
            K+   SI  L++  N  L  +++   +        +       + F   I
Sbjct: 166 -KVSDKSISKLVAGVNAELDTKVSAAITTAASAIQAIP------QPFRNNI 209


>gi|319901230|ref|YP_004160958.1| Peptidase M75, Imelysin [Bacteroides helcogenes P 36-108]
 gi|319416261|gb|ADV43372.1| Peptidase M75, Imelysin [Bacteroides helcogenes P 36-108]
          Length = 388

 Score =  122 bits (305), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 86/234 (36%), Gaps = 35/234 (14%)

Query: 17  ALSIVPNVSLEKVLQNYATIA-HAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
             ++  N  L+ ++ +Y  +     Y         L +A +   +TP+  N E     W+
Sbjct: 181 TAAVNTNAVLDPIIVSYVDVVVLPTYNSLKEKNAALYTAAQKFNSTPSNANFEAVCEAWL 240

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR P++ SE + FG       D  +++WPLD+  I                        
Sbjct: 241 EARQPWETSEAFLFGPVDALGLDPNMDSWPLDQSAI------------------------ 276

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
             I+ +    DL+    D   K+  A  +      G+H +EFL +   +   + +  +  
Sbjct: 277 VNILNSGNYDDLNWSDGDNNDKVEAAQSV-----RGFHTLEFLAFRNGVARTLTDVADS- 330

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMK 246
            ++      T  +      Y+  V+ +L SD E +  +W      G++     K
Sbjct: 331 -SNSADLVYTSANAASWGNYMVQVAYLLKSDAETLYNSWSVSYEGGESYAAKFK 383



 Score = 54.2 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 44/118 (37%), Gaps = 15/118 (12%)

Query: 284 EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKF 343
               +S ++   Y N++  I ++Y G      G      S+ +LI+ NN +L  ++ +  
Sbjct: 79  VESWYSWHSREDYSNNIYSIRNAYYGTLDGTVGTN----SLANLIAKNNASLDTQVRNAI 134

Query: 344 SNTMKDFHILKDRAENIESFDQMISENNPEGNKIVR---NLINDLITQTESLRKIRIA 398
           S+ +     +K        F   I  N+ E    +    +L + L      + +    
Sbjct: 135 SDAVDAILAIKS------PFRNNI--NSTEARTAMTACADLNDVLKDLKGYIERTAAV 184


>gi|329965221|ref|ZP_08302151.1| Imelysin [Bacteroides fluxus YIT 12057]
 gi|328523241|gb|EGF50341.1| Imelysin [Bacteroides fluxus YIT 12057]
          Length = 383

 Score =  119 bits (299), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 42/173 (24%), Positives = 69/173 (39%), Gaps = 30/173 (17%)

Query: 18  LSIVPNVSLEKVLQNYATIA-HAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
            +I  N +L+ ++ NY  +     Y+D       L  A+  L   P+    E A   WI 
Sbjct: 240 STINSNEALDPIVGNYVEVVVLPTYKDLKKKNNMLYDAVVALANNPSNSAFETACNAWIT 299

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR P+++SE + FG       D  +++WPLD+  I                         
Sbjct: 300 AREPWEESEAFLFGPVDELGLDPNMDSWPLDQNAI------------------------V 335

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
           +I+ ++K  DL     D   K+  A  +      G+H +EFLL+       V+
Sbjct: 336 QILNSQKWSDLEWSEGDDDAKVESAQNV-----RGFHTLEFLLFKDGKPRTVK 383



 Score = 53.8 bits (128), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 58/144 (40%), Gaps = 24/144 (16%)

Query: 215 YLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAG---------LNSIITGMTSL 262
           Y++ V+ +L +D   +  +W      G +     K  N           +  +I G   +
Sbjct: 49  YMRNVAALLKTDAANLYDSWNTSYKGGASFATSFKAHNGAYNFSSAWNCIEQVIDGCVEI 108

Query: 263 SYNELAGERMN---LGLILHDPEQE----IDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           S NE+   ++       + ++  +        +S ++   Y N++  I ++Y   Y  ++
Sbjct: 109 S-NEVGETKIGDPYNKYMANNVIEALYAVESWYSWHSRDDYTNNIYSIRNAY---YGSLD 164

Query: 316 GEKIHGASIHDLISHNNRNLAQEI 339
           G K+   SI  L++  N  L  ++
Sbjct: 165 G-KVSDKSISKLVAGVNAELDTKV 187


>gi|330998011|ref|ZP_08321842.1| hypothetical protein HMPREF9442_02945 [Paraprevotella xylaniphila
           YIT 11841]
 gi|329569312|gb|EGG51092.1| hypothetical protein HMPREF9442_02945 [Paraprevotella xylaniphila
           YIT 11841]
          Length = 397

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/168 (20%), Positives = 67/168 (39%), Gaps = 30/168 (17%)

Query: 14  PSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
            ++A   + +  ++ V+  +   +    Y+D       L +A++     P+    E A  
Sbjct: 248 AAYANGTITDAEMDSVVNGFVNKVVLPTYKDLKEKNTALCAAVQNFYNNPSDATFETACD 307

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ AR P++QSE + FG   +   D  +++WPLD+  I                     
Sbjct: 308 AWLVARTPWEQSEAFLFGPVDILGLDPNMDSWPLDQVAI--------------------- 346

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
                I+ +    DL+    D   ++  +  +      G+H +EFLL+
Sbjct: 347 ---VNILESGNFDDLNWEDGDTEEEITASQEV-----RGFHTLEFLLF 386



 Score = 67.7 bits (164), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 78/235 (33%), Gaps = 34/235 (14%)

Query: 185 KTNVREPGNRPYTDFDIG---NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDG 238
             +    G +P   FD     N T  +      Y   V+K+L  D   +  +W      G
Sbjct: 27  DDDGNNGGPKPDEKFDAAANLNYTPENAASWRNYSLQVAKLLQKDATTLYDSWETSFQGG 86

Query: 239 QATKDLMKDINAG--------LNSIITG---MTSLSYNELAGERMNLGLILHDPEQ---E 284
           +A K    + N G        +  II     +T    N   G+  N        E     
Sbjct: 87  EAFKKTFIEHNGGTYTSALSCIEQIIDKCVEITDEVGNSKIGDPYNKWTAGQQTEALYAV 146

Query: 285 IDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFS 344
              +S ++   Y N++  I +     Y       +   S+++L+   N  L  +I ++  
Sbjct: 147 ESWYSFHSRDDYSNNIRSIRN----SYFNSMDSTVSQYSLYNLVQKINPALNTKIANEIE 202

Query: 345 NTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL-ITQTESLRKIRIA 398
           +T      +       + F   I +       + ++    L IT T+ L+    A
Sbjct: 203 STKNAILAIP------QPFRNNIGDAKVP---VAQSACVALGITLTQELKGAIQA 248


>gi|282878042|ref|ZP_06286850.1| imelysin [Prevotella buccalis ATCC 35310]
 gi|281299877|gb|EFA92238.1| imelysin [Prevotella buccalis ATCC 35310]
          Length = 397

 Score =  117 bits (292), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 65/373 (17%), Positives = 127/373 (34%), Gaps = 102/373 (27%)

Query: 31  QNYATIAHA--------KYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
           + YA I  A         YE   + +  L   +      P + NL+ A   ++ +R+ ++
Sbjct: 45  KAYAEIVDAFIHKTVVPTYEKMALKSSELVKDLREYRKNPTQANLDKACEDFLASRMWWE 104

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNE 142
           +SE + FG       D  +++WPLD                E  L TA  I      ++ 
Sbjct: 105 RSEAFLFGAASDFGIDPHIDSWPLD------------LPALEKYLATATNIE----ELDG 148

Query: 143 KEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG 202
            + D++  +      L            GYH +E++L+        R+ G     D    
Sbjct: 149 DDYDIAARTKLGQELL------------GYHGVEYILF---KDGKPRKAG--SIED---- 187

Query: 203 NCTGGHCRRRVEYLK---VVSKILVSDLEEMMKAWGPDGQATK----------------- 242
                      EYL     V+  L +   +++ +W  +  A+K                 
Sbjct: 188 -----------EYLVYAIAVAGDLRNSCWQLLTSWAGEKYASKLDAAQVKHITEDVELGI 236

Query: 243 --------------------DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPE 282
                                L +   A L  I++G  S+  +E+   ++       D  
Sbjct: 237 TVGGGEHSYGENILLAGQPGSLYRSWVAALQEIVSGCNSIC-DEVGTSKIGSAHTGEDVS 295

Query: 283 QEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDK 342
                +S  +   + N++I + + Y   Y  + G    GASIH+ ++ +N+ +  ++   
Sbjct: 296 YIESPYSQMSIHDFHNNIISVENVY---YGGIEGN--RGASIHNYMAKHNKEMDMKVTAA 350

Query: 343 FSNTMKDFHILKD 355
            +        +K 
Sbjct: 351 ITKAQTAIKNMKA 363


>gi|315608936|ref|ZP_07883908.1| conserved hypothetical protein [Prevotella buccae ATCC 33574]
 gi|315249316|gb|EFU29333.1| conserved hypothetical protein [Prevotella buccae ATCC 33574]
          Length = 441

 Score =  116 bits (290), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 63/434 (14%), Positives = 135/434 (31%), Gaps = 99/434 (22%)

Query: 22  PNVSLEKVLQNY-ATIAHAKYEDALMCARTLDSAIETLVTTPNKKN------LENARLQW 74
              +++ +   Y   + +  Y +    A  L + I  L              ++     +
Sbjct: 40  QEQAVKDLTAEYLNNVVYPTYGNLASEAEGLYAKINALKAKLKAGTRVEQSEIDAICTSY 99

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
             AR  +++SE + +G       D  +++WPLD                       ++ +
Sbjct: 100 KAARQYWEESEAFLYGAASDFEIDPHIDSWPLD-----------------VPTLAKDLAS 142

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNR 194
           ++KI   +KE +   ++   L   +           G+H IEF+ +            N 
Sbjct: 143 DAKIKTLDKEAEDIEVTRKNLTAENL----------GFHGIEFIFFRDGKNRPASFFNND 192

Query: 195 PYTDFD-IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA------------- 240
               ++ I +      +  V +   V+  L     +++ AW P   A             
Sbjct: 193 EVEKYENIFDGKNVTAKEEVIFATAVAGDLRDKCYQLVVAWNPAASAAYKARIAECAKHF 252

Query: 241 ----------------------TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLG--- 275
                                  K     +   + +I+    S    E+A ++M      
Sbjct: 253 DDFKTLTKKGLTYGEDLLQAGTAKSTQSSVKKVVETILVSGCSNICAEVADQKMGQAYRA 312

Query: 276 --------------LILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
                         +   DP      +S N++  + ++++ I +S  G Y   NG     
Sbjct: 313 SKDPNSQHQGEDGKMEPDDPNYIESPYSYNSFTDFYDNIMSIQNSLYGNY---NGNTYAA 369

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
            S+   ++  N   A  IN K +  +K     +        F  +++   P    +V+  
Sbjct: 370 KSLMSYLNTYNVVEAALINAKLTAALKALKACQTS---GTPF--VLNPGAP----LVKAA 420

Query: 382 INDLITQTESLRKI 395
           ++ +      L K 
Sbjct: 421 MDAVGELDSELNKA 434


>gi|288926765|ref|ZP_06420675.1| imelysin superfamily [Prevotella buccae D17]
 gi|288336446|gb|EFC74822.1| imelysin superfamily [Prevotella buccae D17]
          Length = 441

 Score =  116 bits (290), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 63/434 (14%), Positives = 135/434 (31%), Gaps = 99/434 (22%)

Query: 22  PNVSLEKVLQNY-ATIAHAKYEDALMCARTLDSAIETLVTTPNKKN------LENARLQW 74
              +++ +   Y   + +  Y +    A  L + I  L              ++     +
Sbjct: 40  QEQAVKDLTAEYLNNVVYPTYGNLASEAEGLYAKINALKAKLKAGTRVEQSEIDAICTSY 99

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
             AR  +++SE + +G       D  +++WPLD                       ++ +
Sbjct: 100 KAARQYWEESEAFLYGAASDFEIDPHIDSWPLD-----------------VPTLAKDLAS 142

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNR 194
           ++KI   +KE +   ++   L   +           G+H IEF+ +            N 
Sbjct: 143 DAKIKTLDKEAEDIEVTRKNLTAENL----------GFHGIEFIFFRDGKNRPASFFNND 192

Query: 195 PYTDFD-IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA------------- 240
               ++ I +      +  V +   V+  L     +++ AW P   A             
Sbjct: 193 EVEKYENIFDGKNVTAKEEVIFATAVAGDLRDKCYQLVVAWNPAASAAYKARIAECAKHF 252

Query: 241 ----------------------TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLG--- 275
                                  K     +   + +I+    S    E+A ++M      
Sbjct: 253 DDFKTLTKKGLTYGEDLLQAGTAKSTQSSVKKVVETILVSGCSNICAEVADQKMGQAYRA 312

Query: 276 --------------LILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
                         +   DP      +S N++  + ++++ I +S  G Y   NG     
Sbjct: 313 SKDPNSQHEGEDGKMEPDDPNYIESPYSYNSFTDFYDNIMSIQNSLYGNY---NGNTYAA 369

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
            S+   ++  N   A  IN K +  +K     +        F  +++   P    +V+  
Sbjct: 370 KSLMSYLNTYNVVEAALINAKLTAALKALKACQTS---GTPF--VLNPGAP----LVKAA 420

Query: 382 INDLITQTESLRKI 395
           ++ +      L K 
Sbjct: 421 MDAVGELDSELNKA 434


>gi|332881676|ref|ZP_08449324.1| hypothetical protein HMPREF9074_05114 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332680315|gb|EGJ53264.1| hypothetical protein HMPREF9074_05114 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 410

 Score =  115 bits (289), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 37/168 (22%), Positives = 65/168 (38%), Gaps = 40/168 (23%)

Query: 19  SIVPNVSLEKVLQNY-ATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA 77
             + +  ++ V+  +   +    Y+D       L +A+E    TP+    E A   W+ A
Sbjct: 266 GTITDAEMDLVVSGFVNNVVLPTYKDLKEKNTALLAAVEDFYNTPSDDTFEAACEAWLVA 325

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R+P++QSE + FG   +   D  +++WPLD+  I                   NI+ +  
Sbjct: 326 RMPWEQSEAFLFGPVDILGLDPNMDSWPLDQVAI------------------VNILNSGN 367

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNIT-----TGYHVIEFLLW 180
                   DL+                +  IT      G+H +EFLL+
Sbjct: 368 FD------DLNW----------EDGDSEDEITASQEVRGFHTLEFLLF 399



 Score = 60.4 bits (145), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/180 (15%), Positives = 59/180 (32%), Gaps = 29/180 (16%)

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAG--------LNSII 256
           +      Y + V+ +L  D   +  +W      G+A K    + N G        +  II
Sbjct: 66  NAASWRNYSRQVAILLKKDATTLYDSWETSFQGGEAFKKTFTEHNGGTYTSALSCIEQII 125

Query: 257 TGMTSLSYNELAGERMNLGLI---LHDPEQE----IDCFSDNTYASYLNDVIGIISSYTG 309
                +  +E+   ++             +        +S ++   Y N++  I +SY  
Sbjct: 126 DKCVEI-TDEVGNSKIGDPYDKWTAGQQTEALYAVESWYSFHSRDDYSNNIRSIRNSYFN 184

Query: 310 EYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISE 369
                    I   S++ L+   +  L  +I ++  +T      +       + F   I +
Sbjct: 185 SL----DSTISNNSLYKLVEKIDPALNTKIANEIESTKNAILAIP------QPFRNNIGD 234


>gi|189463604|ref|ZP_03012389.1| hypothetical protein BACCOP_04328 [Bacteroides coprocola DSM 17136]
 gi|189429707|gb|EDU98691.1| hypothetical protein BACCOP_04328 [Bacteroides coprocola DSM 17136]
          Length = 411

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 67/408 (16%), Positives = 134/408 (32%), Gaps = 85/408 (20%)

Query: 26  LEKVLQNYATIAHAK--YEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
              V+  Y  +A       DA   A+    + +    T   + +  A   W  +R  ++ 
Sbjct: 53  DNTVIPTYTAMADEAILMSDACTKAKEAYLSGDKAKAT---EYVAEACEHWTESRKAWEL 109

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           SE + FG       D  +++WPLD+  +D                  N++ N K++    
Sbjct: 110 SEAFLFGAAADYNIDPHIDSWPLDQVALD------------------NLLNNQKMMDAIG 151

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           E D   I+ +L   L            GYH +E++L+ Q    + REP N   T +    
Sbjct: 152 EGDFDYITTNLGYGL-----------LGYHALEYILF-QLTDDSHREPRNFEKT-YSYSG 198

Query: 204 CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ------------------ATKDLM 245
                    + Y+  V++ L +    +  +W                            M
Sbjct: 199 QVVNITNNHLIYMAGVAEDLRNQCIRLEASWAGMNNISTQKQEILTETEQEPTFNYGTSM 258

Query: 246 KDINAGLNS----------IITGMTSLSYNELAGERMNLGLILHDPEQE---IDCFSDNT 292
           K    G +           +I G   +  +E+  +++         + +      ++ N+
Sbjct: 259 KTAGQGGSKYTSYTVAAQELIQGCIDIV-DEVCTQKIGRPNSGQSADDKNYIESPYALNS 317

Query: 293 YASYLNDVIGIISSYTG-EYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH 351
              +++++  + ++Y G  Y   N       S+   +S  ++    E+      ++    
Sbjct: 318 VVDFVDNIKSVKNAYEGISYDGKNNAT----SVSAYVSTVDQATDTEVKALIDESITKIQ 373

Query: 352 ILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            +       E F       N  G +     I  L   + +L K   AL
Sbjct: 374 AIP------EPF-----AKNATGAEA-DAAIASLSKLSTALNKANKAL 409


>gi|121729966|ref|ZP_01682385.1| iron-regulated protein A, putative [Vibrio cholerae V52]
 gi|121628287|gb|EAX60798.1| iron-regulated protein A, putative [Vibrio cholerae V52]
          Length = 109

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 52/101 (51%), Gaps = 1/101 (0%)

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFD 364
            YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   AE N + FD
Sbjct: 1   IYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAEKNNQHFD 60

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           Q+I+ +N  G+ I+   I  L+ QT S+ +    + +   N
Sbjct: 61  QLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLN 101


>gi|325860541|ref|ZP_08173645.1| imelysin [Prevotella denticola CRIS 18C-A]
 gi|325481926|gb|EGC84955.1| imelysin [Prevotella denticola CRIS 18C-A]
          Length = 417

 Score =  108 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 61/387 (15%), Positives = 126/387 (32%), Gaps = 85/387 (21%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTP- 62
            +      + S  LS      L+ +L      + +  Y++       L +A+ TL     
Sbjct: 56  ALTEANQAIVSSQLSAEQKKELQNILNANVDNVIYPTYKELGDDVEALHAALGTLSEKQI 115

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           ++KN+++A   +++AR  +++SE +  G     + D  +++WPL+   +           
Sbjct: 116 SQKNVDDACAAFLKAREQWEKSEAFLMGPASDFSIDPHIDSWPLNRTAL--------HAY 167

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N       I +  I+                               G+H +EF+L+  
Sbjct: 168 FGNPTAE---IKDESIL-------------------------------GFHALEFILFRN 193

Query: 183 DLKTNVRE-PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
                V E  GN  Y +F     +       ++Y + V K L++ + E+  AW P     
Sbjct: 194 GKPRKVAEFQGNDTYPNFTDIKGSD-----ELKYAEAVIKDLLNHVYELEVAWNPTNATR 248

Query: 242 --------------------------KDLMKDINAGLNSIITGMTSL-------SYNELA 268
                                      D  K   A ++  +T + S          NE+ 
Sbjct: 249 LAAVKAADLKYQTEKGFSYGENMRSVGDAAKSTFASIDVAVTQVLSETEGSCLGIANEVG 308

Query: 269 GERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLI 328
             +++      D       +S N+   + N++  I + + G   R         S H   
Sbjct: 309 TAKISNPFQAGDISYVESPYSYNSITDFQNNIRSIENIWYG--GRNGKNSNAAYSFHKFF 366

Query: 329 SHNNRNLAQEINDKFSNTMKDFHILKD 355
             N   + +++       ++    +  
Sbjct: 367 QSNKTAVGRKVEATIETAIQKIGRMPK 393


>gi|302346436|ref|YP_003814734.1| imelysin [Prevotella melaninogenica ATCC 25845]
 gi|302150941|gb|ADK97202.1| imelysin [Prevotella melaninogenica ATCC 25845]
          Length = 453

 Score =  108 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 76/438 (17%), Positives = 147/438 (33%), Gaps = 86/438 (19%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNL---- 67
           + S + +      + KV+ NY   +    Y D    +  L  A + L        L    
Sbjct: 47  IASESSANANKTEMGKVVANYINEVVKPTYLDLAEKSDILYKACQNLYQKRKAGTLTQND 106

Query: 68  -ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
            + A   +  AR  ++QSE + +G    +  D  +++WPLD             +     
Sbjct: 107 IDAACEAFKAARKDWEQSESFLYGAASDNEIDPHIDSWPLD------------HDQLTRA 154

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
           L  A++IA               I+ +   K    N  + +   G+H +EF+L+      
Sbjct: 155 LNNADVIAG--------------INGENPAKYVYDNNGNFDSVLGFHGLEFVLFRNGKNR 200

Query: 187 NVREPGNRPYTDFDIGNCTGGHCR----------RRVEYLK----VVSKILVSDLEEMMK 232
            V        T+  + + +  +            R + YL     + + I  S L ++  
Sbjct: 201 TVAAFNAEKETEAGLTSVSTVNEAAFAAAVAGDLRNMTYLLEYGWLGTTIPTSHLNQLAN 260

Query: 233 A-WGPDGQATKDL--------------------MKDINAGLNSIITGMTSLSYNELAGER 271
           A W  +G   + L                        +  LN+I  G  S    E+A ++
Sbjct: 261 AMWVVNGTRHRGLSAKLIPYRDYSQFATKENGMFASWHETLNNIFIGGCSGICEEVASQK 320

Query: 272 MNLGLI----LHDPEQE----IDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
           +             +         +S  ++  Y +++  I +S  G     N       S
Sbjct: 321 LGQAYRKATGTGTADDAANYIESPYSKRSFQDYQDNIYSIKNSLYGVRGTENISTPTQYS 380

Query: 324 IHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESF-DQMISENNPEGNKIVRNLI 382
           I + + +NN     E+N   +   +    L+   ++  +F DQ        GN  V+  I
Sbjct: 381 IMNFLKNNNYPKYNELNSALN---EAIAALETAKKSGIAFIDQ-------PGNPQVKTCI 430

Query: 383 NDLITQTESLRKIRIALD 400
           + +    E+L      ++
Sbjct: 431 DKVDALNEALNAAGTWIN 448


>gi|325269079|ref|ZP_08135700.1| imelysin superfamily protein [Prevotella multiformis DSM 16608]
 gi|324988700|gb|EGC20662.1| imelysin superfamily protein [Prevotella multiformis DSM 16608]
          Length = 417

 Score =  108 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 61/387 (15%), Positives = 126/387 (32%), Gaps = 85/387 (21%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTP- 62
            +      + S  LS      L+ +L      + +  Y++       L +A+ TL     
Sbjct: 56  ALTEANQAIVSSQLSAEQKKELQNILNANVDNVIYPTYKELGDDVEALHAALGTLSEKEI 115

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           ++KN+++A   +++AR  +++SE +  G     + D  +++WPL+   +           
Sbjct: 116 SQKNVDDACAAFLKAREQWERSEAFLMGPASDFSIDPHIDSWPLNRTAL--------HAY 167

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N       I +  I+                               G+H +EF+L+  
Sbjct: 168 FGNPTAE---IKDESIL-------------------------------GFHALEFILFRN 193

Query: 183 DLKTNVRE-PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
                V E  GN  Y +F     +       ++Y + V K L++ + E+  AW P     
Sbjct: 194 GKPRKVAEFQGNDTYPNFTDIKGSD-----ELKYAEAVIKDLLNHVYELEVAWNPTNATR 248

Query: 242 --------------------------KDLMKDINAGLNSIITGMTSL-------SYNELA 268
                                      D  K   A ++  +T + S          NE+ 
Sbjct: 249 LAAVKAANLKYQTEKGLSYGENMRSAGDAAKSTFASIDVAVTQVLSETEGSCLGIANEVG 308

Query: 269 GERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLI 328
             +++      D       +S N+   + N++  I + + G   R         S H   
Sbjct: 309 TAKISNPFQAGDISYVESPYSYNSITDFQNNIRSIENIWYG--GRNGKNSNAAYSFHKFF 366

Query: 329 SHNNRNLAQEINDKFSNTMKDFHILKD 355
             N   + +++       ++    +  
Sbjct: 367 QSNKTAVGRKVEAAIETAIQKIGRMPK 393


>gi|187736416|ref|YP_001878528.1| hypothetical protein Amuc_1934 [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187426468|gb|ACD05747.1| conserved hypothetical protein [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 368

 Score =  108 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 61/379 (16%), Positives = 115/379 (30%), Gaps = 92/379 (24%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPN 63
           TI++      +   +          +  YA  +    Y+     A     A + L   P 
Sbjct: 17  TILAFGSQAQAAKAASPKVDKTSAAIAAYADELVIPTYKTMSDNALKFAKAAKELKAAPT 76

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
              +  A    +  R+P++ SE + FG       D K+++WPLD   +D V  +   ++ 
Sbjct: 77  DAKVAEAGKLLLETRVPWELSESFLFGPAAFANLDPKLDSWPLDTTNLDAVAKNADSKSV 136

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                                ID + +   L  +           T G+H  E+LL+   
Sbjct: 137 --------------------TIDAAYVRNSLGAE-----------TRGFHAAEYLLF--- 162

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG-------- 235
                R+   R   D   G  +         YL  V++++  D   +   W         
Sbjct: 163 -----RDGQPRKAADLTPGQLS---------YLAAVAEVIAEDAITLEAWWAGSDKISEE 208

Query: 236 -----------PDGQATKDLMKDINAG---------LNSIITGMTSLSYNELAGERMNLG 275
                      P      +  K   AG         L+ II G   +  +E+A  ++   
Sbjct: 209 KAKILEEAEIEPGKSYAGEFKKAGQAGSRYESNSEVLDEIIGGSKDII-DEIADSKVGKP 267

Query: 276 LILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNL 335
               D       +S  +     ++V  +  SY                I  L++  +  +
Sbjct: 268 YETADAADCESLYSYTSLVDSRHNVQSVEKSYNA--------------ISPLVAAKSAKV 313

Query: 336 AQEINDKFSNTMKDFHILK 354
            Q +    +   K    ++
Sbjct: 314 GQAVKGSIAKVFKSLDAIQ 332


>gi|260175325|ref|ZP_05761737.1| iron-regulated protein A precursor [Bacteroides sp. D2]
 gi|299149248|ref|ZP_07042308.1| iron-regulated protein A [Bacteroides sp. 3_1_23]
 gi|315923558|ref|ZP_07919798.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|298512682|gb|EFI36571.1| iron-regulated protein A [Bacteroides sp. 3_1_23]
 gi|313697433|gb|EFS34268.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 384

 Score =  108 bits (270), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 60/161 (37%), Gaps = 30/161 (18%)

Query: 20  IVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           I  +  L  V+  Y   +    Y+        L +A+  L   P+    E A   WI AR
Sbjct: 243 INTDAVLNPVVTQYVDAVVVPTYKSLKEKNDALYNAVIALADNPSNSAFETACDAWITAR 302

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
            P+++SE + FG       D  +++WPLD+  I                         +I
Sbjct: 303 EPWEKSEAFLFGPVDEMGLDPNMDSWPLDQNAI------------------------VQI 338

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
           + ++   DL     D    +  A  +      G+H +EFLL
Sbjct: 339 LNSQSWSDLEWSEGDDEAAVESAQNV-----RGFHTLEFLL 374



 Score = 58.9 bits (141), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 32/198 (16%), Positives = 75/198 (37%), Gaps = 23/198 (11%)

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDIN 249
           + P  D    + T  +      Y++ V+ +L +D   +  AW      G++   L K  +
Sbjct: 28  DNPTVDPANIDYTPENASSWHNYMRNVAALLKTDATNLYNAWNSSYKGGESYASLFKAHS 87

Query: 250 AG--------LNSIITGMTSLSYNELAGERMNLGLI---LHDPEQE----IDCFSDNTYA 294
           A         +  I+     ++ NE+   ++          + E+        +S ++  
Sbjct: 88  ASPYASALSCVEEIVDKCAEIA-NEVGTAKIGDPYNLYKAGNTEEALYAVESWYSWHSRD 146

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
            Y N++  I ++Y   Y  ++G  I+  S+  +I+  N +L  +I +      K    + 
Sbjct: 147 DYTNNIYSIRNAY---YGSLDGN-INANSLSTVIAGVNSSLDTKIKNAIQKAAKAIQDIP 202

Query: 355 DRAENIESFDQMISENNP 372
               N    ++ ++  + 
Sbjct: 203 QPFRNHIPSNETVAAMDA 220


>gi|327313692|ref|YP_004329129.1| imelysin [Prevotella denticola F0289]
 gi|326945703|gb|AEA21588.1| imelysin [Prevotella denticola F0289]
          Length = 415

 Score =  108 bits (270), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 61/387 (15%), Positives = 126/387 (32%), Gaps = 85/387 (21%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTP- 62
            +      + S  LS      L+ +L      + +  Y++       L +A+ TL     
Sbjct: 54  ALTEANQAIVSSQLSAEQKKELQNILNANVDNVIYPTYKELGDDVEALHAALGTLSEKQI 113

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           ++KN+++A   +++AR  +++SE +  G     + D  +++WPL+   +           
Sbjct: 114 SQKNVDDACAAFLKAREQWEKSEAFLMGPASDFSIDPHIDSWPLNRTAL--------HAY 165

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N       I +  I+                               G+H +EF+L+  
Sbjct: 166 FGNPTAE---IKDESIL-------------------------------GFHALEFILFRN 191

Query: 183 DLKTNVRE-PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
                V E  GN  Y +F     +       ++Y + V K L++ + E+  AW P     
Sbjct: 192 GKPRKVAEFQGNDTYPNFTDIKGSD-----ELKYAEAVIKDLLNHVYELEVAWNPTNATR 246

Query: 242 --------------------------KDLMKDINAGLNSIITGMTSL-------SYNELA 268
                                      D  K   A ++  +T + S          NE+ 
Sbjct: 247 LAAVKAANLKYQTEKGFSYGENMRSAGDAAKSTFASIDVAVTQVLSETEGSCLGIANEVG 306

Query: 269 GERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLI 328
             +++      D       +S N+   + N++  I + + G   R         S H   
Sbjct: 307 TAKISNPFQAGDISYVESPYSYNSITDFQNNIRSIENIWYG--GRNGKNSNAAYSFHKFF 364

Query: 329 SHNNRNLAQEINDKFSNTMKDFHILKD 355
             N   + +++       ++    +  
Sbjct: 365 QSNKTAVGRKVEAAIETAIQKIGRMPK 391


>gi|237719361|ref|ZP_04549842.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|229451221|gb|EEO57012.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
          Length = 384

 Score =  108 bits (270), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 60/161 (37%), Gaps = 30/161 (18%)

Query: 20  IVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           I  +  L  V+  Y   +    Y+        L +A+  L   P+    E A   WI AR
Sbjct: 243 INTDAVLNPVVTQYVDAVVVPTYKSLKEKNDALYNAVIALADNPSNSAFETACDAWITAR 302

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
            P+++SE + FG       D  +++WPLD+  I                         +I
Sbjct: 303 EPWEKSEAFLFGPVDEMGLDPNMDSWPLDQNAI------------------------VQI 338

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
           + ++   DL     D    +  A  +      G+H +EFLL
Sbjct: 339 LNSQSWSDLEWSEGDDEAAVESAQNV-----RGFHTLEFLL 374



 Score = 58.9 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 74/198 (37%), Gaps = 23/198 (11%)

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDIN 249
           + P  D    + T  +      Y++ V+ +L +D   +  AW      G++   L K  +
Sbjct: 28  DNPTVDPANIDYTPENASSWHNYMRNVAALLKTDATNLYNAWNSSYKGGESYASLFKAHS 87

Query: 250 AG--------LNSIITGMTSLSYNELAGERMNLGLI---LHDPEQE----IDCFSDNTYA 294
                     +  I+     ++ NE+   ++          + E+        +S ++  
Sbjct: 88  GSPYASALSCVEEIVDKCAEIA-NEVGTAKIGDPYNLYKAGNTEEALYAVESWYSWHSRD 146

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
            Y N++  I ++Y   Y  ++G  I+  S+  +I+  N +L  +I +      K    + 
Sbjct: 147 DYTNNIYSIRNAY---YGSLDGN-INANSLSTVIAGANSSLDTKIKNAIQKAAKAIQDIP 202

Query: 355 DRAENIESFDQMISENNP 372
               N    ++ ++  + 
Sbjct: 203 QPFRNHIPSNETVAAMDA 220


>gi|317504857|ref|ZP_07962813.1| imelysin superfamily protein [Prevotella salivae DSM 15606]
 gi|315664041|gb|EFV03752.1| imelysin superfamily protein [Prevotella salivae DSM 15606]
          Length = 399

 Score =  108 bits (270), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 66/408 (16%), Positives = 138/408 (33%), Gaps = 107/408 (26%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVS---------LEKVLQNYAT-IAHAKYEDALMCART 50
           M F    S+  ++ S +       S         L++VL +Y     +  Y+     +  
Sbjct: 9   MLFAMACSLTTSMTSCSSDDDVKPSGELSAGDKYLQQVLSSYVDNTVNPTYKALADESEK 68

Query: 51  LDSAIETLV-TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLD-E 108
           L   +E L   +  ++ + +    ++ AR  Y++SE +  G       D  +++WPLD +
Sbjct: 69  LYKELEALQPGSITQQQVNDVCKTFLEARGNYERSEAFLLGAASHFLIDPHIDSWPLDLQ 128

Query: 109 GFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNI 168
              +Y+ +    +           I +  I+                             
Sbjct: 129 SLYNYIKADKKYK-----------IDDQSIL----------------------------- 148

Query: 169 TTGYHVIEFLLW--GQ-----DLKTNVR-EPGNRPYTDFDIGNCTGGHCRRRVEYLKVVS 220
             G+H IEF+L+  GQ     +L  +     G   +T F             +EY K V+
Sbjct: 149 --GFHGIEFILFRDGQPRKAAELNGHDTYNAGTNNFTIFTGAQ--------ELEYAKAVA 198

Query: 221 KILVSDLEEMMKAWGPD--------------------GQATKDLMKDINA---------- 250
           + L + +  +  +W  D                    G +    MK              
Sbjct: 199 EDLRNSVYRLECSWNEDATKAHKDVLDELETSYTTDKGNSYGYEMKHAGDPVNSQYATVK 258

Query: 251 -GLNSIITGMTSLSY--NELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSY 307
             ++S+++G  S +   +E+   ++N      D       +S N+   + N++  I + +
Sbjct: 259 IAVSSVLSGDHSAAGIADEVGNTKINNPFSGKDESYIESPYSYNSLTDFQNNIHSIENVW 318

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKD 355
              Y  + G++    S  +     +    + + D  +N +K    +K 
Sbjct: 319 ---YGGVQGKR-SEYSFSNYFKKYDAATGKRVEDAITNALKQIAAIKA 362


>gi|261879091|ref|ZP_06005518.1| iron-regulated protein A [Prevotella bergensis DSM 17361]
 gi|270334271|gb|EFA45057.1| iron-regulated protein A [Prevotella bergensis DSM 17361]
          Length = 424

 Score =  108 bits (270), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 64/156 (41%), Gaps = 11/156 (7%)

Query: 26  LEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
           L+ ++ +    +    Y D     + L   I      P+ +  +     WI+AR P++ S
Sbjct: 270 LDPIVSHVVDEVIVPTYSDLKKYNKELYQKILAFQAKPSNEGFKACCEAWIKARQPWESS 329

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           E Y FG       D  ++ WPLD   ID +++    E+     ++ + + + +       
Sbjct: 330 EAYLFGPVADKGLDPNMDTWPLD---IDGIENILKSEDWNKLNWSGDFVEDEEGDNGS-- 384

Query: 145 IDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
              S +SP+  +K             GYH IEFL++
Sbjct: 385 ---SQLSPEEKKKAEAI--SSAQSLRGYHTIEFLIF 415



 Score = 67.7 bits (164), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/182 (15%), Positives = 66/182 (36%), Gaps = 34/182 (18%)

Query: 213 VEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGMTSLSY----- 264
             Y+ VV K+LV D   +   W      G++  +L K+  +    + +    L+      
Sbjct: 59  GNYMAVVGKLLVDDANALYDDWTKSYNGGKSYAELFKEHKSEALKLNSAYDCLALLVTYM 118

Query: 265 ----NELAGERMNLGLILHDPE------------QEIDCFSDNTYASYLNDVIGIISSYT 308
               +E+  E++      +  +                 +S ++   Y+N+++ I + Y 
Sbjct: 119 DHIADEVGSEKIGSPYRKYTEKWPNKANMKAGLYAVESWYSWHSRLDYMNNILSIRNGYY 178

Query: 309 GEYIRMNGEKIHGA---SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQ 365
           G Y +    K+  A   S++  +  N+  L +++       +K    +       + F  
Sbjct: 179 GVYDKSF-SKLSKAHANSLYAYVEKNDPALNKKVAQAIDKAIKAIDNIP------QPFRN 231

Query: 366 MI 367
            I
Sbjct: 232 HI 233


>gi|295083856|emb|CBK65379.1| Imelysin. [Bacteroides xylanisolvens XB1A]
          Length = 399

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/159 (22%), Positives = 59/159 (37%), Gaps = 30/159 (18%)

Query: 22  PNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
            +  L  V+  Y   +    Y+        L +A+  L   P+    + A   WI AR P
Sbjct: 260 TDAVLNPVVMQYVDAVVVPTYKSLKEKNDALYNAVIALADNPSNSAFDKACEAWITAREP 319

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           +++SE + FG       D  +++WPLD+  I                         +I+ 
Sbjct: 320 WEKSEAFLFGPVDEMGLDPNMDSWPLDQNAI------------------------VQILN 355

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
           ++   DL     D    +  A  +      G+H +EFLL
Sbjct: 356 SQSWSDLEWNENDDEAAVESAQNV-----RGFHTLEFLL 389



 Score = 65.0 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/214 (15%), Positives = 77/214 (35%), Gaps = 24/214 (11%)

Query: 178 LLWGQDLKTNVREPGN-RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG- 235
           L+WG    T      +  P  D    + T  +      Y++ V+ +L +D   +  AW  
Sbjct: 27  LIWGLAFTTTSCSSDDDNPTVDPANIDYTSENASSWHNYMRNVAALLKTDATNLYNAWNS 86

Query: 236 --PDGQATKDLMKDINAG--------LNSIITGMTSLSYNELAGERMNLGLI---LHDPE 282
               G +   L K  N          +  I+     ++ NE+   ++          + E
Sbjct: 87  SYKGGDSYASLFKAHNGSPYASALSCVEEIVDKCAEIA-NEVGTAKIGDPYNLYKAGNTE 145

Query: 283 QE----IDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQE 338
           +        +S ++   Y N++  I ++Y   Y  ++G  I+  S+  +++  N +L   
Sbjct: 146 EALYAVESWYSWHSRDDYTNNIYSIRNAY---YGSLDGS-INANSLSTVVAGVNPSLDTN 201

Query: 339 INDKFSNTMKDFHILKDRAENIESFDQMISENNP 372
           + +      K    +     N    ++ ++  + 
Sbjct: 202 VKNAIQKAAKAIQDIPQPFRNHIPSNETVAAMDA 235


>gi|293373325|ref|ZP_06619683.1| imelysin [Bacteroides ovatus SD CMC 3f]
 gi|292631721|gb|EFF50341.1| imelysin [Bacteroides ovatus SD CMC 3f]
          Length = 384

 Score =  107 bits (268), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 60/161 (37%), Gaps = 30/161 (18%)

Query: 20  IVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           I  +  L  V+  Y   +    Y+        L +A+  L   P+    E A   WI AR
Sbjct: 243 INTDAVLNPVVTQYVDAVVVPTYKSLKEKNDALYNAVIVLADNPSNSAFETACDAWITAR 302

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
            P+++SE + FG       D  +++WPLD+  I                         +I
Sbjct: 303 EPWEKSEAFLFGPVDEMGLDPNMDSWPLDQNAI------------------------VQI 338

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
           + ++   DL     D    +  A  +      G+H +EFLL
Sbjct: 339 LNSQSWSDLEWSEGDDEAAVESAQNV-----RGFHTLEFLL 374



 Score = 60.4 bits (145), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 75/198 (37%), Gaps = 23/198 (11%)

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDIN 249
           + P  D    + T  +      Y++ V+ +L +D   +  AW      G++   L K  +
Sbjct: 28  DNPTVDPANIDYTPENASSWHNYMRNVAALLKTDATNLYNAWNSSYKGGESYASLFKAHS 87

Query: 250 AG--------LNSIITGMTSLSYNELAGERMNLGLI---LHDPEQE----IDCFSDNTYA 294
                     +  I+     ++ NE+   ++          + E+        +S ++  
Sbjct: 88  GSPYASALSCVEEIVDKCAEIA-NEVGTAKIGDPYNLYKAGNTEEALYAVESWYSWHSRD 146

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
            Y N++  I ++Y   Y  ++G  I+  S+  +I+  N +L  +I +     +K    + 
Sbjct: 147 DYTNNIYSIRNAY---YGSLDGN-INANSLSTVIAGANSSLDTKIKNAIQKAVKAIQDIP 202

Query: 355 DRAENIESFDQMISENNP 372
               N    ++ ++  + 
Sbjct: 203 QPFRNHIPSNETVAAMDA 220


>gi|160885797|ref|ZP_02066800.1| hypothetical protein BACOVA_03801 [Bacteroides ovatus ATCC 8483]
 gi|156108610|gb|EDO10355.1| hypothetical protein BACOVA_03801 [Bacteroides ovatus ATCC 8483]
          Length = 384

 Score =  107 bits (267), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 60/161 (37%), Gaps = 30/161 (18%)

Query: 20  IVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           I  +  L  V+  Y   +    Y+        L +A+  L   P+    E A   WI AR
Sbjct: 243 INTDAVLNPVVTQYVDAVVVPTYKSLKEKNDALYNAVIVLADNPSNSAFETACDAWITAR 302

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
            P+++SE + FG       D  +++WPLD+  I                         +I
Sbjct: 303 EPWEKSEAFLFGPVDEMGLDPNMDSWPLDQNAI------------------------VQI 338

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
           + ++   DL     D    +  A  +      G+H +EFLL
Sbjct: 339 LNSQSWSDLEWSEGDDEAAVESAQNV-----RGFHTLEFLL 374



 Score = 58.9 bits (141), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 74/198 (37%), Gaps = 23/198 (11%)

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDIN 249
           + P  D    + T  +      Y++ V+ +L +D   +  AW      G++   L K  +
Sbjct: 28  DNPTVDPANIDYTPENASSWHNYMRNVAALLKTDATNLYNAWNSSYKGGESYASLFKAHS 87

Query: 250 AG--------LNSIITGMTSLSYNELAGERMNLGLI---LHDPEQE----IDCFSDNTYA 294
                     +  I+     ++ NE+   ++          + E+        +S ++  
Sbjct: 88  GSPYASALSCVEEIVDKCAEIA-NEVGTAKIGDPYNLYKAGNTEEALYAVESWYSWHSRD 146

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
            Y N++  I ++Y   Y  ++G  I+  S+  +I+  N +L  +I +      K    + 
Sbjct: 147 DYTNNIYSIRNAY---YGSLDGN-INANSLSTVIAGANSSLDTKIKNAIQKAAKAIQDIP 202

Query: 355 DRAENIESFDQMISENNP 372
               N    ++ ++  + 
Sbjct: 203 QPFRNHIPSNETVAAMDA 220


>gi|212694845|ref|ZP_03302973.1| hypothetical protein BACDOR_04379 [Bacteroides dorei DSM 17855]
 gi|212662598|gb|EEB23172.1| hypothetical protein BACDOR_04379 [Bacteroides dorei DSM 17855]
          Length = 393

 Score =  106 bits (264), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 53/366 (14%), Positives = 128/366 (34%), Gaps = 66/366 (18%)

Query: 16  HALSIVPNVSLEKVLQNYATI-AHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
              +   +   E + + Y     +  Y++       L   ++ L ++    N++     +
Sbjct: 33  DTGTSETDAKFEAIAKQYLDHTVYVTYKNLADETEQLVKDLQALKSSKTDANVKATCETF 92

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           + AR  +++SE + +G       D  +++WPLD   +D + ++     +   +       
Sbjct: 93  LEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD---LDGLQTALKNTEQVEAM------- 142

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ----------DL 184
                   ++ D+             A     N   G+H IE++L+            DL
Sbjct: 143 ------GGEDGDIY------------AGEKLGNSLLGFHGIEYILFEDGSPKSVSKISDL 184

Query: 185 KTNVREP-----GNRPYT-DFDIGNCTGGHCRRRVEYLKVVSKILV---------SDLEE 229
                        NR +  +      +  +  R     KV +++ +         S  E 
Sbjct: 185 HLTYAVAVAGDLRNRCWQLELSWRGESAVNADRVA---KVANELELPYTVNSGEYSYGEN 241

Query: 230 MMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFS 289
           M+ A           +      + +II G  +++ +E+   ++       DP      +S
Sbjct: 242 MLNAGKAGSTYASWTL-----AMQAIIDGCKTIA-DEVGTSKIGKPYSGEDPAYIESPYS 295

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
             +   + +++I I ++Y G       E     S+H+ I+  ++ L  ++ +  +N +  
Sbjct: 296 HKSILDFYDNIISIQNAYMGGIENERDET---NSLHNYIAGVDKELDTKVVNAINNALTK 352

Query: 350 FHILKD 355
            + +  
Sbjct: 353 INAMAA 358


>gi|150005299|ref|YP_001300043.1| putative iron-regulated protein A precursor [Bacteroides vulgatus
           ATCC 8482]
 gi|149933723|gb|ABR40421.1| putative iron-regulated protein A precursor [Bacteroides vulgatus
           ATCC 8482]
          Length = 393

 Score =  106 bits (264), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 58/410 (14%), Positives = 138/410 (33%), Gaps = 78/410 (19%)

Query: 16  HALSIVPNVSLEKVLQNYATI-AHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
              +   +   + + + Y     +  Y++       L   ++ L ++    N++     +
Sbjct: 33  DTGTSETDAKFKAIAKQYLDHTVYVTYKNLADETEQLVKDLQALKSSKTDANVKATCETF 92

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           + AR  +++SE + +G       D  +++WPLD   +D + ++     +   +       
Sbjct: 93  LEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD---LDGLQTALKNTEQVEAM------- 142

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ----------DL 184
                   ++ D+             A     N   G+H IE++L+            DL
Sbjct: 143 ------GGEDGDIY------------AGEKLGNSLLGFHGIEYILFEDGSPKSVSKISDL 184

Query: 185 KTNVREP-----GNRPYT-DFDIGNCTGGHCRRRVEYLKVVSKILV---------SDLEE 229
                        NR +  +      +  +  R     KV +++ +         S  E 
Sbjct: 185 HLTYAVAVAGDLRNRCWQLELSWRGESAVNADRVA---KVANELELPYTVNSGEYSYGEN 241

Query: 230 MMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFS 289
           M+ A           +      + +II G  +++ +E+   ++       DP      +S
Sbjct: 242 MLNAGKAGSTYASWTL-----AMQAIIDGCKTIA-DEVGTSKIGKPYSGEDPAYIESPYS 295

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
             +   + +++I I ++Y G       E     S+H+ I+  ++ L  ++ +  +N +  
Sbjct: 296 HKSILDFYDNIISIQNAYMGGIENERDET---NSLHNYIAGVDKELDTKVVNAINNALTK 352

Query: 350 FHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            + +         F   I + +          I         L  ++ AL
Sbjct: 353 INAMAA------PFVNNIKDPSAG------EAIKACQDLDAILSDVKTAL 390


>gi|265750476|ref|ZP_06086539.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|263237372|gb|EEZ22822.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 393

 Score =  106 bits (264), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 59/410 (14%), Positives = 138/410 (33%), Gaps = 78/410 (19%)

Query: 16  HALSIVPNVSLEKVLQNYATI-AHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
              +   +   E + + Y     +  Y++       L   ++ L ++    N++     +
Sbjct: 33  DTGTSETDAKFEAIAKQYLDHTVYVTYKNLADETEQLVKDLQALKSSKTDANVKATCETF 92

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           + AR  +++SE + +G       D  +++WPLD   +D + ++     +   +       
Sbjct: 93  LEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD---LDGLQTALKNTEQVEAM------- 142

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ----------DL 184
                   ++ D+             A     N   G+H IE++L+            DL
Sbjct: 143 ------GGEDGDIY------------AGEKLGNSLLGFHGIEYILFEDGSPKSVSKISDL 184

Query: 185 KTNVREP-----GNRPYT-DFDIGNCTGGHCRRRVEYLKVVSKILV---------SDLEE 229
                        NR +  +      +  +  R     KV +++ +         S  E 
Sbjct: 185 HLTYAVAVAGDLRNRCWQLELSWRGESAVNADRVA---KVANELELPYTVNSGEYSYGEN 241

Query: 230 MMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFS 289
           M+ A           +      + +II G  +++ +E+   ++       DP      +S
Sbjct: 242 MLNAGKAGSTYASWTL-----AMQAIIDGCKTIA-DEVGTSKIGKPYSGEDPAYIESPYS 295

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
             +   + +++I I ++Y G       E     S+H+ I+  ++ L  ++ +  +N +  
Sbjct: 296 HKSILDFYDNIISIQNAYMGGIENERDET---NSLHNYIAGVDKELDTKVVNAINNALTK 352

Query: 350 FHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            + +         F   I + +          I         L  ++ AL
Sbjct: 353 INAMAA------PFVNNIKDPSAG------EAIKACQDLDAILSDVKTAL 390


>gi|319643493|ref|ZP_07998116.1| iron-regulated protein A [Bacteroides sp. 3_1_40A]
 gi|317384898|gb|EFV65854.1| iron-regulated protein A [Bacteroides sp. 3_1_40A]
          Length = 393

 Score =  106 bits (264), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 59/410 (14%), Positives = 138/410 (33%), Gaps = 78/410 (19%)

Query: 16  HALSIVPNVSLEKVLQNYATI-AHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
              +   +   E + + Y     +  Y++       L   ++ L ++    N++     +
Sbjct: 33  DTGTSETDAKFEAIAKQYLDHTVYVTYKNLADETEQLVKDLQALKSSKTDANVKATCETF 92

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           + AR  +++SE + +G       D  +++WPLD   +D + ++     +   +       
Sbjct: 93  LEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD---LDGLQTALKNTEQVEAM------- 142

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ----------DL 184
                   ++ D+             A     N   G+H IE++L+            DL
Sbjct: 143 ------GGEDGDIY------------AGEKLGNSLLGFHGIEYILFEDGSPKSVSKISDL 184

Query: 185 KTNVREP-----GNRPYT-DFDIGNCTGGHCRRRVEYLKVVSKILV---------SDLEE 229
                        NR +  +      +  +  R     KV +++ +         S  E 
Sbjct: 185 HLTYAVAVAGDLRNRCWQLELSWRGESAVNADRVA---KVANELELPYTVNSGEYSYGEN 241

Query: 230 MMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFS 289
           M+ A           +      + +II G  +++ +E+   ++       DP      +S
Sbjct: 242 MLNAGKAGSTYASWTL-----AMQAIIDGCKTIA-DEVGTSKIGKPYSGEDPAYIESPYS 295

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
             +   + +++I I ++Y G       E     S+H+ I+  ++ L  ++ +  +N +  
Sbjct: 296 HKSILDFYDNIISIQNAYMGGIENERDET---NSLHNYIAGVDKELDTKVVNAINNALTK 352

Query: 350 FHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            + +         F   I + +          I         L  ++ AL
Sbjct: 353 INAMAA------PFVNNIKDPSAG------EAIKACQDLDAILSDVKTAL 390


>gi|294777137|ref|ZP_06742594.1| imelysin [Bacteroides vulgatus PC510]
 gi|294449006|gb|EFG17549.1| imelysin [Bacteroides vulgatus PC510]
          Length = 393

 Score =  105 bits (263), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 59/410 (14%), Positives = 138/410 (33%), Gaps = 78/410 (19%)

Query: 16  HALSIVPNVSLEKVLQNYATI-AHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
              +   +   E + + Y     +  Y++       L   ++ L ++    N++     +
Sbjct: 33  DTGTSETDAKFEAIAKQYLDHTVYVTYKNLADETEQLVKDLQALKSSKTDANVKATCETF 92

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           + AR  +++SE + +G       D  +++WPLD   +D + ++     +   +       
Sbjct: 93  LEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD---LDGLQTALKNTEQVEAM------- 142

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ----------DL 184
                   ++ D+             A     N   G+H IE++L+            DL
Sbjct: 143 ------GGEDGDIY------------AGEKLGNSLLGFHGIEYILFEDGSPKSVSKISDL 184

Query: 185 KTNVREP-----GNRPYT-DFDIGNCTGGHCRRRVEYLKVVSKILV---------SDLEE 229
                        NR +  +      +  +  R     KV +++ +         S  E 
Sbjct: 185 HLTYAVAVAGDLRNRCWQLELSWRGESAVNADRVA---KVANELELPYTVNSGEYSYGEN 241

Query: 230 MMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFS 289
           M+ A           +      + +II G  +++ +E+   ++       DP      +S
Sbjct: 242 MLNAGKAGSTYASWTL-----AMQAIIDGCKTIA-DEVGTSKIGKPYSGEDPAYIESPYS 295

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
             +   + +++I I ++Y G       E     S+H+ I+  ++ L  ++ +  +N +  
Sbjct: 296 HKSILDFYDNIISIQNAYMGGIENERDET---NSLHNYIAGVDKELDTKVVNAINNALTK 352

Query: 350 FHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            + +         F   I + +          I         L  ++ AL
Sbjct: 353 INAMAA------PFVNNIKDPSAG------EAIKACQDLDAILSDVKTAL 390


>gi|237727195|ref|ZP_04557676.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|229434051|gb|EEO44128.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
          Length = 390

 Score =  105 bits (263), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 59/410 (14%), Positives = 138/410 (33%), Gaps = 78/410 (19%)

Query: 16  HALSIVPNVSLEKVLQNYATI-AHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
              +   +   E + + Y     +  Y++       L   ++ L ++    N++     +
Sbjct: 30  DTGTSETDAKFEAIAKQYLDHTVYVTYKNLADETEQLVKDLQALKSSKTDANVKATCETF 89

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           + AR  +++SE + +G       D  +++WPLD   +D + ++     +   +       
Sbjct: 90  LEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD---LDGLQTALKNTEQVEAM------- 139

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ----------DL 184
                   ++ D+             A     N   G+H IE++L+            DL
Sbjct: 140 ------GGEDGDIY------------AGEKLGNSLLGFHGIEYILFEDGSPKSVSKISDL 181

Query: 185 KTNVREP-----GNRPYT-DFDIGNCTGGHCRRRVEYLKVVSKILV---------SDLEE 229
                        NR +  +      +  +  R     KV +++ +         S  E 
Sbjct: 182 HLTYAVAVAGDLRNRCWQLELSWRGESAVNADRVA---KVANELELPYTVNSGGYSYGEN 238

Query: 230 MMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFS 289
           M+ A           +      + +II G  +++ +E+   ++       DP      +S
Sbjct: 239 MLNAGKAGSTYASWTL-----AMQAIIDGCKTIA-DEVGTSKIGKPYSGEDPAYIESPYS 292

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
             +   + +++I I ++Y G       E     S+H+ I+  ++ L  ++ +  +N +  
Sbjct: 293 HKSILDFYDNIISIQNAYMGGIENERDET---NSLHNYIAGVDKELDTKVVNAINNALTK 349

Query: 350 FHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            + +         F   I + +          I         L  ++ AL
Sbjct: 350 INAMAA------PFVNNIKDPSAG------EAIKACQDLDAILSDVKTAL 387


>gi|237710885|ref|ZP_04541366.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|229454729|gb|EEO60450.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
          Length = 390

 Score =  105 bits (263), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 59/410 (14%), Positives = 138/410 (33%), Gaps = 78/410 (19%)

Query: 16  HALSIVPNVSLEKVLQNYATI-AHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
              +   +   E + + Y     +  Y++       L   ++ L ++    N++     +
Sbjct: 30  DTGTSETDAKFEAIAKQYLDHTVYVTYKNLADETEQLVKDLQALKSSKTDANVKATCETF 89

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           + AR  +++SE + +G       D  +++WPLD   +D + ++     +   +       
Sbjct: 90  LEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD---LDGLQTALKNTEQVEAM------- 139

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ----------DL 184
                   ++ D+             A     N   G+H IE++L+            DL
Sbjct: 140 ------GGEDGDIY------------AGEKLGNSLLGFHGIEYILFEDGSPKSVSKISDL 181

Query: 185 KTNVREP-----GNRPYT-DFDIGNCTGGHCRRRVEYLKVVSKILV---------SDLEE 229
                        NR +  +      +  +  R     KV +++ +         S  E 
Sbjct: 182 HLTYAVAVAGDLRNRCWQLELSWRGESAVNADRVA---KVANELELPYTVNSGEYSYGEN 238

Query: 230 MMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFS 289
           M+ A           +      + +II G  +++ +E+   ++       DP      +S
Sbjct: 239 MLNAGKAGSTYASWTL-----AMQAIIDGCKTIA-DEVGTSKIGKPYSGEDPAYIESPYS 292

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
             +   + +++I I ++Y G       E     S+H+ I+  ++ L  ++ +  +N +  
Sbjct: 293 HKSILDFYDNIISIQNAYMGGIENERDET---NSLHNYIAGVDKELDTKVVNAINNALTK 349

Query: 350 FHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            + +         F   I + +          I         L  ++ AL
Sbjct: 350 INAMAA------PFVNNIKDPSAG------EAIKACQDLDAILSDVKTAL 387


>gi|288802515|ref|ZP_06407954.1| iron-regulated protein A [Prevotella melaninogenica D18]
 gi|288335043|gb|EFC73479.1| iron-regulated protein A [Prevotella melaninogenica D18]
          Length = 394

 Score =  103 bits (258), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 76/423 (17%), Positives = 144/423 (34%), Gaps = 86/423 (20%)

Query: 28  KVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNL-----ENARLQWIRARIPY 81
           KV+ NY   +    Y D    +  L  A + L        L     + A   +  AR  +
Sbjct: 3   KVVANYIDEVVKPTYLDLAKKSDILYKACQNLYQKRKAGTLTQNDIDAACEAFKGARRDW 62

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
           +QSE + +G    +  D  +++WPLD             +     L  AN+IA       
Sbjct: 63  EQSESFLYGAASDNEIDPHIDSWPLD------------HDQLTRALNDANVIAG------ 104

Query: 142 EKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
                   I+ +   K    N  + +   G+H +EF+L+       V +      T+  +
Sbjct: 105 --------INGENPTKYVYDNNGNFDSVLGFHGLEFVLFRNGKNRTVADFNAEKETEAGL 156

Query: 202 GNCTGGHCR----------RRVEYLK----VVSKILVSDLEEMMKA-WGPDGQATKDL-- 244
            + +  +            R + YL     + + I  S L ++  A W  +G   + L  
Sbjct: 157 TSVSTVNEAAFAAAVASDLRNMTYLLEYGWLGTTIPTSHLNQLANAMWVVNGTRHRGLSA 216

Query: 245 ------------------MKDINAGLNSIITGMTSLSYNELAGERMNLGLI----LHDPE 282
                                 +  LN+I  G  S    E+A +++             +
Sbjct: 217 KNIPYRDYSQFATKENGMFASWHETLNNIFIGGCSGICEEVASQKLGQAYRKATGTGTEK 276

Query: 283 QE----IDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQE 338
                    +S  ++  Y +++  I +S  G     N       SI + + +NN     E
Sbjct: 277 DAANYIESPYSKRSFQDYQDNIYSIKNSLYGVRGTENISTPAQYSIMNFLKNNNYPNYNE 336

Query: 339 INDKFSNTMKDFHILKDRAENIESF-DQMISENNPEGNKIVRNLINDLITQTESLRKIRI 397
           +N+  +   +    L+   ++  +F DQ        GN  V+  I+ +    E+L     
Sbjct: 337 LNNALN---EAIAALETAKKSGIAFIDQ-------PGNPQVKTCIDKVDALNEALNAAGT 386

Query: 398 ALD 400
            ++
Sbjct: 387 WIN 389


>gi|301598665|pdb|3N8U|A Chain A, Crystal Structure Of An Imelysin Peptidase (Bacova_03801)
           From Bacteroides Ovatus At 1.44 A Resolution
 gi|301598666|pdb|3N8U|B Chain B, Crystal Structure Of An Imelysin Peptidase (Bacova_03801)
           From Bacteroides Ovatus At 1.44 A Resolution
 gi|309320705|pdb|3OYV|A Chain A, Crystal Structure Of An Imelysin Peptidase (Bacova_03801)
           From Bacteroides Ovatus Atcc 8483 At 1.25 A Resolution
          Length = 361

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 59/161 (36%), Gaps = 30/161 (18%)

Query: 20  IVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           I  +  L  V+  Y   +    Y+        L +A+  L   P+    E A   WI AR
Sbjct: 220 INTDAVLNPVVTQYVDAVVVPTYKSLKEKNDALYNAVIVLADNPSNSAFETACDAWITAR 279

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
            P+++SE + FG       D   ++WPLD+  I                         +I
Sbjct: 280 EPWEKSEAFLFGPVDEXGLDPNXDSWPLDQNAI------------------------VQI 315

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
           + ++   DL     D    +  A  +      G+H +EFLL
Sbjct: 316 LNSQSWSDLEWSEGDDEAAVESAQNV-----RGFHTLEFLL 351



 Score = 56.2 bits (134), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 73/198 (36%), Gaps = 23/198 (11%)

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDIN 249
           + P  D    + T  +      Y + V+ +L +D   +  AW      G++   L K  +
Sbjct: 5   DNPTVDPANIDYTPENASSWHNYXRNVAALLKTDATNLYNAWNSSYKGGESYASLFKAHS 64

Query: 250 AG--------LNSIITGMTSLSYNELAGERMNLGLI---LHDPEQE----IDCFSDNTYA 294
                     +  I+     ++ NE+   ++          + E+        +S ++  
Sbjct: 65  GSPYASALSCVEEIVDKCAEIA-NEVGTAKIGDPYNLYKAGNTEEALYAVESWYSWHSRD 123

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
            Y N++  I ++Y   Y  ++G  I+  S+  +I+  N +L  +I +      K    + 
Sbjct: 124 DYTNNIYSIRNAY---YGSLDGN-INANSLSTVIAGANSSLDTKIKNAIQKAAKAIQDIP 179

Query: 355 DRAENIESFDQMISENNP 372
               N    ++ ++  + 
Sbjct: 180 QPFRNHIPSNETVAAXDA 197


>gi|198276853|ref|ZP_03209384.1| hypothetical protein BACPLE_03058 [Bacteroides plebeius DSM 17135]
 gi|198270378|gb|EDY94648.1| hypothetical protein BACPLE_03058 [Bacteroides plebeius DSM 17135]
          Length = 394

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/147 (25%), Positives = 56/147 (38%), Gaps = 29/147 (19%)

Query: 38  HAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTW 97
              Y D      TL   + TL   P  +  ++A   WI AR P+++SE + FG       
Sbjct: 270 LPTYSDLKDRVATLYDKVNTLAANPTNQAFKDACDAWITAREPWEKSEAFLFGPVADQGL 329

Query: 98  DKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK 157
           D  +++WPLD+  I                   NI+ +      E   D S  S  +   
Sbjct: 330 DPNMDSWPLDQAAI------------------VNILNSGDYSQMEWSGDYSEDSEAISAA 371

Query: 158 LHRANGIDTNITTGYHVIEFLLW--GQ 182
            +           G+H +EFLL+  GQ
Sbjct: 372 QN---------VRGFHTLEFLLFKDGQ 389



 Score = 51.9 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 35/