PSIBLAST alignment of GI: 254780635 and protein with PDB id: 3at7

>gi|323714411|pdb|3AT7|A Chain A, Crystal Structure Of Bacterial Cell-Surface Alginate-Binding Protein Algp7 Length = 283
>gi|323714412|pdb|3AT7|B Chain B, Crystal Structure Of Bacterial Cell-Surface Alginate-Binding Protein Algp7 Length = 283
 Score = 96.9 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 51/403 (12%), Positives = 107/403 (26%), Gaps = 132/403 (32%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +  +  +++     S A + V  + L + + +Y               +TL         
Sbjct: 6   LSRLASLTLFVGFMSAAQAAVAPLDLVQPISDYKIYV-------SENLQTLVRDTREFTN 58

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
                ++  A+  +   R+ Y++ E                   P+ E F D   S   +
Sbjct: 59  AVKAGDVAKAKKLFASTRMSYERIE-------------------PIAELFSDLDASIDSR 99

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
            ++                                               G+H IE+ L+
Sbjct: 100 ADDHEK------------------------------------AEKDPAFFGFHRIEYGLF 123

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
            Q+                                L  V+  L++D+ E+ K        
Sbjct: 124 AQNSAKG----------------------------LAPVADKLMADVLELQKRIRGLTFP 155

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
            + +             G  ++   E+A  +++          E D +S      +  + 
Sbjct: 156 PEKV------------VGGAAVLMEEVAATKISG---------EEDRYSHTDLWDFQANF 194

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
            G                        L+  +NR  A +++  F    K     +      
Sbjct: 195 EGAKKIVDL--------------FRPLVVKDNRAFADKVDANFDTVFKTLAKYRTADGGF 240

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           E + ++    +    K++   +N L    E L K+R  L L  
Sbjct: 241 ELYGKL----SERDRKVLAGRVNTL---AEDLSKMRGLLGLDL 276