BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780635|ref|YP_003065048.1| hypothetical protein
CLIBASIA_02610 [Candidatus Liberibacter asiaticus str. psy62]
         (412 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780635|ref|YP_003065048.1| hypothetical protein CLIBASIA_02610 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040312|gb|ACT57108.1| hypothetical protein CLIBASIA_02610 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 412

 Score =  423 bits (1088), Expect = e-116,   Method: Composition-based stats.
 Identities = 412/412 (100%), Positives = 412/412 (100%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT
Sbjct: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
           TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK
Sbjct: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
           ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW
Sbjct: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA
Sbjct: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
           TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV
Sbjct: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI
Sbjct: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP 412
           ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP
Sbjct: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP 412


>gi|187479059|ref|YP_787084.1| hypothetical protein BAV2579 [Bordetella avium 197N]
 gi|115423646|emb|CAJ50191.1| putative exported protein [Bordetella avium 197N]
          Length = 430

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 197/392 (50%), Positives = 264/392 (67%), Gaps = 13/392 (3%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
             + V++ Y+ IA A Y+DAL  A+TL  AI+ L+  P++  L+ AR  WI AR PYQQ+
Sbjct: 24  EPKAVVKTYSDIAAAGYQDALTSAKTLQQAIDALIAQPSEATLKAAREAWIVARAPYQQT 83

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EV+RFGN +VD W+ +VNAWPLDEG IDYVD+ YG E+++N  Y  N+IANSKI V  K 
Sbjct: 84  EVFRFGNPVVDDWEGRVNAWPLDEGLIDYVDAGYGTESDDNAFYAVNVIANSKISVGGKT 143

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE------------P 191
           ID   ++P+LL + LH A+G + N+ TGYH IEFLLWGQDL                   
Sbjct: 144 IDAGKLTPELLAEVLHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPKDRKGTPQERHA 203

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
           GNRP+TDFD  +CTGG+C RRV YLKVV+++LV DL+EM   W  DG A K + +D  AG
Sbjct: 204 GNRPHTDFDPKHCTGGNCERRVAYLKVVTQLLVDDLKEMAGQWQDDGDARKVVQEDPKAG 263

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L +++TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  + IGI + Y G Y
Sbjct: 264 LVAMLTGMGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYNQIGIRNVYLGAY 323

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENN 371
            R +G+++ GAS+ DL+   +  L  E+  K + T+     ++DRAE +E++DQMI+E N
Sbjct: 324 TRPDGKQVSGASLSDLVKEKDPKLDTEVRAKLNATVAAMQAMRDRAEKVETYDQMIAEGN 383

Query: 372 PEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
            EGN IV+  I+ LI QT S  ++   LDL +
Sbjct: 384 KEGNAIVQAAIDRLIDQTRSFERVIALLDLGD 415


>gi|33596872|ref|NP_884515.1| hypothetical protein BPP2269 [Bordetella parapertussis 12822]
 gi|33573573|emb|CAE37567.1| putative exported protein [Bordetella parapertussis]
          Length = 434

 Score =  408 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 192/418 (45%), Positives = 268/418 (64%), Gaps = 13/418 (3%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +    +   L       V     + V+Q Y+ IA A Y+DAL  A+ L +AI+ L+  
Sbjct: 3   KLLRKTVLALALGMTTPLAVAAAQPKAVVQTYSDIALAGYQDALASAQALRTAIDALIAA 62

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ + L+ AR  W+ AR+PYQQ+E +RFGN +VD W+ +VNAWPLDEG IDYVD++YG E
Sbjct: 63  PSAQTLQAARQAWLAARVPYQQTEAFRFGNPVVDDWEGRVNAWPLDEGLIDYVDAAYGTE 122

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
           ++ N  YT N+IAN++I V  K ID S I+P LL + LH A+G + N+ TGYH IEFLLW
Sbjct: 123 SDANAFYTVNVIANARISVGGKTIDASKITPQLLSEVLHEADGNEANVATGYHAIEFLLW 182

Query: 181 GQDLKTNVRE------------PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLE 228
           GQDL                   G+RP+TDFD   CTGG+C RRV+YLK V+ +LV DL+
Sbjct: 183 GQDLNGTGPAPKDRTGTPQERHAGDRPHTDFDPRQCTGGNCERRVQYLKAVTDLLVDDLQ 242

Query: 229 EMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCF 288
           EM+  W   G A K + +D  AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCF
Sbjct: 243 EMVDNWKAGGAARKVVEEDPKAGLIAMMTGLGSLSYGELAGERMKLGLMLHDPEEEHDCF 302

Query: 289 SDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMK 348
           SDNT+ S+  + IGI + Y G Y R++G+ + GAS+ DL+   +  L  E+  K   T++
Sbjct: 303 SDNTHNSHYYNQIGIRNVYLGNYARIDGKTVSGASLSDLVKAKDAKLDAEVRAKLDATVQ 362

Query: 349 DFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
               +K RAE +E++DQMI++ N EGN +V+  I+ L+ QT SL ++  AL+L +   
Sbjct: 363 AMEAMKQRAETVETYDQMIAQGNKEGNAVVQAAIDRLVDQTRSLERVIAALELGDIEL 420


>gi|33592652|ref|NP_880296.1| hypothetical protein BP1561 [Bordetella pertussis Tohama I]
 gi|33572298|emb|CAE41851.1| putative exported protein [Bordetella pertussis Tohama I]
 gi|332382069|gb|AEE66916.1| hypothetical protein BPTD_1544 [Bordetella pertussis CS]
          Length = 436

 Score =  408 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 192/418 (45%), Positives = 268/418 (64%), Gaps = 13/418 (3%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +    +   L       V     + V+Q Y+ IA A Y+DAL  A+ L +AI+ L+  
Sbjct: 5   KLLRKTVLALALGVATPLAVAAAQPKAVVQTYSDIALAGYQDALASAQALRTAIDALIAA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ + L+ AR  W+ AR+PYQQ+E +RFGN +VD W+ +VNAWPLDEG IDYVD++YG E
Sbjct: 65  PSAQTLQAARQAWLAARVPYQQTEAFRFGNPVVDDWEGRVNAWPLDEGLIDYVDAAYGTE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
           ++ N  YT N+IAN++I V  K ID S I+P LL + LH A+G + N+ TGYH IEFLLW
Sbjct: 125 SDANAFYTVNVIANARISVGGKTIDASKITPQLLSEVLHEADGNEANVATGYHAIEFLLW 184

Query: 181 GQDLKTNVRE------------PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLE 228
           GQDL                   G+RP+TDFD   CTGG+C RRV+YLK V+ +LV DL+
Sbjct: 185 GQDLNGTGPAPKDRTGTPQERHAGDRPHTDFDPRQCTGGNCERRVQYLKAVTDLLVDDLQ 244

Query: 229 EMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCF 288
           EM+  W   G A K + +D  AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCF
Sbjct: 245 EMVDNWKAGGAARKVVEEDPKAGLIAMMTGLGSLSYGELAGERMKLGLMLHDPEEEHDCF 304

Query: 289 SDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMK 348
           SDNT+ S+  + IGI + Y G Y R++G+ + GAS+ DL+   +  L  E+  K   T++
Sbjct: 305 SDNTHNSHYYNQIGIRNVYLGNYARIDGKTVSGASLSDLVKARDAKLDAEVRAKLDATVQ 364

Query: 349 DFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
               +K RAE +E++DQMI++ N EGN +V+  I+ L+ QT SL ++  AL+L +   
Sbjct: 365 AMEAMKQRAETVETYDQMIAQGNKEGNAVVQVAIDRLVDQTRSLERVIAALELGDIEL 422


>gi|33600706|ref|NP_888266.1| hypothetical protein BB1721 [Bordetella bronchiseptica RB50]
 gi|33568306|emb|CAE32218.1| putative exported protein [Bordetella bronchiseptica RB50]
          Length = 434

 Score =  406 bits (1044), Expect = e-111,   Method: Composition-based stats.
 Identities = 192/418 (45%), Positives = 268/418 (64%), Gaps = 13/418 (3%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +    +   L       V     + V+Q Y+ IA A Y+DAL  A+ L +AI+ L+  
Sbjct: 3   KLLRKTVLALALGMATPLAVAAAQPKAVVQTYSDIALAGYQDALASAQALRTAIDALIAA 62

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ + L+ AR  W+ AR+PYQQ+E +RFGN +VD W+ +VNAWPLDEG IDYVD++YG E
Sbjct: 63  PSAQTLQAARQAWLAARVPYQQTEAFRFGNPVVDDWEGRVNAWPLDEGLIDYVDAAYGTE 122

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
           ++ N  YT N+IAN++I V  K ID S I+P LL + LH A+G + N+ TGYH IEFLLW
Sbjct: 123 SDANAFYTVNVIANARISVGGKTIDASKITPQLLSEVLHEADGNEANVATGYHAIEFLLW 182

Query: 181 GQDLKTNVRE------------PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLE 228
           GQDL                   G+RP+TDFD   CTGG+C RRV+YLK V+ +LV DL+
Sbjct: 183 GQDLNGTGPAPKDRTGTPQERHAGDRPHTDFDPRQCTGGNCERRVQYLKAVTDLLVDDLQ 242

Query: 229 EMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCF 288
           EM+  W   G A K + +D  AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCF
Sbjct: 243 EMVDNWKAGGAARKVVEEDPKAGLIAMMTGLGSLSYGELAGERMKLGLMLHDPEEEHDCF 302

Query: 289 SDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMK 348
           SDNT+ S+  + IGI + Y G Y R++G+ + GAS+ DL+   +  L  E+  K   T++
Sbjct: 303 SDNTHNSHYYNQIGIRNVYLGNYARIDGKTVSGASLSDLVKAKDAKLDAEVRAKLDATVQ 362

Query: 349 DFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
               +K RAE +E++DQMI++ N EGN +V+  I+ L+ QT SL ++  AL+L +   
Sbjct: 363 AMEAMKQRAETVETYDQMIAQGNKEGNAVVQAAIDRLVDQTRSLERVIAALELGDIEL 420


>gi|311107741|ref|YP_003980594.1| imelysin [Achromobacter xylosoxidans A8]
 gi|310762430|gb|ADP17879.1| imelysin family protein 2 [Achromobacter xylosoxidans A8]
          Length = 432

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 200/399 (50%), Positives = 266/399 (66%), Gaps = 13/399 (3%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
             +    V  + V+  Y+ +A A YED+L  A+TL +AI+ L+  P+ + L+ AR  W+ 
Sbjct: 16  GGTAQAAVEPKAVVATYSDLALAGYEDSLTSAKTLRTAIDALIAKPSAETLKAAREAWLA 75

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR+PYQQ+E YRFGN IVD W+ +VNAWPLDEG IDYVD+SYG EN+EN  Y  N+IANS
Sbjct: 76  ARVPYQQTEAYRFGNPIVDDWEGRVNAWPLDEGLIDYVDASYGTENDENAYYAVNVIANS 135

Query: 137 KIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE----- 190
           KI V  K +D+S I+P LL + LH A+G + N+ TGYH IEFLLWGQDL           
Sbjct: 136 KISVGGKTVDVSKITPKLLSEILHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPADRK 195

Query: 191 -------PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                   GNRP+TDFD   CTGGHC RRVE+LK V+ +LV+DLEEM+  W  DG A K 
Sbjct: 196 GTPQERHAGNRPHTDFDTKQCTGGHCERRVEFLKAVTDLLVTDLEEMVGNWKKDGAARKA 255

Query: 244 LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           + +D  AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D IGI
Sbjct: 256 VEEDPKAGLIAMLTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYDQIGI 315

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESF 363
            + Y G Y R++G+ + GAS+ +L+   +  L  E+  K   T+     +K RAE +E++
Sbjct: 316 RNVYLGAYTRIDGKTVKGASLSELVKARDPKLDAEVRAKLDATVAAMQAMKTRAETVETY 375

Query: 364 DQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
           DQMIS+ N EGN +V+  I+ L+ QT SL ++   LDL 
Sbjct: 376 DQMISDGNKEGNAVVQAAIDRLVDQTRSLERVIALLDLG 414


>gi|317404824|gb|EFV85200.1| exported protein [Achromobacter xylosoxidans C54]
          Length = 432

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 196/394 (49%), Positives = 263/394 (66%), Gaps = 13/394 (3%)

Query: 22  PNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPY 81
                + V+ NY+ +A A YEDAL  A+TL  AI  LV  P+   L+ AR  W+ AR+PY
Sbjct: 21  AATQPKAVVTNYSDLALAGYEDALTSAKTLREAINALVAKPSADTLKAARQAWLDARVPY 80

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
           QQ+E +RFGN IVD W+ +VNAWPLDEG IDYVD+SYG EN+EN  Y  N+IANSKI V 
Sbjct: 81  QQTEAFRFGNPIVDDWEGRVNAWPLDEGLIDYVDASYGTENDENAYYAVNVIANSKISVG 140

Query: 142 EKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE---------- 190
            K +D+S I+P LL + LH A+G + N+ TGYH IEFLLWGQDL                
Sbjct: 141 GKTVDVSEITPKLLSEVLHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPADRKGTPQE 200

Query: 191 --PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDI 248
              GNRP+TD+D+  CTGG+C RR+ YLK V+ +LV+DLEEM+  W  DG A K + +D 
Sbjct: 201 RHSGNRPHTDYDVKQCTGGNCERRIAYLKAVTDLLVTDLEEMVGNWQKDGAARKAVEEDP 260

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
            AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  + IGI + Y 
Sbjct: 261 KAGLVAMLTGVGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHFYNQIGIRNVYL 320

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
           G Y R++G+++ GAS+ +L+   +  L  E+  K   T+     +K RAE +E++DQMI+
Sbjct: 321 GAYTRVDGKQVSGASLSELVKARDPKLDAEVRAKLDATVAAMQAMKTRAETVETYDQMIA 380

Query: 369 ENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
           + N EGN +V+  I+ L+ QT SL ++   LDL 
Sbjct: 381 DGNKEGNAVVQAAIDRLVDQTRSLERVIALLDLG 414


>gi|222147269|ref|YP_002548226.1| hypothetical protein Avi_0335 [Agrobacterium vitis S4]
 gi|221734259|gb|ACM35222.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 425

 Score =  405 bits (1041), Expect = e-111,   Method: Composition-based stats.
 Identities = 214/398 (53%), Positives = 289/398 (72%), Gaps = 1/398 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           +++     S A         + VL++YA +A AKY+D+L  A+TLD+A++ L+  P+K  
Sbjct: 11  LALFIASTSFAAPAAKAPEADAVLKHYAELAEAKYQDSLTTAKTLDAAVDALLAKPSKST 70

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  WI+AR+PYQQSEVYRFGNKIVD W+ KVNAWPLDEG IDYVD SYG E++ N 
Sbjct: 71  LNKARSAWIKARVPYQQSEVYRFGNKIVDDWEGKVNAWPLDEGLIDYVDKSYGTESDTNA 130

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLK 185
           LYTAN+IAN+KI +N +E+D + ++PD L   L  A G++ N+ TGYH IEFLLWGQDL 
Sbjct: 131 LYTANVIANTKIKINGEEVDATNLTPDFLANKLQEAGGVEANVATGYHAIEFLLWGQDLN 190

Query: 186 TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM 245
                 GNRP+TD+D+ NCTGGHC RR +YLK  S +LVSDL+EM+ AW P+G+ATK L+
Sbjct: 191 GTGPGAGNRPFTDYDLKNCTGGHCDRRAQYLKSASTLLVSDLQEMVDAWKPEGEATKTLL 250

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
            D  +GL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D +GI S
Sbjct: 251 ADPTSGLKAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTHNSHYYDALGIRS 310

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQ 365
           +YTG+Y R++G K+ G S+ DL++  ++ L +E+  K + TMK    L  RA+++E +DQ
Sbjct: 311 AYTGKYTRIDGTKMTGPSLSDLVAAKDKALDKEMKSKLNTTMKAMTALVKRAKSVEHYDQ 370

Query: 366 MISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           MI+ENN +GN  V+  I+ LI QT+S++++  ALDL E
Sbjct: 371 MIAENNKDGNATVQAGIDGLIDQTKSIQRVVAALDLGE 408


>gi|325291722|ref|YP_004277586.1| iron-regulated protein [Agrobacterium sp. H13-3]
 gi|325059575|gb|ADY63266.1| putative iron-regulated protein [Agrobacterium sp. H13-3]
          Length = 425

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 211/391 (53%), Positives = 282/391 (72%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            AL          V+++YA +AHAKYED+L  A+ LD AI+ L+ TP++  L+ AR  WI
Sbjct: 21  TALPASAATDAADVVKHYADVAHAKYEDSLTTAKALDKAIDALIATPSEGTLKAAREAWI 80

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
           +AR+PYQQSEVYRFGN +VD W+ KVNAWPLDEG IDYVD SYG E++EN LY ANIIAN
Sbjct: 81  KARVPYQQSEVYRFGNPVVDAWEGKVNAWPLDEGLIDYVDGSYGTESDENELYVANIIAN 140

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
            KI ++ +++D S I+P+L+  LH A  ++ N+TTGYH IEFLLWGQDL       GNRP
Sbjct: 141 PKIKISGEDVDTSKITPELIESLHEAGDVEANVTTGYHAIEFLLWGQDLNGTGPGAGNRP 200

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI 255
           YTD+D  NCT G+C RR +YLK  S +L+ DL+EM+ AW P+G+ATK +  D  AGL +I
Sbjct: 201 YTDYDKKNCTNGNCDRRGDYLKSASTLLIKDLQEMVDAWAPEGEATKTVEADPKAGLTAI 260

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           +TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI S+YTGEY R++
Sbjct: 261 LTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIASAYTGEYTRVD 320

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGN 375
           G K+ GAS+ +L+   ++ L  E+  K + T+   H ++ RA+ +E++DQMI E N EGN
Sbjct: 321 GTKMTGASLSELVGAKDKALNDEMTAKLNKTLDAMHAMEKRAQTVEAYDQMIGEGNKEGN 380

Query: 376 KIVRNLINDLITQTESLRKIRIALDLIEPNR 406
            +V+  I+ L+ QT+++ ++  ALDL +   
Sbjct: 381 AVVQAAIDGLLDQTKTVERVIAALDLGKIEL 411


>gi|293606599|ref|ZP_06688955.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292814984|gb|EFF74109.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 432

 Score =  402 bits (1033), Expect = e-110,   Method: Composition-based stats.
 Identities = 197/399 (49%), Positives = 265/399 (66%), Gaps = 13/399 (3%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
             +    V    V+  Y+ +A A YED+L  A+TL +AI  LV  P+   L+ AR  W+ 
Sbjct: 16  GGTAHAAVEPRAVVATYSDLALAGYEDSLAAAKTLRTAINALVAKPSPDTLQAARQAWLA 75

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR+PYQQ+E YRFGN IVD W+ +VNAWPLDEG IDYVD+SYG +N+EN  Y+ N+IANS
Sbjct: 76  ARVPYQQTEAYRFGNPIVDDWEGRVNAWPLDEGLIDYVDASYGTDNDENAYYSVNVIANS 135

Query: 137 KIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE----- 190
           KI V  K +D+S I+P LL + LH A+G + N+ TGYH IEFLLWGQDL           
Sbjct: 136 KISVGGKTVDVSKITPQLLSEVLHEADGNEANVATGYHAIEFLLWGQDLNGTGPAPADRK 195

Query: 191 -------PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                   GNRP+TDFD   CTGGHC RR+E+LK V+ +LV+DLEEM+  W  DG A K 
Sbjct: 196 GTPQERHAGNRPHTDFDTKQCTGGHCERRIEFLKAVTDLLVTDLEEMVGNWKKDGAARKA 255

Query: 244 LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           + +D  AGL +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D IGI
Sbjct: 256 VEEDPKAGLIAMLTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYDQIGI 315

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESF 363
            + Y G Y R++G+++ GAS+ +L+   +  L  E+  K   T+     +K RAE +E++
Sbjct: 316 RNVYLGTYTRIDGKQVTGASLSELVKARDPKLDAEVRAKLDATVAAMQAMKTRAETVETY 375

Query: 364 DQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
           DQMI++ N EGN +V+  I+ L+ QT SL ++   L+L 
Sbjct: 376 DQMIADGNKEGNAVVQAGIDRLVDQTRSLERVITLLELG 414


>gi|159184243|ref|NP_353318.2| hypothetical protein Atu0288 [Agrobacterium tumefaciens str. C58]
 gi|159139571|gb|AAK86103.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 425

 Score =  401 bits (1031), Expect = e-110,   Method: Composition-based stats.
 Identities = 212/400 (53%), Positives = 286/400 (71%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           + +  +    AL          V+++YA +AHAKYED+L  A+ LD AI+ L+ TP+++ 
Sbjct: 12  VLLAASAAFTALPAQAATDAAAVIKHYADVAHAKYEDSLTTAKALDKAIDALIATPSEET 71

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L+ AR  WI+AR+PYQQSEVYRFGN +VD W+ KVNAWPLDEG IDYVD+SYG E++EN 
Sbjct: 72  LKAAREAWIKARVPYQQSEVYRFGNPLVDAWEGKVNAWPLDEGLIDYVDASYGTESDENE 131

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
           LY ANIIAN KI ++ +E+D S I+P+L+  LH A  ++ N+TTGYH IEFLLWGQDL  
Sbjct: 132 LYVANIIANPKIKISGEEVDASKITPELIESLHEAGDVEANVTTGYHAIEFLLWGQDLNG 191

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
                GNRPYTD+D   CT G+C RR +YLK  S +LV DL+EM+ AW P+G+ATK +  
Sbjct: 192 TGPGAGNRPYTDYDKAKCTNGNCDRRADYLKSASSLLVKDLQEMVDAWAPEGEATKTVEA 251

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
           D  AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI S+
Sbjct: 252 DPKAGLTAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIASA 311

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
           YTG+Y R++G K+ GAS+ +L+   ++ L  E+  K + T+   H ++ RA+ +E++DQM
Sbjct: 312 YTGDYTRVDGTKMTGASLAELVGAKDKALNDEMTAKLNKTLNAMHAMEKRAQTVEAYDQM 371

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           I E N EGN +V+  I+ LI QT+++ ++  ALDL +   
Sbjct: 372 IGEGNKEGNAVVQAAIDGLIDQTKTVERVIAALDLGKIEL 411


>gi|163738590|ref|ZP_02146004.1| lipoprotein, putative [Phaeobacter gallaeciensis BS107]
 gi|163743022|ref|ZP_02150405.1| lipoprotein, putative [Phaeobacter gallaeciensis 2.10]
 gi|161383705|gb|EDQ08091.1| lipoprotein, putative [Phaeobacter gallaeciensis 2.10]
 gi|161387918|gb|EDQ12273.1| lipoprotein, putative [Phaeobacter gallaeciensis BS107]
          Length = 422

 Score =  401 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 190/377 (50%), Positives = 256/377 (67%), Gaps = 2/377 (0%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +VL  YA IAHAKY+D+L  A+TL +A+++L+  P+ + LE AR  W+ AR+PYQQSEV+
Sbjct: 28  EVLTTYANIAHAKYQDSLETAKTLQTAVDSLIAEPSAEALEAARKAWLAARVPYQQSEVF 87

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   +EN L   NI+AN    ++ K ID 
Sbjct: 88  RFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPTDENTLAALNIVANPSFELSGKSIDA 147

Query: 148 SIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCT 205
           S I+P+LL   LH A+G++ N+ TGYH IEFLLWGQDL       G+R +TD+  G +CT
Sbjct: 148 SAITPELLETTLHEADGVEANVATGYHAIEFLLWGQDLNGTDHGAGSRAWTDYAAGEDCT 207

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYN 265
            G+C RR EYLK  + +L+SDLE M   WG +G+A   L+ D NAG+ +++TGM SLSY 
Sbjct: 208 NGNCDRRGEYLKAATDLLISDLEWMAAQWGTEGEARGTLLSDENAGITAMLTGMGSLSYG 267

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G+ + Y GEYIR +G  + GAS+ 
Sbjct: 268 ETAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGVQNVYLGEYIRTDGSMVSGASLS 327

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           DL+   +  L  E+  K S TM+    +K  AE   S+DQM+ + N  G  +V   +N L
Sbjct: 328 DLVQEIDPALDGEMRSKLSTTMRALGQIKTAAEAGFSYDQMLEQGNEAGEALVMGGVNGL 387

Query: 386 ITQTESLRKIRIALDLI 402
           + QT S+ ++  ALDL 
Sbjct: 388 VDQTRSIERVVTALDLD 404


>gi|110633000|ref|YP_673208.1| imelysin [Mesorhizobium sp. BNC1]
 gi|110283984|gb|ABG62043.1| imelysin. Metallo peptidase. MEROPS family M75 [Chelativorans sp.
           BNC1]
          Length = 417

 Score =  398 bits (1023), Expect = e-109,   Method: Composition-based stats.
 Identities = 199/397 (50%), Positives = 263/397 (66%), Gaps = 1/397 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           + +  T  +  +S V       VL  YA IA A YED+L  AR+L SA+  L+ TP++  
Sbjct: 3   VPVAVTAVALGISAVHAEEPSAVLVTYADIAFAGYEDSLESARSLQSAVNALIATPSEDT 62

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  W+ AR+PYQQ+E +RFGN IVD W+ +VNAWPLDEG IDYVD+ YG E++ N 
Sbjct: 63  LVAARQAWLAARVPYQQTEAFRFGNPIVDEWEGRVNAWPLDEGLIDYVDAGYGTESDTNA 122

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
            YT N+IAN K+ V  + ID S I+P+L+R LH A GI++N+ TGYH IEFLLWGQDL  
Sbjct: 123 FYTVNVIANDKVSVGGEIIDTSQITPELIRSLHEAGGIESNVATGYHAIEFLLWGQDLNG 182

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
                G RP+TDFD  NCTGGHC RR +YL   + +LVSDL+EM+  W   G A   L +
Sbjct: 183 TGPGAGIRPHTDFDPANCTGGHCERRGQYLNAATALLVSDLQEMVSNWDAGGAARNALTQ 242

Query: 247 -DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
            D   GL +++TG+ SLSY ELAGERM LGL+L+DPE+E DCFSDNT+ S+  DV GI +
Sbjct: 243 GDPKVGLTALLTGLGSLSYGELAGERMKLGLLLNDPEEEHDCFSDNTHNSHFYDVQGIRN 302

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQ 365
            Y G Y RM GE + G+S+  L+   +  LA E+  K + T +    LK RAE++E++DQ
Sbjct: 303 VYFGRYERMGGEVVEGSSLAALVREKDAALADEMEAKLNATYEAAKNLKARAESVEAYDQ 362

Query: 366 MISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
           MI E N EGN  V+ +I+ L+ QT SL ++  ALD+ 
Sbjct: 363 MIGEGNAEGNATVQAVIDGLVDQTRSLERVIAALDIS 399


>gi|222084586|ref|YP_002543115.1| hypothetical protein Arad_0521 [Agrobacterium radiobacter K84]
 gi|221722034|gb|ACM25190.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 425

 Score =  398 bits (1022), Expect = e-109,   Method: Composition-based stats.
 Identities = 206/398 (51%), Positives = 279/398 (70%), Gaps = 5/398 (1%)

Query: 10  VFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
              +P  A +  P      ++++YA +AHAKYED+L+ A+ LD AI+ L+  P+ K L+ 
Sbjct: 17  TSAVPVLAKAPEPAA----IIKHYAEVAHAKYEDSLITAKALDKAIDALLANPSDKTLKA 72

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           A+  WI+AR+PYQQSEVYRFGN IVD W+ KVN+WPLDEG IDYVD+SYG E++EN+LY 
Sbjct: 73  AQAAWIKARVPYQQSEVYRFGNPIVDDWEGKVNSWPLDEGLIDYVDASYGTESDENSLYV 132

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
           AN+IAN  I +N K++D S ++P+ L   LH+A G++ N+ TGYH IEFLLWGQDL    
Sbjct: 133 ANVIANKTIKINGKDVDTSHLTPEFLSGTLHQAGGVEANVATGYHAIEFLLWGQDLHGTG 192

Query: 189 REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDI 248
              G RP TD+D+ NCT G+C RR EYLK  S +LVSDL+EM + W PDG+ATK +  D 
Sbjct: 193 PGAGERPATDYDLKNCTHGNCDRRAEYLKSASTLLVSDLQEMTEKWTPDGEATKHVEADP 252

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
            AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+ ND IGI ++Y 
Sbjct: 253 KAGLAAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHNNDAIGIAAAYN 312

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
           G Y R++G+K+ G S+HDL++  ++ L +E+  K + T+     +  R E +E +DQMI 
Sbjct: 313 GNYTRIDGKKLKGPSLHDLVAAKDKALDKEVETKLNATLDAMKAMVHRGETVEKYDQMIG 372

Query: 369 ENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           E N  GN  V+  I+ L+ QT+S++++  ALDL     
Sbjct: 373 EGNTVGNATVQKAIDGLLDQTKSIQRVVAALDLGTIKL 410


>gi|218673655|ref|ZP_03523324.1| putative iron-regulated protein [Rhizobium etli GR56]
          Length = 429

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 202/370 (54%), Positives = 268/370 (72%), Gaps = 1/370 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  +  P+   L+ AR  WI+AR+PYQQ+EVYR
Sbjct: 60  VVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPSDATLKAAREAWIKARVPYQQTEVYR 119

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN +VD W+ KVNAWPLDEG IDYVD SYG E++EN+LY AN+IAN  I ++ K++D S
Sbjct: 120 FGNPVVDEWEGKVNAWPLDEGLIDYVDPSYGTESDENSLYVANVIANKTIKIDGKDVDAS 179

Query: 149 IISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+ NCT G
Sbjct: 180 KLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDLKNCTHG 239

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 240 NCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGSLSYGEL 299

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G S+HDL
Sbjct: 300 AGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLTGPSLHDL 359

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L  E+  K + T+   + +  R E +E +DQMI E N EGN +V+  I+ LI 
Sbjct: 360 VAAKDKALDAEMEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAAIDGLID 419

Query: 388 QTESLRKIRI 397
           QT+S++++  
Sbjct: 420 QTKSIQRVIA 429


>gi|190889971|ref|YP_001976513.1| hypothetical protein RHECIAT_CH0000341 [Rhizobium etli CIAT 652]
 gi|190695250|gb|ACE89335.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 424

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 205/379 (54%), Positives = 273/379 (72%), Gaps = 1/379 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  +  P  + L+ AR  WI+AR+PYQQ+EVYR
Sbjct: 32  VVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPTDETLKAARDAWIKARVPYQQTEVYR 91

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN +VD W+ KVNAWPLDEG IDYVD SYG E++EN+LY AN+IAN  I ++ K++D S
Sbjct: 92  FGNPVVDEWEGKVNAWPLDEGLIDYVDPSYGSESDENSLYVANVIANKTIKIDGKDVDAS 151

Query: 149 IISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+ NCT G
Sbjct: 152 KLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDLKNCTHG 211

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 212 NCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGSLSYGEL 271

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G S+HDL
Sbjct: 272 AGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSGPSLHDL 331

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L  E+  K + T+   + +  R E +E +DQMI+E N +GN +V+  I+ LI 
Sbjct: 332 VAAKDKALDAELEGKLNKTLDAMNSMAKRGETVEKYDQMIAEGNKDGNAVVQAAIDGLID 391

Query: 388 QTESLRKIRIALDLIEPNR 406
           QT+S++++  ALDL     
Sbjct: 392 QTKSIQRVIAALDLGTVQL 410


>gi|327192006|gb|EGE58987.1| hypothetical protein RHECNPAF_2530063 [Rhizobium etli CNPAF512]
          Length = 424

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 204/379 (53%), Positives = 272/379 (71%), Gaps = 1/379 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYED+L  A+ LD+AI+  +  P  + L+ AR  WI+AR+PYQQ+EVYR
Sbjct: 32  VVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPTDETLKAARDAWIKARVPYQQTEVYR 91

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN +VD W+ KVNAWPLDEG IDYVD SYG E++EN+LY AN+IAN  I ++ K++D S
Sbjct: 92  FGNPVVDEWEGKVNAWPLDEGLIDYVDPSYGSESDENSLYVANVIANKTIKIDGKDVDAS 151

Query: 149 IISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+ NCT G
Sbjct: 152 KLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDLKNCTHG 211

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM SLSY EL
Sbjct: 212 NCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGSLSYGEL 271

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNT  S+LND IGI ++YTG Y R++G K+ G S+HDL
Sbjct: 272 AGERMKLGLLLHDPEEEHDCFSDNTDNSHLNDAIGIAAAYTGNYTRVDGTKLSGPSLHDL 331

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  ++ L  E+  K + T+   + +  R E +E +DQMI+E N +GN +V+  I+ LI 
Sbjct: 332 VAAKDKALDAELEGKLNKTLDAMNAMAKRGETVEKYDQMIAEGNKDGNAVVQAAIDGLID 391

Query: 388 QTESLRKIRIALDLIEPNR 406
           QT+S++++  ALDL     
Sbjct: 392 QTKSIQRVIAALDLGTVQL 410


>gi|254475879|ref|ZP_05089265.1| insulin-cleaving metalloproteinase outer membrane protein [Ruegeria
           sp. R11]
 gi|214030122|gb|EEB70957.1| insulin-cleaving metalloproteinase outer membrane protein [Ruegeria
           sp. R11]
          Length = 422

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 194/380 (51%), Positives = 257/380 (67%), Gaps = 2/380 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
              +VL  YA IA AKYED+L+ A+TL SA++ L+  P+ + LE AR  W+ AR+PYQQS
Sbjct: 25  DKAEVLTTYANIAQAKYEDSLITAKTLQSAVDALIAAPSAEALEAARKAWLAARVPYQQS 84

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN L   N+IAN +  ++ K 
Sbjct: 85  EVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDENTLAALNVIANPQFELSGKA 144

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           ID S I+P LL   LH A+G++ N+ TGYH IEFLLWGQDL       G+RP+TDF  G 
Sbjct: 145 IDASAITPALLENTLHEADGVEANVATGYHAIEFLLWGQDLNGTDHGAGDRPWTDFAAGE 204

Query: 204 -CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSL 262
            CTGGHC RR EYLK  + +LVSDLE M   WG  G+A   LM D +AG+ +++TGM SL
Sbjct: 205 TCTGGHCDRRGEYLKAATDLLVSDLEWMAAQWGDAGEARSTLMADEDAGITAMLTGMGSL 264

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           SY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G+ + Y GEY+R+NGE + GA
Sbjct: 265 SYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGVQNVYLGEYVRVNGELVSGA 324

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+ DL++  +  L  E+  K + TM+    +K  AE   S+DQM+   N  G  +V   +
Sbjct: 325 SLSDLVAEQDSALDSELRGKLAQTMQALGRIKTAAEAGFSYDQMLEAGNEAGEALVMGGV 384

Query: 383 NDLITQTESLRKIRIALDLI 402
           N LI QT S+ ++   L++ 
Sbjct: 385 NGLIDQTRSIERVVSLLNVD 404


>gi|315122173|ref|YP_004062662.1| hypothetical protein CKC_02115 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495575|gb|ADR52174.1| hypothetical protein CKC_02115 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 433

 Score =  393 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 302/406 (74%), Positives = 354/406 (87%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M+F TII+ + T PS+ LS+V +V    VL+NYATIAHAKYEDA++ ARTL+ AIETLV+
Sbjct: 27  MHFFTIITFILTFPSNVLSVVIDVDPIDVLRNYATIAHAKYEDAVISARTLNRAIETLVS 86

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
           +P++KNL+NARLQWI+ARIPYQQSE+YRFG+ IV+ WDKK+NAWP+DEG IDYVD SYGK
Sbjct: 87  SPSQKNLDNARLQWIKARIPYQQSEIYRFGSTIVNAWDKKINAWPIDEGVIDYVDISYGK 146

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
            N+EN LY ANIIAN+KI  + KEID SIISP LLRKLH  NGIDTNITTGYHVIEFLLW
Sbjct: 147 HNDENELYAANIIANTKISFDGKEIDTSIISPKLLRKLHFINGIDTNITTGYHVIEFLLW 206

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           GQDLKTNV   G RPYTDFDI  CTGG+C+RR+EYLKVVSKILVSDLEE+MK W PDG+ 
Sbjct: 207 GQDLKTNVHGSGERPYTDFDIKKCTGGNCQRRIEYLKVVSKILVSDLEELMKVWKPDGEE 266

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
           T ++MKD N GL++IITGMTSLSYNELAGERMNLGLILHDP+QE+DCFSDNTYASYLN+V
Sbjct: 267 TLNIMKDTNLGLDTIITGMTSLSYNELAGERMNLGLILHDPKQELDCFSDNTYASYLNNV 326

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           IGI+SSYTGEY R+NGE+IHG SIHDLI + N+NL+ EI +KF++TMKDF+ L +RAE+I
Sbjct: 327 IGILSSYTGEYTRINGEEIHGPSIHDLIKNKNKNLSAEIKNKFAHTMKDFYALAERAEHI 386

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           ES+DQMIS NNPEGNKIV NLI+DLITQT SL+K+RIALDL E N 
Sbjct: 387 ESYDQMISANNPEGNKIVLNLIDDLITQTNSLKKLRIALDLKEIND 432


>gi|116250090|ref|YP_765928.1| iron-regulated protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254738|emb|CAK05812.1| putative iron-regulated protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 424

 Score =  393 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 205/385 (53%), Positives = 272/385 (70%), Gaps = 1/385 (0%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
                 V+++YA +AHAKYED+L  A+ LD+AI+  +  P    L+ AR  WI+AR+PYQ
Sbjct: 26  ETDAAAVVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPTDATLKAAREAWIKARVPYQ 85

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNE 142
           Q+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG E++EN+LY AN+IAN  I ++ 
Sbjct: 86  QTEVYRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGTESDENSLYVANVIANKTIKIDG 145

Query: 143 KEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
           K++D S ++P+ +   L  A GI+ N+ TGYH IEFLLWGQDL       G+RP TD+D+
Sbjct: 146 KDVDASKLTPEFISGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGDRPATDYDL 205

Query: 202 GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTS 261
            NCT G+C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM S
Sbjct: 206 KNCTHGNCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGS 265

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G
Sbjct: 266 LSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSG 325

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
            S+HDL++  ++ L  E+  K + T+   + +  R E +E +DQMI E N EGN +V+  
Sbjct: 326 PSLHDLVAAKDKALDAEVEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAA 385

Query: 382 INDLITQTESLRKIRIALDLIEPNR 406
           I+ LI QT+S++++  ALDL     
Sbjct: 386 IDGLIDQTKSVQRVIAALDLGTVQL 410


>gi|241207259|ref|YP_002978355.1| hypothetical protein Rleg_4578 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861149|gb|ACS58816.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 424

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 205/383 (53%), Positives = 272/383 (71%), Gaps = 1/383 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
               V+++YA +AHAKYED+L  A+ LD+AI+  +  P    L+ AR  WI+AR+PYQQ+
Sbjct: 28  DAASVVKHYADVAHAKYEDSLTTAKALDAAIDAFLKAPTDATLKAAREAWIKARVPYQQT 87

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG E++EN+LY AN+IAN  I ++ K+
Sbjct: 88  EVYRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGTESDENSLYVANVIANKTIKIDGKD 147

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           +D S ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       G+RP TD+D+ N
Sbjct: 148 VDASKLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGDRPATDYDLKN 207

Query: 204 CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLS 263
           CT G+C RR EYLK  S +LV+DL+EM   W PDG ATK++  D  AGL +I+TGM SLS
Sbjct: 208 CTHGNCDRRAEYLKSASTLLVTDLQEMTDNWTPDGAATKNVEADPKAGLVAILTGMGSLS 267

Query: 264 YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
           Y ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G S
Sbjct: 268 YGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSGPS 327

Query: 324 IHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLIN 383
           +HDL++  ++ L  E+  K + T+   + +  R E +E +DQMI E N EGN +V+  I+
Sbjct: 328 LHDLVAAKDKALDAEVEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAAID 387

Query: 384 DLITQTESLRKIRIALDLIEPNR 406
            LI QT+S++++  ALDL     
Sbjct: 388 GLIDQTKSVQRVIAALDLGTVQL 410


>gi|126738822|ref|ZP_01754518.1| lipoprotein, putative [Roseobacter sp. SK209-2-6]
 gi|126720003|gb|EBA16710.1| lipoprotein, putative [Roseobacter sp. SK209-2-6]
          Length = 422

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 193/406 (47%), Positives = 266/406 (65%), Gaps = 4/406 (0%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           F+T  ++   +     + V   S   +L NYA IA AKY+D+L  A+ L SA+E L+ +P
Sbjct: 5   FLTGTALAGII--FNAAPVLAASKADILTNYANIAEAKYQDSLHTAKQLQSAVEALIASP 62

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + + LE AR  WI +R+PYQQSEV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  +
Sbjct: 63  SAEALEAARAAWIASRVPYQQSEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPS 122

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           +EN L   N+IAN    ++ K ID S I+P+LL   LH A+GI+ N+ TGYH IEFLLWG
Sbjct: 123 DENALAALNVIANPSFDLSGKSIDTSKITPELLSDTLHEADGIEANVATGYHAIEFLLWG 182

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDLK      G+RP+TD+  G +CTGGHC RR EYLK  + +LVSDLE M   W   G+A
Sbjct: 183 QDLKGTEHGAGDRPWTDYASGEDCTGGHCDRRGEYLKAATDLLVSDLEWMAAQWSASGEA 242

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              L+ D + G+++++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D 
Sbjct: 243 RGTLLGDEDVGISAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDG 302

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +G+ + Y GEY+R++GE + G S+ DL+S ++ +L  E+  K + TM+    +K  AE  
Sbjct: 303 LGVQNVYLGEYVRVSGELVSGPSLSDLVSASDSSLDSEMRSKLATTMQALGRIKLTAEAG 362

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
            S+DQM+   N  G  ++   +N L+ QT S+ ++   L L     
Sbjct: 363 TSYDQMLEAGNSAGEALIMGGVNGLVDQTRSIERVVKLLSLDGLEF 408


>gi|85706973|ref|ZP_01038063.1| lipoprotein, putative [Roseovarius sp. 217]
 gi|85668584|gb|EAQ23455.1| lipoprotein, putative [Roseovarius sp. 217]
          Length = 420

 Score =  392 bits (1006), Expect = e-107,   Method: Composition-based stats.
 Identities = 173/405 (42%), Positives = 251/405 (61%), Gaps = 6/405 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +T  +I   L   A +   N    +VL  YA IA A Y D+L   R L+ A+  L+ +P
Sbjct: 5   LLTSTAIATALLGSAQAQTAN----EVLDTYADIAEANYGDSLEAVRALEKAVTALIKSP 60

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + +++  AR  W++AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD  YG   
Sbjct: 61  SAESMSAARDAWLQARVPYQQTEVFRFGNPIVDDWEGKVNAWPLDEGLIDYVDGLYGGPT 120

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           + N     N+IAN    ++ KEID + I+PDLL   LH A+GI+ N+ TGYH IEFLLWG
Sbjct: 121 DANQFAALNVIANPSFSLSGKEIDATEITPDLLENILHEADGIEANVATGYHAIEFLLWG 180

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDL  +    G+RP+TD+    +CT G+C RR +YL   + +L SDLE +   W  DG+A
Sbjct: 181 QDLNGHGDGAGSRPWTDYAQNEDCTNGNCERRADYLMAATDLLSSDLEWITAQWAKDGEA 240

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              +  D  AGL +I+TGM SLSY E AGERM LGL+L+DPE+E  CF+DNT+  +  + 
Sbjct: 241 RATITADEQAGLTAILTGMGSLSYGETAGERMRLGLMLNDPEEEHSCFADNTHNDHYYNG 300

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +GI S Y G Y+R +G  + GAS+ DL+++ +  L +E+  + +  +     +K  AE+ 
Sbjct: 301 VGIRSVYLGNYVRTDGTTVSGASLSDLVANIDPELDREMRTRLAEAVLALGRIKTAAESG 360

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
            ++D+M++  +  G  ++   ++ LI QT S+ ++  ALDL    
Sbjct: 361 FAYDEMLARGDEGGEALIMGGVDGLINQTRSIERVVTALDLGGIE 405


>gi|209551882|ref|YP_002283799.1| hypothetical protein Rleg2_4315 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537638|gb|ACI57573.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 424

 Score =  392 bits (1006), Expect = e-107,   Method: Composition-based stats.
 Identities = 208/385 (54%), Positives = 272/385 (70%), Gaps = 1/385 (0%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
                 V+++YA +AHAKYED+L  A+ LD+AI+  + TP+   L++AR  WI+AR+PYQ
Sbjct: 26  ETDAAAVVKHYADVAHAKYEDSLTTAKALDAAIDAFLKTPDDATLKSARDAWIKARVPYQ 85

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNE 142
           Q+EVYRFGN IVD W+ KVNAWPLDEG IDYVD SYG EN+EN+LY AN+IAN  I ++ 
Sbjct: 86  QTEVYRFGNPIVDDWEGKVNAWPLDEGLIDYVDPSYGTENDENSLYVANVIANKTIKIDG 145

Query: 143 KEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
           K++D S ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+
Sbjct: 146 KDVDASKLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDL 205

Query: 202 GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTS 261
            NCT G+C RR EYLK  S +LVSDL+EM   W  DG ATK++  D  AGL +I+TGM S
Sbjct: 206 KNCTHGNCDRRAEYLKSASTLLVSDLQEMTDNWKADGAATKNVEADPKAGLVAILTGMGS 265

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R++G K+ G
Sbjct: 266 LSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSG 325

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
            S+HDL++  +  L  E+  K + T+   + +  R E +E +DQMI E N EGN +V+  
Sbjct: 326 PSLHDLVAAKDEALDAEMEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAA 385

Query: 382 INDLITQTESLRKIRIALDLIEPNR 406
           I+ LI QT+S++++  ALDL     
Sbjct: 386 IDGLIDQTKSVQRVIAALDLGTVQL 410


>gi|89053859|ref|YP_509310.1| putative lipoprotein [Jannaschia sp. CCS1]
 gi|88863408|gb|ABD54285.1| lipoprotein putative [Jannaschia sp. CCS1]
          Length = 420

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 176/406 (43%), Positives = 253/406 (62%), Gaps = 6/406 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +T  ++   L   AL+         VL  YA IA A YED+L+ A+ L+ A++ L+  P
Sbjct: 5   ILTTTALASFLAGPALAQDAA----DVLNTYADIAAAGYEDSLITAQALERAVDALIAEP 60

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + + L  AR  W++AR+PYQQ+EV+RFGN IVD W+ +VNAWPLDEG IDYVD +YG   
Sbjct: 61  SAQTLTAARTAWLQARVPYQQTEVFRFGNAIVDDWEGRVNAWPLDEGLIDYVDGAYGGPT 120

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           +EN L   N+IAN    ++  E+D S I+P LL   LH A+G++ N+ TGYH +EFLLWG
Sbjct: 121 DENTLAAVNVIANPTFTLSGSEVDASSITPALLEDTLHEADGVEANVATGYHAVEFLLWG 180

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDL  +    GNRPYTD+  G+ CTGG+C RR EYL   +++LVSDLE M   W  DG A
Sbjct: 181 QDLNGHGDGAGNRPYTDYAAGDDCTGGNCDRRAEYLAAATELLVSDLEWMAAQWTADGDA 240

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              LM++  AGL++++TGM SLSY E AGERM LGL+L+DPE+E  CF+DNT+  +  + 
Sbjct: 241 RAALMENEQAGLSAMLTGMGSLSYGETAGERMRLGLMLNDPEEEHSCFADNTHNDHFFNG 300

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +G+ + Y G Y R++G  + G S+ DL+   + +L  E+  + +  +     +K  AE  
Sbjct: 301 VGVRNVYLGSYSRIDGTLVSGPSLSDLVMDVDADLDAEMRSRLAEAVLALGEIKTAAEAG 360

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
            ++D+M+   N  G  ++   +N LI QT S+ ++  AL L     
Sbjct: 361 FAYDEMLERGNEGGELLIMGGVNGLIEQTRSIERVVTALGLDGIEF 406


>gi|86355961|ref|YP_467853.1| hypothetical protein RHE_CH00304 [Rhizobium etli CFN 42]
 gi|86280063|gb|ABC89126.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 424

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 205/385 (53%), Positives = 274/385 (71%), Gaps = 1/385 (0%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
                 V+++YA +AHAKYED+L  A+ LD+AI+  +  P  + L+ AR  WI+AR+PYQ
Sbjct: 26  ETDAAAVVKHYAEVAHAKYEDSLTTAKALDAAIDAFLKAPTDETLKAARDAWIKARVPYQ 85

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNE 142
           Q+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG E++EN+LY AN+IA+  I ++ 
Sbjct: 86  QTEVYRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGTESDENSLYVANVIASKTIKIDG 145

Query: 143 KEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
           K++D + ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GNRP TD+D+
Sbjct: 146 KDVDATKLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDL 205

Query: 202 GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTS 261
            NCT G+C RR EYLK  S +LVSDL+EM   W PDG ATK++  D  AGL +I+TGM S
Sbjct: 206 KNCTHGNCDRRAEYLKSASTLLVSDLQEMTDDWKPDGAATKNVEADPKAGLVAILTGMGS 265

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG+Y R++G K+ G
Sbjct: 266 LSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGDYTRVDGTKLGG 325

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
            S+HDL++  ++ L  E+  K + T+   + +  R E +E +DQMI+E N EGN +V+  
Sbjct: 326 PSLHDLVAAKDKALDAEMEGKLNKTLDAMNAMAKRGETVEKYDQMIAEGNKEGNAVVQAA 385

Query: 382 INDLITQTESLRKIRIALDLIEPNR 406
           I+ LI QT S++++  ALDL     
Sbjct: 386 IDGLIDQTTSIQRVIAALDLGTVQL 410


>gi|312883632|ref|ZP_07743357.1| uncharacterized iron-regulated protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368855|gb|EFP96382.1| uncharacterized iron-regulated protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 420

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 165/414 (39%), Positives = 240/414 (57%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   +   +V+ ++V+++YA IAHA + D+L  A+ L+ +IE  +  
Sbjct: 5   SLLAKSIAASMLIASGTAFSADVTNKQVVEHYADIAHAVFADSLATAKNLNKSIEAFLAA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P    L   +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV S Y  E
Sbjct: 65  PTDAKLMEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGMIDYVTSDYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+++ +    +D+S I+P L+  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNAGAKANIVANTQLTIGASTLDVSKITPALIADLNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       GNRPYTDF +G  CT G+C RR  +L+   ++LV DLE M K W  +  G
Sbjct: 184 QDLNGTESGAGNRPYTDFVLGEACTHGNCDRRGAFLRAAGQLLVQDLEWMEKQWSKEAKG 243

Query: 239 QATKDLMK-DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+    + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQELVNGSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G  + G S+HDL++  ++  AQEI  +F  T      L   A
Sbjct: 304 YNEQGIYNIYTGIYKRQDGSLLSGPSLHDLVNQKDKVAAQEIQKQFDQTRSQVGKLVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+  N +GNK+V   I  L+ QTE + +    + +   N    +
Sbjct: 364 EKNNQHFDQLIAAGNAKGNKLVNETIMSLVAQTEQIERAAKIVGVNSLNPDTAD 417


>gi|114766834|ref|ZP_01445761.1| lipoprotein, putative [Pelagibaca bermudensis HTCC2601]
 gi|114540955|gb|EAU44014.1| lipoprotein, putative [Roseovarius sp. HTCC2601]
          Length = 419

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 185/381 (48%), Positives = 254/381 (66%), Gaps = 2/381 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
               VL  YA IAHA YED+L+ A+ L  A++ L+  P+++ L  AR  W+ +R PYQQ+
Sbjct: 22  EKSAVLDTYADIAHAGYEDSLITAQALQEAVDALIAEPSEETLTAAREAWLASRNPYQQT 81

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EVYRFGN IVD W+ KVNAWPLDEG IDYVD SYG   +EN     NIIAN  + +  +E
Sbjct: 82  EVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDDSYGGATDENEYAALNIIANPSVTLAGQE 141

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           +D S I+P L+   L+ A+GI+TN+  GYH IEFLLWGQDL       G RPYTD+  G 
Sbjct: 142 VDASEITPTLIADTLNEADGIETNVARGYHAIEFLLWGQDLNGTEPGAGERPYTDYVTGE 201

Query: 204 -CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSL 262
            CTGG+C RR +YLK  + +LVSDLEEM+ AWG  G+A + +M+D NAG+ +++TGM SL
Sbjct: 202 ECTGGNCDRRADYLKAATDLLVSDLEEMVAAWGEGGEARETVMEDENAGIVAMLTGMGSL 261

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           SY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D  GI + Y G Y R++G  + GA
Sbjct: 262 SYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGKGIQNVYLGSYTRVDGSTVEGA 321

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+ DL++  +  L +E+  K   TM     +K+ AE   ++DQM++  + +G +++   +
Sbjct: 322 SLSDLVAETDAALDEEMKAKLDTTMAALGAIKEAAEGGFAYDQMLALGDEKGEELIMGGV 381

Query: 383 NDLITQTESLRKIRIALDLIE 403
           N LI QT S+ ++   LDL +
Sbjct: 382 NGLIDQTRSIERVVSTLDLSD 402


>gi|86136374|ref|ZP_01054953.1| lipoprotein, putative [Roseobacter sp. MED193]
 gi|85827248|gb|EAQ47444.1| lipoprotein, putative [Roseobacter sp. MED193]
          Length = 422

 Score =  388 bits (996), Expect = e-106,   Method: Composition-based stats.
 Identities = 188/403 (46%), Positives = 258/403 (64%), Gaps = 6/403 (1%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           + ++ +    +  L+        +VL NYA IA AKY+D+L  A TL  A++ L+ TP+ 
Sbjct: 9   SALAGLALCATPGLATE----KAEVLANYANIAQAKYQDSLATAHTLQLAVDALIATPSA 64

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           + L  AR  W+ AR+PYQQSEV+RFGN IVD W+ KVNAWPLDEG IDYVD++YG  ++E
Sbjct: 65  EALTAARQAWLAARVPYQQSEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDATYGGPSDE 124

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQD 183
           N L   N+IAN    ++ K ID S I+P LL + LH A+G++ N+ TGYH IEFLLWGQD
Sbjct: 125 NALAALNVIANPTFDLSGKAIDTSAITPALLSETLHEADGVEANVATGYHAIEFLLWGQD 184

Query: 184 LKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           L       GNR +TD+  G+ CT GHC RR +YLK  + +LVSDLE M   W   G A  
Sbjct: 185 LNGTDHGAGNRSWTDYASGDNCTNGHCDRRGDYLKAATALLVSDLEWMAAQWDEAGDARI 244

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
            L+ D  AG+++++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G
Sbjct: 245 SLLADEGAGISAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLG 304

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           + + Y GEYIR+NGE I G S+ DL+   +  L  E+  K + TM+    +K  AE   S
Sbjct: 305 VQNIYLGEYIRVNGEMISGPSLSDLVVAADPALDSEMRMKLATTMRALGRIKSTAEAGLS 364

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           +DQM+++ N  G  ++   +N L+ QT S+ ++   L L    
Sbjct: 365 YDQMLAQGNTAGEALIMGGVNGLVDQTRSIERVVTLLSLDGLE 407


>gi|254507004|ref|ZP_05119142.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus 16]
 gi|219549999|gb|EED26986.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus 16]
          Length = 420

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 164/414 (39%), Positives = 237/414 (57%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        + + +      V+ E+V+++YA IAHA +ED+L  A+ LD +IE+ + T
Sbjct: 5   SLLAQSVAASLVLASSSVFAAKVTKEQVVEHYADIAHAVFEDSLTTAKKLDKSIESFLAT 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+   LE  +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSAAKLEEVKQAWLDSRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSTDYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN ++ +    +D+S ++P  +  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIVANKQLKIGATTMDVSQLTPKAIADLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G RPYTDF +G  CT G+C RR EYLK  +++L+ DLE M K W      
Sbjct: 184 QDLNGTNAGAGQRPYTDFVVGEGCTNGNCERRGEYLKATAQLLIQDLEWMEKQWSADEKG 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L      GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRAELLSDSSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G  + G SI+DL++  ++  A+EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGLYKRQDGTLLSGPSINDLVAQKDQQAAKEIQKQFDVTRSQVGQLVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N E FDQ+I+  N +GN +V   I  L+ QT S+ +    + +   N    +
Sbjct: 364 ENNGEFFDQLIASGNVKGNALVNETIMSLVAQTASIERAAKIVGINSLNPDTAD 417


>gi|148978889|ref|ZP_01815209.1| Uncharacterized iron-regulated protein [Vibrionales bacterium
           SWAT-3]
 gi|145962087|gb|EDK27373.1| Uncharacterized iron-regulated protein [Vibrionales bacterium
           SWAT-3]
          Length = 419

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 158/412 (38%), Positives = 240/412 (58%), Gaps = 6/412 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +   ++  +L   + S    V+ ++V+++YA IAHA + D+++ A+ L+S+I+T + +P+
Sbjct: 6   LVTKAVTSSLIFASASSFAAVTQDQVVEHYADIAHAVFADSVITAKALNSSIDTFLASPS 65

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
             N E  +L W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV S Y  E  
Sbjct: 66  AGNFEKVKLAWLESRVPYQQSEVFRFGNVVVDDWEGQLNAWPLDEGLIDYVSSDYQYE-L 124

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
            N   +ANI+AN    + +  +D + I+P+L+ +L+   G + N+ +GYH IEFLLWGQD
Sbjct: 125 GNEGASANIVANKTFQIGQTTVDATNITPELIAELNEIGGSEANVASGYHAIEFLLWGQD 184

Query: 184 LKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQ 239
           +       G R YTDF +G  CT G+C RR  YLK  +++L+ DLE M K W        
Sbjct: 185 MNGTNSGAGERAYTDFVVGAECTNGNCDRRGAYLKASAELLIQDLEWMEKQWAEGEKGNY 244

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
             + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +
Sbjct: 245 RQELLSESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYN 304

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE- 358
             GI + YTG Y R +G  + G S+ DL+   +   A+EI  +F         L   AE 
Sbjct: 305 EQGIYNVYTGLYKREDGTLLSGPSLFDLVEQKDEQAAKEIQKQFDLARAQVGQLVTSAEK 364

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           N + FDQ+I+ +N  GN +V   I  L++QT ++ +    + +   N    +
Sbjct: 365 NNQHFDQLIAADNAAGNALVNKTIVALVSQTAAIERAAGVIGIDSLNPDTAD 416


>gi|262393894|ref|YP_003285748.1| iron-regulated protein A [Vibrio sp. Ex25]
 gi|262337488|gb|ACY51283.1| iron-regulated protein A precursor [Vibrio sp. Ex25]
          Length = 420

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 164/413 (39%), Positives = 237/413 (57%), Gaps = 6/413 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +        L +   ++   V+ ++V+++YA +AHA + D++  A+TLD  I+  + +P
Sbjct: 6   VLVQSIAASLLIASGSTVAAQVTKQQVVEHYADVAHAVFADSVTTAKTLDVKIDEFLKSP 65

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +   LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E 
Sbjct: 66  SADKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVATDYQYE- 124

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N    ANIIAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 125 LGNEGAAANIIANTSLQIGASKLDVSNITPELLADLNEVGGSEANVASGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDG 238
           DL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W       
Sbjct: 185 DLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKGN 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
                L    + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YRETFLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G  + G SI DL++  ++  A+EI  +F  T      L   AE
Sbjct: 305 NEQGIYNVYTGLYKREDGTLLSGPSIADLVAQKDKQAAKEIQKQFDVTRNQVGKLVTSAE 364

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
            N + FDQ+I+  N +GN +V + I  L+ QT S+ +    + +   +    +
Sbjct: 365 KNNQHFDQLIAAGNAQGNTLVNDTIMSLVAQTGSIERAAGIIGIDSLSPDTAD 417


>gi|37680303|ref|NP_934912.1| uncharacterized iron-regulated protein [Vibrio vulnificus YJ016]
 gi|37199050|dbj|BAC94883.1| uncharacterized iron-regulated protein [Vibrio vulnificus YJ016]
          Length = 423

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 163/413 (39%), Positives = 243/413 (58%), Gaps = 6/413 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +     V TL +    +  NV+ ++V+++YA +AHA + D+L  A+ L+  +E  ++ P
Sbjct: 9   LLVQSLAVTTLFASGHLLAANVTNQQVVEHYADVAHAVFADSLTTAQQLEKKVEQFLSAP 68

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +   LE  +  W+ AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E 
Sbjct: 69  SAAKLEEVKQAWLAARVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSTDYQYE- 127

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N    ANI+AN+ + +   ++D+S+I+P+L+ +L+   G + N+ +GYH IEFLLWGQ
Sbjct: 128 LGNEGAKANIVANTTLKIGASQLDVSVITPELIAELNEVGGSEANVASGYHAIEFLLWGQ 187

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDG 238
           DL       G R YTDF +G  CT GHC RR  YLK  +++LV+DLE M K W       
Sbjct: 188 DLNGTNAGAGQRAYTDFVVGSQCTNGHCDRRGAYLKAAAQLLVTDLEWMEKQWSAQEKGN 247

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 248 YRQELLAQSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 307

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R++G  + G S+HDL++  ++N A+EI  +F  T      L   AE
Sbjct: 308 NEQGIYNVYTGIYKRVDGSLLTGPSLHDLVAQQDKNTAKEIQAQFDTTRAQVGKLVTSAE 367

Query: 359 N-IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
              + FDQ+I+  N +GN +V   I  L+ QT ++ +    + +   N    +
Sbjct: 368 KQNQHFDQLIAAGNAQGNALVNETIMSLVAQTSAIERAAKIVGIDSLNPDTAD 420


>gi|262402384|ref|ZP_06078945.1| iron-regulated protein A precursor [Vibrio sp. RC586]
 gi|262351166|gb|EEZ00299.1| iron-regulated protein A precursor [Vibrio sp. RC586]
          Length = 420

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 160/414 (38%), Positives = 236/414 (57%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +T   +     + + S     +  +V+++YA IAHA Y D+ + A+ L  +I+  + T
Sbjct: 5   SILTSAILASLTLTASASFAAAPTQAQVVEHYANIAHAVYADSRLTAQQLQKSIDRFLQT 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  K LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAKGLEEVKQAWLAARVPYQQSEVFRFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTSLTIGANKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT G+C RR +YLK  +++LV+DLE M K W      
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKECTNGNCDRRAQYLKAAAQLLVTDLEWMEKQWANGEKG 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLTESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + +TG Y R +G ++ G S+++L++  + + A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIFTGTYTRADGSELKGPSLYELVAEKDASAAKEILQQFETARTQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 364 EKNNQHFDQLIAADNTAGHAIINQAIMALVVQTGSIERAAGIIGIDNLNPDTAD 417


>gi|254230285|ref|ZP_04923674.1| hypothetical protein VEx25_B0317 [Vibrio sp. Ex25]
 gi|151937182|gb|EDN56051.1| hypothetical protein VEx25_B0317 [Vibrio sp. Ex25]
          Length = 419

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 164/413 (39%), Positives = 237/413 (57%), Gaps = 6/413 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +        L +   ++   V+ ++V+++YA +AHA + D++  A+TLD  I+  + +P
Sbjct: 5   VLVQSIAASLLIASGSTVAAQVTKQQVVEHYADVAHAVFADSVTTAKTLDVKIDEFLKSP 64

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +   LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E 
Sbjct: 65  SADKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVATDYQYE- 123

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N    ANIIAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 124 LGNEGAAANIIANTSLQIGASKLDVSNITPELLADLNEVGGSEANVASGYHAIEFLLWGQ 183

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDG 238
           DL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W       
Sbjct: 184 DLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKGN 243

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
                L    + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 244 YRETFLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 303

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G  + G SI DL++  ++  A+EI  +F  T      L   AE
Sbjct: 304 NEQGIYNVYTGLYKREDGTLLSGPSIADLVAQKDKQAAKEIQKQFDVTRNQVGKLVTSAE 363

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
            N + FDQ+I+  N +GN +V + I  L+ QT S+ +    + +   +    +
Sbjct: 364 KNNQHFDQLIAAGNAQGNTLVNDTIMSLVAQTGSIERAAGIIGIDSLSPDTAD 416


>gi|126460976|ref|YP_001042090.1| putative iron-regulated protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102640|gb|ABN75318.1| imelysin. Metallo peptidase. MEROPS family M75 [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 441

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 177/401 (44%), Positives = 250/401 (62%), Gaps = 6/401 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  ++    LP  AL+    V   +V++ YA IA A Y D+L  AR L +A++ LV  P+
Sbjct: 27  LATVAPCALLPLPALA----VERSEVVETYADIAEATYADSLATARELQTAVKALVDQPS 82

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           +  L  AR  W+ AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   E
Sbjct: 83  EAALMAARSAWLAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGGATE 142

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN+L   N+IA  K  ++  EID + I+P+L+   LH A+GI+ N+ +GYH IEFLLWGQ
Sbjct: 143 ENDLAALNVIATPKFTLSGTEIDATEITPELISGTLHEADGIEANVASGYHAIEFLLWGQ 202

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           DL       G+RP+TD+  G +CTGG+C RR  YL   + +LVSDL+ M   W   G A 
Sbjct: 203 DLNGTEAGAGDRPFTDYAKGEDCTGGNCDRRAAYLVAATDLLVSDLDYMAAQWADGGAAR 262

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
             + +D   GL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +
Sbjct: 263 VAVTEDPGKGLRAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYYDGL 322

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y G Y R++G  + G S+ DL++  +  L + +  +   T+     L+       
Sbjct: 323 GIRNVYRGHYARVDGSTVEGPSLSDLVAEADPELDKVLTGQLDATVDRLDALRTAVAGGM 382

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
           ++DQM++  N EG  ++   ++ L+TQT S+ +   AL L 
Sbjct: 383 AYDQMLAPGNAEGEALIMGAVDALVTQTASIERATTALGLT 423


>gi|152996576|ref|YP_001341411.1| putative iron-regulated protein [Marinomonas sp. MWYL1]
 gi|150837500|gb|ABR71476.1| putative iron-regulated protein [Marinomonas sp. MWYL1]
          Length = 431

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 181/406 (44%), Positives = 260/406 (64%), Gaps = 3/406 (0%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +T   +    P+        ++ + V+ +YA IA A Y D+L  A+TL S+IET +  P 
Sbjct: 12  VTGAMLTACGPATVKKESSAITADSVVVHYADIAEAVYGDSLTTAKTLRSSIETFLANPT 71

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSS-YGKEN 122
           + NL+ AR +WI AR+PYQQSEVYRFGN IVD W+ KVNAWPLDEG IDYV +  YG E+
Sbjct: 72  EVNLKAARAEWIAARVPYQQSEVYRFGNPIVDEWEGKVNAWPLDEGLIDYVAADSYGTES 131

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           + N LY AN+IA++ +++   +ID + I+P+L+   L  A+G++ N+ +GYH IEFLLWG
Sbjct: 132 DLNPLYAANVIASTSLMIGGVKIDTTNITPELIADSLQEADGVEANVASGYHAIEFLLWG 191

Query: 182 QDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           QDL       G RP TDFD+ NCT G+C RR +YL   + +L+SDLEEM   W   G A 
Sbjct: 192 QDLNGTNPGAGERPATDFDLNNCTNGNCDRRRDYLVAATDLLISDLEEMANNWKQGGAAR 251

Query: 242 -KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              L +    GL++I+TGM SL+Y EL GER  LGL+LHDPE+E DCFSDNT+ S+  D 
Sbjct: 252 VALLEQSAEQGLSTILTGMGSLAYGELGGERTKLGLMLHDPEEEHDCFSDNTHWSHYYDA 311

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
            GI ++Y GEY R++G  + GAS+ DL++  N  L  E+  K + T      + D A+  
Sbjct: 312 KGIKNAYLGEYKRVDGSWVKGASLSDLVAKQNPQLDIEMKQKLNETEAAAQAMVDAAKKG 371

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           ++FD +I+ NN +GN++V+N ++ L+ +T +  ++   L+L     
Sbjct: 372 QTFDVLIAMNNTKGNQLVQNFVDSLVNETRTTEEVIHELNLEGIAL 417


>gi|258624446|ref|ZP_05719393.1| iron-regulated protein A, putative [Vibrio mimicus VM603]
 gi|258583293|gb|EEW08095.1| iron-regulated protein A, putative [Vibrio mimicus VM603]
          Length = 420

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 160/414 (38%), Positives = 236/414 (57%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +T   +     S + S     +  +V+++YA IAHA Y D+ + A+ L  +I+  + T
Sbjct: 5   SILTSAILASLTLSASASFAAAPTQAQVVEHYANIAHAVYSDSRLTAQQLQKSIDRFLQT 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  K LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAKGLEEVKQAWLAARVPYQQSEVFRFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIVANTSLTIGANKLDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT G+C RR +YLK  +++LV+DLE M K W      
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKECTNGNCDRRAQYLKAAAQLLVTDLEWMEKQWANGEKG 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLNESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + +TG Y R +G ++ G S+++L++  + + A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIFTGTYTRADGSELKGPSLYELVAEKDASAAKEILQQFETARTQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 364 EKNNQHFDQLIAADNTAGHAIINQAIMALVVQTGSIERAAGIIGIDNLNPDTAD 417


>gi|260427865|ref|ZP_05781844.1| hypothetical protein CSE45_1614 [Citreicella sp. SE45]
 gi|260422357|gb|EEX15608.1| hypothetical protein CSE45_1614 [Citreicella sp. SE45]
          Length = 425

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 180/381 (47%), Positives = 250/381 (65%), Gaps = 2/381 (0%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
                VL+ YA IA A YED+L  A+ L  A+E L+  P+++ L  AR  W+ +R PYQQ
Sbjct: 27  PDKASVLETYADIALAGYEDSLSTAKALQEAVEALIAEPSEETLAAAREAWLVSRNPYQQ 86

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           +EV+RFGN IVD W+ KVNAWPLDEG IDYV   Y    +EN     NIIA  +  +  +
Sbjct: 87  TEVFRFGNPIVDDWEGKVNAWPLDEGLIDYVSEEYEGPTDENEYAALNIIATPQATIAGQ 146

Query: 144 EIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG 202
           E+D S I+P+L+   L+ A+GI+TN+  GYH IEFLLWGQDL       G RPYTD+  G
Sbjct: 147 EVDASEITPELIADTLNEADGIETNVARGYHAIEFLLWGQDLNGTEPGAGERPYTDYATG 206

Query: 203 N-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTS 261
           + CTGG+C RR +YLK  + +LVSDLEEM+ AWG DG+A   +++D NAG+ +++TGM S
Sbjct: 207 DDCTGGNCDRRADYLKAATTLLVSDLEEMVAAWGADGEARGAVLEDENAGITAMLTGMGS 266

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D  GI + Y G Y R++G  + G
Sbjct: 267 LSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHFYDGKGIQNVYLGSYTRVDGSTVEG 326

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
           AS+ +L++  +  L  E+  K   TM     +K+ AE   ++DQM++  + +G +++   
Sbjct: 327 ASLSELVAATDPALDDEMKTKLDTTMTALGAIKEAAEGGFAYDQMLAIGDEKGEELIMGG 386

Query: 382 INDLITQTESLRKIRIALDLI 402
           +N LI QT ++ +I  ALDL 
Sbjct: 387 VNGLIDQTRTIERIVGALDLS 407


>gi|320156753|ref|YP_004189132.1| iron-regulated protein A [Vibrio vulnificus MO6-24/O]
 gi|319932065|gb|ADV86929.1| iron-regulated protein A precursor [Vibrio vulnificus MO6-24/O]
          Length = 420

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 162/413 (39%), Positives = 243/413 (58%), Gaps = 6/413 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +     V TL +    +  NV+ ++V+++YA +AHA + D+L  A+ L+  +E  ++ P
Sbjct: 6   LLVQSLAVTTLFASGHLLAANVTNQQVVEHYADVAHAVFADSLTTAQQLEKKVEQFLSAP 65

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +   LE  +  W+ AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E 
Sbjct: 66  SAAKLEEVKQAWLDARVPYQQSEVFRFGNVVVDDWEGQLNAWPLDEGLIDYVSTDYQYE- 124

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N    ANI+AN+ + +   ++D+S+I+P+L+ +L+   G + N+ +GYH IEFLLWGQ
Sbjct: 125 LGNEGAKANIVANTTLKIGASQLDVSVITPELIAELNEVGGSEANVASGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDG 238
           DL       G R YTDF +G  CT GHC RR  YLK  +++LV+DLE M K W       
Sbjct: 185 DLNGTNAGAGQRAYTDFVVGSQCTNGHCDRRGAYLKAAAQLLVTDLEWMEKQWSAQEKGN 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YRQELLAQSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R++G  + G S+HDL++  ++N A+EI  +F  T      +   AE
Sbjct: 305 NEQGIYNVYTGIYKRVDGSLLTGPSLHDLVAQQDKNAAKEIQAQFDTTRAQVGKIVTSAE 364

Query: 359 N-IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
              + FDQ+I+  N +GN +V   I  L+ QT ++ +    + +   N    +
Sbjct: 365 KQNQHFDQLIAAGNAQGNALVNETIMSLVAQTSAIERAAKIVGIDSLNPDTAD 417


>gi|86148451|ref|ZP_01066741.1| Uncharacterized iron-regulated protein [Vibrio sp. MED222]
 gi|218709910|ref|YP_002417531.1| putative iron-regulated protein A [Vibrio splendidus LGP32]
 gi|85833748|gb|EAQ51916.1| Uncharacterized iron-regulated protein [Vibrio sp. MED222]
 gi|218322929|emb|CAV19106.1| putative iron-regulated protein A [Vibrio splendidus LGP32]
          Length = 419

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 157/412 (38%), Positives = 238/412 (57%), Gaps = 6/412 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +   ++  +L   + S    V+ ++V+++YA IAHA + D+++ A+ L+S+I+T + +P+
Sbjct: 6   LVTKAVTSSLIFASASSFAAVTQDQVVEHYADIAHAVFADSVITAKALNSSIDTFLASPS 65

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
             N E  +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E  
Sbjct: 66  AGNFEQVKQAWLDSRVPYQQSEVFRFGNVVVDDWEGQLNAWPLDEGLIDYVSTDYQYE-L 124

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
            N   +ANI+AN    + +  +D + I+P+L+  L+   G + N+ +GYH IEFLLWGQD
Sbjct: 125 GNEGASANIVANKTFQIGQTTVDATNITPELIADLNEIGGSEANVASGYHAIEFLLWGQD 184

Query: 184 LKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQ 239
           L       G R YTDF +G  CT G+C RR  YLK  +++L+ DLE M K W        
Sbjct: 185 LNGTNSGAGERAYTDFVVGAECTNGNCDRRGAYLKASAELLIQDLEWMEKQWAEGEKGNY 244

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
             + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +
Sbjct: 245 RQELLSESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYN 304

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE- 358
             GI + YTG Y R +G  + G S+ DL+   +   A+EI  +F         L   AE 
Sbjct: 305 EQGIYNVYTGLYKREDGSLLSGPSLFDLVEQKDEQAAKEIQKQFDLARAQVGQLVVSAEK 364

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           N + FDQ+I+ +N  GN +V   I  L++QT ++ +    + +   N    +
Sbjct: 365 NNQHFDQLIAADNAAGNALVNKTIVALVSQTAAIERAAGVIGIDSLNPDTAD 416


>gi|27366244|ref|NP_761772.1| Iron-regulated protein A [Vibrio vulnificus CMCP6]
 gi|27362445|gb|AAO11299.1| Iron-regulated protein A precursor [Vibrio vulnificus CMCP6]
          Length = 427

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 162/406 (39%), Positives = 241/406 (59%), Gaps = 6/406 (1%)

Query: 10  VFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
             TL +    +  NV+ ++V+++YA +AHA + D+L  A+ L+  +E  ++ P+   LE 
Sbjct: 20  STTLFASGHLLAANVTNQQVVEHYADVAHAVFADSLTTAQQLEKKVEQFLSAPSAAKLEE 79

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
            +  W+ AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E   N    
Sbjct: 80  VKQAWLDARVPYQQSEVFRFGNTVVDDWEGQLNAWPLDEGLIDYVSTDYQYE-LGNEGAK 138

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
           ANI+AN+ + +   ++D+S+I+P+L+ +L+   G + N+ +GYH IEFLLWGQDL     
Sbjct: 139 ANIVANTTLKIGASQLDVSVITPELIAELNEVGGSEANVASGYHAIEFLLWGQDLNGTNA 198

Query: 190 EPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLM 245
             G R YTDF +G  CT GHC RR  YLK  +++LV+DLE M K W          + L 
Sbjct: 199 GAGQRAYTDFVVGSQCTNGHCDRRGAYLKAAAQLLVTDLEWMEKQWSAQEKGNYRQELLA 258

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
           +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI +
Sbjct: 259 QSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYN 318

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN-IESFD 364
            YTG Y R++G  + G S+HDL++  ++N A+EI  +F  T      L   AE   + FD
Sbjct: 319 VYTGIYKRVDGSLLTGPSLHDLVAQQDKNAAKEIQAQFDTTRAQVGKLVTSAEKQNQHFD 378

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           Q+I+  N +GN +V   I  L+ QT ++ +    + +   N    +
Sbjct: 379 QLIAAGNAQGNALVNETIMSLVAQTSAIERAAKIVGIDSLNPDTAD 424


>gi|163745379|ref|ZP_02152739.1| lipoprotein, putative [Oceanibulbus indolifex HEL-45]
 gi|161382197|gb|EDQ06606.1| lipoprotein, putative [Oceanibulbus indolifex HEL-45]
          Length = 420

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 177/396 (44%), Positives = 254/396 (64%), Gaps = 2/396 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
            +    L + A +        +VL  YA IA A YED+L  A+TL  A+  L+ TP+ + 
Sbjct: 5   ATTAIALITFAAAPAFAQDKAEVLGTYADIAQAGYEDSLTTAQTLQKAVNALIETPSAEA 64

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L+ A+  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG E +EN 
Sbjct: 65  LQAAKSAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGETDENQ 124

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLK 185
           L   N+IAN    +  +++D S I+PDLL  +LH A  ++ N+ TGYH IEFLLWGQDL 
Sbjct: 125 LAVLNVIANPNFTLGGEKVDASAITPDLLEGQLHEAGAVEANVATGYHAIEFLLWGQDLN 184

Query: 186 TNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
                 GNRP+TD+  G +CTGG+C RR +YLK  + +LVSDLE M   W   G A   +
Sbjct: 185 GTDHGAGNRPWTDYATGEDCTGGNCDRRGQYLKAATDLLVSDLEWMSGQWAEGGDARAAV 244

Query: 245 MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
           ++D +AG+N+I+TGM SLSY E AGERM LG++L+DPE+E DCFSDNT+ S+  D +G+ 
Sbjct: 245 LEDEDAGINAILTGMGSLSYGEQAGERMKLGVMLNDPEEEHDCFSDNTHNSHYYDGLGVR 304

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y GEY+R++G  + GAS+ DL++  +  +  ++      +M +   +K  AE   S+D
Sbjct: 305 NVYLGEYLRVDGRVVSGASLSDLVASADATVDADLRAGLDASMVELGQIKTAAEAGFSYD 364

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
            M+   N EG  ++ + ++ L+ QT ++ +    L 
Sbjct: 365 MMLERGNAEGEALIMSAVDALVNQTRAIERAVTVLG 400


>gi|258620194|ref|ZP_05715233.1| iron-regulated protein A, putative [Vibrio mimicus VM573]
 gi|258587552|gb|EEW12262.1| iron-regulated protein A, putative [Vibrio mimicus VM573]
          Length = 420

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 160/414 (38%), Positives = 236/414 (57%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +T   +     S + S     +  +V+++YA IAHA Y D+ + A+ L  +I+  + T
Sbjct: 5   SILTSAILASLTLSASASFAAAPTQAQVVEHYANIAHAVYADSRLTAQQLQKSIDRFLQT 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  K LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAKGLEEVKQAWLAARVPYQQSEVFRFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIVANTSLTIGANKLDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT G+C RR +YLK  +++LV+DLE M K W      
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKECTNGNCDRRAQYLKAAAQLLVTDLEWMEKQWANGEKG 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLNESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + +TG Y R +G ++ G S+++L++  + + A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIFTGTYTRADGSELKGPSLYELVAEKDASAAKEILQQFETARTQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 364 EKNNQHFDQLIAADNTAGHAIINQAIMALVVQTGSIERAAGIIGIDNLNPDTAD 417


>gi|28898694|ref|NP_798299.1| putative iron-regulated protein A [Vibrio parahaemolyticus RIMD
           2210633]
 gi|28806912|dbj|BAC60183.1| putative iron-regulated protein A [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 429

 Score =  385 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 160/413 (38%), Positives = 237/413 (57%), Gaps = 6/413 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +        L +   ++   V+ ++V+++YA +AHA + D+L  A+TL+  I+  +  P
Sbjct: 15  VLVQSIAASLLIASGTTVAAQVTKQQVVEHYADVAHAVFADSLTTAKTLEVKIDEFLKAP 74

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           ++  LE+ +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E 
Sbjct: 75  SEAKLEDVKQAWLESRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVAADYQYE- 133

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N    ANIIAN+ + +   ++D++ I+P+LL  L+   G + N+ TGYH IEFLLWGQ
Sbjct: 134 LGNEGAAANIIANTSLTIGPSKLDVAKITPELLASLNEVGGSEANVATGYHAIEFLLWGQ 193

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDG 238
           DL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W       
Sbjct: 194 DLNGTNAGAGKRAYTDFVVGSGCTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADEKGN 253

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L      GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 254 YRQELLTGSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 313

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G  + G SI +L++  ++  A+EI  +F  T      L   AE
Sbjct: 314 NEQGIYNVYTGTYSRQDGTVLTGPSIANLVAQEDKKAAEEIQKQFDATRSQVGELVTSAE 373

Query: 359 N-IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
              + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +   +    +
Sbjct: 374 KHNQHFDQLIAAGNAQGNALVNDTIMALVAQTGAIERAAGIVGIDSLSPDTAD 426


>gi|84393101|ref|ZP_00991866.1| Uncharacterized iron-regulated protein [Vibrio splendidus 12B01]
 gi|84376258|gb|EAP93141.1| Uncharacterized iron-regulated protein [Vibrio splendidus 12B01]
          Length = 419

 Score =  385 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 157/412 (38%), Positives = 239/412 (58%), Gaps = 6/412 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +   ++  +L   + S    V+ ++V+++YA IAHA + D+++ A+ L+S+I+T + +P+
Sbjct: 6   LVTKAVTSSLLFASASSFAAVTQDQVVEHYADIAHAVFADSVITAKALNSSIDTFLASPS 65

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
             N E  +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E  
Sbjct: 66  AGNFEQVKQAWLESRVPYQQSEVFRFGNVVVDDWEGQLNAWPLDEGLIDYVSTDYQYE-L 124

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
            N   +ANI+AN    + +  +D + I+P+L+  L+   G + N+ +GYH IEFLLWGQD
Sbjct: 125 GNEGASANIVANKTFQIGQTTVDATNITPELIADLNEIGGSEANVASGYHAIEFLLWGQD 184

Query: 184 LKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQ 239
           L       G R YTDF +G  CT G+C RR  YLK  +++L+ DLE M K W        
Sbjct: 185 LNGTNSGAGERVYTDFVVGAECTNGNCDRRGAYLKASAELLIQDLEWMEKQWAEGEKGNY 244

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
             + L +  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +
Sbjct: 245 RQELLSESSDNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYN 304

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE- 358
             GI + YTG Y R +G  + G S+ DL+   +   A+EI  +F         L   AE 
Sbjct: 305 EQGIYNVYTGLYKREDGTLLSGPSLFDLVEQKDEQAAKEIQKQFDLARAQVGQLVTSAEK 364

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           N + FDQ+I+ +N  GN +V   I  L++QT ++ +    + +   N    +
Sbjct: 365 NNQHFDQLIAADNAAGNALVNKTIVALVSQTAAIERAAGVIGIDSLNPDTAD 416


>gi|262165520|ref|ZP_06033257.1| iron-regulated protein A precursor [Vibrio mimicus VM223]
 gi|262025236|gb|EEY43904.1| iron-regulated protein A precursor [Vibrio mimicus VM223]
          Length = 420

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 160/414 (38%), Positives = 236/414 (57%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +T   +     S + S     +  +V+++YA IAHA Y D+ + A+ L  +I+  + T
Sbjct: 5   SILTSAILASLTLSASASFAAAPTQAQVVEHYANIAHAVYADSRLTAQQLQKSIDRFLQT 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  K LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAKGLEEVKQAWLAARVPYQQSEVFRFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIVANTSLTIGANKLDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT G+C RR +YLK  +++LV+DLE M K W      
Sbjct: 184 QDLNGTKAGAGARSYTDYLKGKECTNGNCDRRAQYLKAAAQLLVADLEWMEKQWANGEKG 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLNESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + +TG Y R +G ++ G S+++L++  + + A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIFTGTYTRADGSELKGPSLYELVAEKDASAAKEILQQFETARTQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 364 EKNNQHFDQLIAADNTAGHAIINQAIMALVVQTGSIERAAGIIGIDNLNPDTAD 417


>gi|307943588|ref|ZP_07658932.1| imelysin [Roseibium sp. TrichSKD4]
 gi|307773218|gb|EFO32435.1| imelysin [Roseibium sp. TrichSKD4]
          Length = 421

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 194/384 (50%), Positives = 251/384 (65%), Gaps = 2/384 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
           S ++VL  Y  IA A Y D+L  A+ L SAI+TL+  P + NL  AR  W+ AR PYQQ+
Sbjct: 24  SPKEVLGTYGDIAQAGYADSLESAKLLQSAIDTLIAEPTEANLATARSAWVAARNPYQQT 83

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EVYRFGN IVD W+ +VNAWPLDEG IDYVD+SYG E EEN+ Y AN+IAN  + V  + 
Sbjct: 84  EVYRFGNAIVDNWEGRVNAWPLDEGLIDYVDASYGTEAEENDFYVANVIANPTLKVGGET 143

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           ID ++I+  LL+  L  A  ++ N+ TGYH IEFLLWGQDL       GNRP TDFD  N
Sbjct: 144 IDATVINASLLQDTLQEAGEVEANVATGYHAIEFLLWGQDLNGTGPGAGNRPTTDFDTAN 203

Query: 204 CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL-MKDINAGLNSIITGMTSL 262
           CTGG+C RR +YLK  + +L+SDLEEM+ AW P G A +DL  K    GL +I+TGM SL
Sbjct: 204 CTGGNCERRSQYLKAATDLLISDLEEMVAAWAPGGAAREDLGSKGDTGGLATILTGMGSL 263

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           SY ELAGERM LGL+LHDPE+E DCFSDNT+ S+ NDV+GI + Y G Y    G  + GA
Sbjct: 264 SYGELAGERMKLGLMLHDPEEEHDCFSDNTHMSHYNDVVGIRNVYFGTYKSDFGRDVSGA 323

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+  ++   +  LA E+  K   T+  F  +  R    E++DQ+I E N EGN +V+  I
Sbjct: 324 SLAHMVEDKDPALAAEMKTKLDATLAAFEAVNARVAQGEAYDQLIGEGNAEGNALVQAAI 383

Query: 383 NDLITQTESLRKIRIALDLIEPNR 406
           + L+ QT S+ ++   L L +   
Sbjct: 384 DALVDQTTSIERVVKVLGLDDIAF 407


>gi|269967081|ref|ZP_06181149.1| iron-regulated protein A, putative [Vibrio alginolyticus 40B]
 gi|269828340|gb|EEZ82606.1| iron-regulated protein A, putative [Vibrio alginolyticus 40B]
          Length = 419

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 163/414 (39%), Positives = 238/414 (57%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D++  A+ LD  I+  + +
Sbjct: 4   KVLVQSIAASLLIASGSTVAATVTKQQVVEHYADVAHAVFADSVTTAKALDVKIDEFLQS 63

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ K LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 64  PSAKKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAADYQYE 123

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 124 -LGNEGAAANIIANTSLQIGASKLDVSKITPELLADLNEVGGSEANVASGYHAIEFLLWG 182

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W      
Sbjct: 183 QDLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKG 242

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 243 NYREELLNESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 302

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y  +NG+ + G SI DL++  ++  A EI  +F  T      L   A
Sbjct: 303 YNEQGIYNVYTGTYKGVNGKALSGPSIADLVAQKDKKAATEIQKQFDTTRSQVGELVTSA 362

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +   +    +
Sbjct: 363 EKNNQHFDQLIAAGNAQGNALVNDTIMSLVAQTGAIERAASIVGIDSLSPDTAD 416


>gi|254451478|ref|ZP_05064915.1| insulin-cleaving metalloproteinase outer membrane protein
           [Octadecabacter antarcticus 238]
 gi|198265884|gb|EDY90154.1| insulin-cleaving metalloproteinase outer membrane protein
           [Octadecabacter antarcticus 238]
          Length = 406

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 177/391 (45%), Positives = 247/391 (63%), Gaps = 2/391 (0%)

Query: 18  LSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA 77
            S    +    VL  YA IA AKY D+L+ A+ L +A+  LV  P+ +NL  AR  W+ A
Sbjct: 2   ASPAFAIEKADVLDTYADIAAAKYGDSLIMAQRLQTAVNALVADPSPENLTAARKAWLEA 61

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN     N+IAN+ 
Sbjct: 62  RVPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDENEFAALNVIANAT 121

Query: 138 IIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
             ++  EID + I+PDLL   L  A+G++ N+ TGYH IEFLLWGQDL  +    G RP+
Sbjct: 122 FTLSGTEIDATEITPDLLENTLQEADGVEANVATGYHAIEFLLWGQDLNGHGTGAGQRPW 181

Query: 197 TDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI 255
           TD+ +  +CT  +C RR EYL   + +LVSDLE M+  W   G A  ++M + +AGL ++
Sbjct: 182 TDYALANDCTNANCDRRGEYLTAATDLLVSDLEWMVAQWADHGAARAEVMTNKDAGLAAM 241

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           +TGM SLSY E+AGERM LG++L+DPE+E  CF+DNT+  +  D +G+ + Y GEYIR++
Sbjct: 242 LTGMGSLSYGEVAGERMRLGVMLNDPEEEHSCFADNTHNDHFYDGMGVQNIYLGEYIRVD 301

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGN 375
           G  + G S+ DL+S  +  L  E+  K S TM     +K  AE   ++DQM+   N  G 
Sbjct: 302 GTLVSGPSLADLVSETDAALDAEMQSKLSATMMALGRIKTTAEAGFAYDQMLERGNEAGE 361

Query: 376 KIVRNLINDLITQTESLRKIRIALDLIEPNR 406
            ++   +N  I QT S+ ++  +L L     
Sbjct: 362 ALIMGGVNGFIDQTRSIERVVTSLGLDGIAF 392


>gi|307545021|ref|YP_003897500.1| iron-regulated protein [Halomonas elongata DSM 2581]
 gi|307217045|emb|CBV42315.1| K07231 putative iron-regulated protein [Halomonas elongata DSM
           2581]
          Length = 427

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 174/409 (42%), Positives = 241/409 (58%), Gaps = 7/409 (1%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
            +++   LP  A++    V+ E+V+ +YA +AHA Y+DAL+ ARTLD  I+ L+  PN +
Sbjct: 13  AVALAALLPVTAMAADSEVTAEQVVDHYADLAHANYQDALVAARTLDERIDALLADPNDE 72

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
            L  AR  W+ AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV S   +    N
Sbjct: 73  TLAAARQAWLEARVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGMIDYVASDDYQHELGN 132

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
              TANIIAN  I V  + +D+S ++P+LL +L+   G + N+ TGYH IEFLLWGQDL 
Sbjct: 133 AGATANIIANQSIQVGGEIVDVSELTPELLAELNEIGGSEANVATGYHAIEFLLWGQDLH 192

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQAT 241
                 G RP +D+  G  CT GHC RR  YL   S +LVSDLE M+  W P   D    
Sbjct: 193 GFEAGNGERPASDYMSGEACTHGHCDRRSAYLDATSDLLVSDLEWMVAQWAPDEDDNYRR 252

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
             L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  
Sbjct: 253 ALLAESPKEGLRRMLFGMGSLSLGELAGERMKVALEANSVEDEHDCFSDNTHNSHYYNGQ 312

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + YTG Y R++G  + G S+ DL++  +  L   +  + +++M     LK  AE  +
Sbjct: 313 GIQNVYTGSYQRLDGSTLEGPSLSDLVATRDNTLDDTLKAQLTSSMDALEALKQAAEAEQ 372

Query: 362 ---SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRV 407
              +FD MI+  N +G ++V N I  L+TQT S+ K    L +      
Sbjct: 373 DPMAFDMMIAPGNEQGAELVNNAILALVTQTGSIEKAAGELGVNSLQSD 421


>gi|144899636|emb|CAM76500.1| lipoprotein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 423

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 190/403 (47%), Positives = 253/403 (62%), Gaps = 2/403 (0%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           F+ + +    L     +    V  + VL  YA IAHAKYED+L+ A+ L  AI+ LV  P
Sbjct: 4   FVMVAASAAVLLGTGQAGAAGVDKKAVLTTYADIAHAKYEDSLIAAKQLKVAIDALVAAP 63

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSS-YGKE 121
           + + L  A+  WI AR+PYQQSE +RFGN  VD W+ KVNAWPLDEG IDYV++  YG E
Sbjct: 64  SAETLATAKAAWIAARVPYQQSEAFRFGNTAVDEWEGKVNAWPLDEGLIDYVNADTYGTE 123

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
           + EN LYTANIIA+ K+ V  K ++ S I   LL K+H A G++ N+TTGYH IEF+LWG
Sbjct: 124 SGENPLYTANIIAHPKLKVGGKNVNASKIDKKLLAKMHEAGGVEANVTTGYHAIEFMLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           QD        GNRP +DFD  +CTGG+C RR  YL   + +LV DL+ M+  WG  G+  
Sbjct: 184 QDTNGTGPGAGNRPASDFDTKSCTGGNCDRRAAYLVTATDLLVDDLKTMVDGWGAKGKIR 243

Query: 242 KDLMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
             L+K   +AG+ +I+TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D 
Sbjct: 244 AKLLKGKADAGIATIVTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHFYDA 303

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
            GI + Y G+Y R +G ++ G ++ DL++  +  L  ++  K   TM    +L   AE  
Sbjct: 304 KGIQNIYLGKYTRTDGTEVKGPALADLVAAKDATLDGDMKAKLDATMTAMGVLVKTAEGG 363

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           E++DQMI   N  GN  V+  I+ L+ QT SL K    L L E
Sbjct: 364 EAYDQMIGAGNSAGNAKVQAAIDALVAQTRSLEKAVAVLALGE 406


>gi|332560014|ref|ZP_08414336.1| putative iron-regulated protein [Rhodobacter sphaeroides WS8N]
 gi|332277726|gb|EGJ23041.1| putative iron-regulated protein [Rhodobacter sphaeroides WS8N]
          Length = 422

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 177/401 (44%), Positives = 249/401 (62%), Gaps = 6/401 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  ++    LP  AL+    V   +V++ YA IA A Y D+L  AR L +A++ LV  P 
Sbjct: 8   LATVAPCALLPLPALA----VERSEVVETYADIAEATYADSLATARELQTAVKALVDQPA 63

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           +  L  AR  W+ AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   E
Sbjct: 64  EAALMAARSAWLAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGGATE 123

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN+L   N+IA  K  ++  EID + I+P+L+   LH A+GI+ N+ +GYH IEFLLWGQ
Sbjct: 124 ENDLAALNVIATPKFTLSGTEIDATEITPELISGTLHEADGIEANVASGYHAIEFLLWGQ 183

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           DL       G+RP+TD+  G +CTGG+C RR  YL   + +LVSDL+ M   W   G A 
Sbjct: 184 DLNGTEAGAGDRPFTDYVKGEDCTGGNCDRRAAYLVAATDLLVSDLDYMAAQWADGGAAR 243

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
             + +D   GL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +
Sbjct: 244 VAVTEDPEKGLRAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYYDGL 303

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y G Y R++G  + G S+ DL++  +  L + +  +   T+     L+       
Sbjct: 304 GIRNVYRGHYPRVDGSTVEGPSLSDLVAEADPELDKVLTGQLDATVDRLDALRTAVAGGM 363

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
           ++DQM++  N EG  ++   ++ L+TQT S+ +   AL L 
Sbjct: 364 AYDQMLAPGNAEGEALIMGAVDALVTQTASIERATTALGLT 404


>gi|163803517|ref|ZP_02197387.1| putative iron-regulated protein A [Vibrio sp. AND4]
 gi|159172693|gb|EDP57544.1| putative iron-regulated protein A [Vibrio sp. AND4]
          Length = 420

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 157/413 (38%), Positives = 243/413 (58%), Gaps = 6/413 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +        L +   ++   V+ ++V+++YA +AHA + D+L+ A+ LD+ I+  + +P
Sbjct: 6   VLVQSIAASLLIASGSTVAATVTKQQVVEHYADVAHAVFADSLVTAKALDAKIDEFLKSP 65

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +++ LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E 
Sbjct: 66  SEEKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVATDYQYE- 124

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N    ANI+AN+ + +   ++D+S I+P+L+  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 125 LGNEGAAANIVANTSLQIGASKLDVSKITPELIADLNEVGGSEANVASGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDG 238
           DL       G R YTDF +G  CT GHC RR EYLK  + +LV DL+ M   W       
Sbjct: 185 DLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAAVLLVQDLKWMENQWSIETKGN 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L    ++GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YREELLNGSADSGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y  ++G+++ G S+ DL++  ++  A+EI  +F  T      L   AE
Sbjct: 305 NEQGIYNVYTGTYKGVSGKELSGPSLADLVAQKDKKAAEEIQKQFDTTRSQVGELVTSAE 364

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
            N + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +   +    +
Sbjct: 365 KNNQHFDQLIAAGNAQGNALVNDTIMSLVAQTGAIERAAKIVGIDSLSPDTAD 417


>gi|15964075|ref|NP_384428.1| putative signal peptide protein [Sinorhizobium meliloti 1021]
 gi|307301219|ref|ZP_07580981.1| Peptidase M75, Imelysin [Sinorhizobium meliloti BL225C]
 gi|307317890|ref|ZP_07597327.1| Peptidase M75, Imelysin [Sinorhizobium meliloti AK83]
 gi|15073251|emb|CAC41759.1| Hypothetical signal peptide protein [Sinorhizobium meliloti 1021]
 gi|306896292|gb|EFN27041.1| Peptidase M75, Imelysin [Sinorhizobium meliloti AK83]
 gi|306903675|gb|EFN34262.1| Peptidase M75, Imelysin [Sinorhizobium meliloti BL225C]
          Length = 426

 Score =  383 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 203/379 (53%), Positives = 271/379 (71%), Gaps = 1/379 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYEDAL  A  L+ A++ L+  P+++ L+ AR  W+RAR PYQ++EVYR
Sbjct: 34  VVKHYAAVAHAKYEDALATAEALEKAVDALIAGPSEETLKAAREAWLRARNPYQETEVYR 93

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD+SYG E++EN L+TAN+IAN  I V+ +++D +
Sbjct: 94  FGNTIVDEWEGKVNAWPLDEGLIDYVDASYGSESDENALFTANVIANKTIKVDGQDVDAT 153

Query: 149 IISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            I+P+LL   L  A GI+ N+ TGYH IEFLLWGQDL       GNRPYTDFD   CT G
Sbjct: 154 NITPELLSGTLQEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPYTDFDTKACTNG 213

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR  YLK  + +LVSDLEEM+  W PDG ATK +  D  AGL +I+TGM SLSY EL
Sbjct: 214 NCDRRAAYLKAATSLLVSDLEEMVANWTPDGAATKAVEADPKAGLVAILTGMGSLSYGEL 273

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DCFSDNT+ S+L+D IGI S+Y+GEY R++G K+ G S+ +L
Sbjct: 274 AGERMKLGLLLHDPEEEHDCFSDNTHNSHLHDAIGIQSAYSGEYTRVDGSKLTGPSLSEL 333

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  +  L +E+ D  + T++   ++  RAE  E++DQMI E N EGN  V+  I+ LI 
Sbjct: 334 VAAKDAALDKEMKDGLATTVEKMQVMAKRAETGEAYDQMIGEGNAEGNATVQAAIDGLIA 393

Query: 388 QTESLRKIRIALDLIEPNR 406
           Q +++ ++  ALDL     
Sbjct: 394 QAKTVERVIAALDLGTVEL 412


>gi|260776049|ref|ZP_05884944.1| iron-regulated protein A precursor [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607272|gb|EEX33537.1| iron-regulated protein A precursor [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 420

 Score =  383 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 163/414 (39%), Positives = 243/414 (58%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        + + +     NV+ E+V+++YA +AHA + DAL  A+TLD +IE+ +  
Sbjct: 5   SLLARSVATSLVLASSSVFAANVTKEQVVEHYADVAHAVFADALTTAKTLDQSIESFLAA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P++  L   +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSEAKLAEVKQAWLDSRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSTDYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N   +ANI+AN ++ +   ++D++ ++P+ +  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGASANIVANKQLTIGATKLDVAQLTPEAIADLNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT G+C RR EYLK  + +LV DL+ M K W  D  G
Sbjct: 184 QDLNGTNAGAGERAYTDFVVGKGCTNGNCDRRGEYLKAAADLLVQDLQWMEKQWSSDVKG 243

Query: 239 QATKDLMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+ D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYREELLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G  + G SI DL++  ++  A+EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGLYKREDGTLLSGPSIADLVAQKDKAAAKEIQKQFDVTRSQVGQLVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+  N +GN +V   I  L+ QT S+ +    + +   N    +
Sbjct: 364 EKNGQYFDQLIAAGNAQGNALVNETIMSLVAQTSSIERAAKIVGINSLNPDTAD 417


>gi|269961719|ref|ZP_06176080.1| iron-regulated protein A, putative [Vibrio harveyi 1DA3]
 gi|269833584|gb|EEZ87682.1| iron-regulated protein A, putative [Vibrio harveyi 1DA3]
          Length = 420

 Score =  383 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 163/414 (39%), Positives = 240/414 (57%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D++  A+ LD  I+  + +
Sbjct: 5   KVLVQSIAASLLIASGSTVAATVTKQQVVEHYADVAHAVFADSVTTAKALDVKIDEFLKS 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ K LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSAKKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAADYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGAAANIIANTSLQIGASKLDVSKITPELLADLNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W      
Sbjct: 184 QDLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKG 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYREELLNESADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y  +NG+++ G SI DL++  ++  A EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGTYKGVNGKELSGPSIADLVAQKDKKAATEIQKQFDTTRNQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +   +    +
Sbjct: 364 EKNNQHFDQLIAAGNAQGNALVNDTIMSLVAQTGAIERAANIVGIDSLSPDTAD 417


>gi|149191668|ref|ZP_01869911.1| putative iron-regulated protein A [Vibrio shilonii AK1]
 gi|148834509|gb|EDL51503.1| putative iron-regulated protein A [Vibrio shilonii AK1]
          Length = 419

 Score =  383 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 158/408 (38%), Positives = 244/408 (59%), Gaps = 6/408 (1%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           ++  +L   + +    V+ ++V+++YA +AHA + DAL+ A+ LD++I T +  P++K L
Sbjct: 10  AVAASLVMTSSAAFSAVTKDQVVEHYADLAHAVFADALITAKDLDTSINTFLANPSEKGL 69

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
            + +  W+ +R+PYQQ+EV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N  
Sbjct: 70  ADVQQAWLASRVPYQQTEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVSADYQYE-LGNEG 128

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
             ANI+AN  + +    +D+  I+P+++  L+   G + N+ +GYH IEFLLWGQDL   
Sbjct: 129 AQANIVANKSLKIGATTLDVKEITPEVIANLNEVGGSEANVASGYHAIEFLLWGQDLNGT 188

Query: 188 VREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKD 243
               G RPYTD+ +G  CT G+C RR +YL+  SK+L+ DL+ M K W         ++ 
Sbjct: 189 NAGAGERPYTDYVVGEGCTNGNCERRAQYLQAASKLLIQDLQWMEKQWSASEKGNYRSEL 248

Query: 244 LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           L    + G+  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI
Sbjct: 249 LADKADNGIRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGI 308

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIES 362
            + YTG Y+R++G  + G SI +L+   ++  A+EI  +F         L   AE + + 
Sbjct: 309 YNVYTGTYVRVDGTLVDGPSIANLVEAKDKTAAKEIQKQFDLARAQVGKLVTSAEKDNQH 368

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           FDQ+I+ NNP+GNK+V   I  L+ QT S+ +    + +   N    +
Sbjct: 369 FDQLIASNNPQGNKLVNETIVALVAQTGSIERAAGIIGIDSLNPDTAD 416


>gi|262171702|ref|ZP_06039380.1| iron-regulated protein A precursor [Vibrio mimicus MB-451]
 gi|261892778|gb|EEY38764.1| iron-regulated protein A precursor [Vibrio mimicus MB-451]
          Length = 420

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 160/414 (38%), Positives = 237/414 (57%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +T   +     S + S+    +  +V+++YA IAHA Y D+ + A+ L  +I+  + T
Sbjct: 5   SILTSAILASLTLSASASLAAAPTQAQVVEHYANIAHAVYADSRLTAQQLQKSIDRFLQT 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  K LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAKGLEEVKQAWLAARVPYQQSEVFRFGNTIVDDWEGQLNAWPLDEGLIDYVSGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIVANTSLTIGANKLDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT G+C RR +YLK  +++LV+DLE M K W      
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKECTNGNCDRRAQYLKAAAQLLVTDLEWMEKQWANGEKG 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLNESSENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + +TG Y R +G ++ G S+++L++  + + A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIFTGTYTRADGSELKGPSLYELVAEKDASAAKEILQQFEAARTQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 364 EKNNQHFDQLIAADNTAGHAIINQAIMALVVQTGSIERAAGIIGIDNLNPDTAD 417


>gi|77462087|ref|YP_351591.1| imelysin [Rhodobacter sphaeroides 2.4.1]
 gi|77386505|gb|ABA77690.1| imelysin. Metallo peptidase. MEROPS family M75 [Rhodobacter
           sphaeroides 2.4.1]
          Length = 422

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 177/401 (44%), Positives = 250/401 (62%), Gaps = 6/401 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  ++    LP  AL+    V   +V++ YA IA A Y D+L  AR L +A++ LV  P+
Sbjct: 8   LATVAPCALLPLPALA----VERSEVVETYADIAEATYADSLATARELQTAVKALVDQPS 63

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           +  L  AR  W+ AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   E
Sbjct: 64  EAALMAARSAWLAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGGATE 123

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN+L   N+IA  K  ++  EID + I+P+L+   LH A+GI+ N+ +GYH IEFLLWGQ
Sbjct: 124 ENDLAALNVIATPKFTLSGTEIDATEITPELISGTLHEADGIEANVASGYHAIEFLLWGQ 183

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           DL       G+RP+TD+  G +CTGG+C RR  YL   + +LVSDL+ M   W   G A 
Sbjct: 184 DLNGTEAGAGDRPFTDYAKGEDCTGGNCDRRAAYLVAATDLLVSDLDYMAAQWADGGAAR 243

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
             + +D   GL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +
Sbjct: 244 VAVNEDPGKGLRAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYYDGL 303

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y G Y R++G  + G S+ DL++  +  L + +  +   T+     L+       
Sbjct: 304 GIRNVYRGHYARVDGSTVEGPSLSDLVAEADPELDKVLTGQLDATVDRLDALRTAVAGGM 363

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
           ++DQM++  N EG  ++   ++ L+TQT S+ +   AL L 
Sbjct: 364 AYDQMLAPGNAEGEALIMGAVDALVTQTASIERATTALGLT 404


>gi|91227199|ref|ZP_01261658.1| putative iron-regulated protein A [Vibrio alginolyticus 12G01]
 gi|91188727|gb|EAS75015.1| putative iron-regulated protein A [Vibrio alginolyticus 12G01]
          Length = 420

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 163/414 (39%), Positives = 239/414 (57%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +   ++   V+ ++V+++YA +AHA + D++  A+ LD  I+  + +
Sbjct: 5   KVLVQSIAASLLIASGSTVAATVTKQQVVEHYADVAHAVFADSVTTAKALDVKIDEFLQS 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ K LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E
Sbjct: 65  PSAKKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAADYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+S I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGAAANIIANTSLQIGASKLDVSKITPELLADLNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PD 237
           QDL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W      
Sbjct: 184 QDLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSAEVKG 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L    + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYREELLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y  +NG+++ G SI DL++  ++  A EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGTYKGVNGKELSGPSIADLVAQKDKKAATEIQKQFDTTRSQVGELVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +   +    +
Sbjct: 364 EKNNQHFDQLIAAGNAQGNALVNDTIMSLVAQTGAIERAASIVGIDSLSPDTAD 417


>gi|302608206|emb|CBW44452.1| putative iron-regulated protein A precursor [Marinobacter
           hydrocarbonoclasticus]
          Length = 431

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 161/414 (38%), Positives = 239/414 (57%), Gaps = 9/414 (2%)

Query: 1   MYFITIISIVFTLPSHALSIV--PNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETL 58
           +      ++     +   S       +   V+ +YA +AHA YEDAL+ AR LD A + L
Sbjct: 10  LALTIATALTAGCANAPWSAEQSAQATKASVVTHYADLAHATYEDALITARALDEATDRL 69

Query: 59  VTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSY 118
           +  P + NL+ A+  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV +  
Sbjct: 70  IANPTEANLKAAKEAWLASRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVKADD 129

Query: 119 GKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFL 178
            +    N   TANI+A++ I V  + +D++ ++P+LL  L+   G + N+ TGYH +EFL
Sbjct: 130 YQHELGNAGATANIVASNSINVGGETLDVATLTPELLADLNEVGGSEANVATGYHAVEFL 189

Query: 179 LWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD 237
           LWGQDL       G RP TD+  G +CT G+C RR +YL  V+ +LV DLE M+  W P 
Sbjct: 190 LWGQDLHGFEGGAGERPVTDYAKGNDCTNGNCERRAQYLDAVTDLLVDDLEWMVAQWAPG 249

Query: 238 ---GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYA 294
                 ++    + + G+  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ 
Sbjct: 250 TSDNYRSQLTSANADEGIQKMLFGMGSLSLGELAGERMKVALEANSYEDEHDCFSDNTHN 309

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
           S+  +  GI + YTG Y R++G  + G S+ DL+   N  L   +N +   +M+   ++K
Sbjct: 310 SHYYNGQGIQNVYTGTYRRVDGSVVSGPSLSDLVEQTNPELDARLNRQLDASMEALALMK 369

Query: 355 DRAENIE---SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
            RAE+ +   +FD MI+  N EG +IV   I  L+ QT S+ +    L +   +
Sbjct: 370 ARAESSQNPMAFDTMIAPGNAEGTRIVNGAIMALVEQTGSIEQAARQLGIQALS 423


>gi|221641041|ref|YP_002527303.1| Imelysin. Metallo peptidase. MEROPS family M75 [Rhodobacter
           sphaeroides KD131]
 gi|221161822|gb|ACM02802.1| Imelysin. Metallo peptidase. MEROPS family M75 precursor
           [Rhodobacter sphaeroides KD131]
          Length = 422

 Score =  381 bits (979), Expect = e-104,   Method: Composition-based stats.
 Identities = 177/401 (44%), Positives = 249/401 (62%), Gaps = 6/401 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  ++    LP  AL+    V   +V++ YA IA A Y D+L  AR L +A++ LV  P+
Sbjct: 8   LATVAPCALLPLPALA----VERSEVVETYADIAEATYADSLATARELQTAVKALVDQPS 63

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           +  L  AR  W+ AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   E
Sbjct: 64  EAALMAARSAWLAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGGVTE 123

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN+L   N+IA  K  ++  EID + I+P+L+   LH A+GI+ N+ +GYH IEFLLWGQ
Sbjct: 124 ENDLAALNVIATPKFTLSGTEIDATEITPELISGTLHEADGIEANVASGYHAIEFLLWGQ 183

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           DL       G+RP+TD+  G  CTGG+C RR  YL   + +LVSDL+ M   W   G A 
Sbjct: 184 DLNGTEAGAGDRPFTDYAKGEACTGGNCDRRAAYLLAATDLLVSDLDYMAAQWADGGAAR 243

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
             + +D   GL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +
Sbjct: 244 VAVTEDPEKGLRAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYYDGL 303

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y G Y R++G  + G S+ DL++  +  L + +  +   T+     L+       
Sbjct: 304 GIRNVYRGHYARVDGSTVEGPSLSDLVAEADPELDKVLTGQLDATVDRLDALRTAVAGGM 363

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
           ++DQM++  N EG  ++   ++ L+TQT S+ +   AL L 
Sbjct: 364 AYDQMLAPGNAEGEALIMGAVDALVTQTASIERATTALGLT 404


>gi|15641277|ref|NP_230909.1| iron-regulated protein A, putative [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121590729|ref|ZP_01678060.1| iron-regulated protein A, putative [Vibrio cholerae 2740-80]
 gi|147673863|ref|YP_001216829.1| putative iron-regulated protein A [Vibrio cholerae O395]
 gi|153819649|ref|ZP_01972316.1| iron-regulated protein A, putative [Vibrio cholerae NCTC 8457]
 gi|227081436|ref|YP_002809987.1| putative iron-regulated protein A [Vibrio cholerae M66-2]
 gi|254848388|ref|ZP_05237738.1| iron-regulated protein A [Vibrio cholerae MO10]
 gi|298498644|ref|ZP_07008451.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9655748|gb|AAF94423.1| iron-regulated protein A, putative [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121547410|gb|EAX57521.1| iron-regulated protein A, putative [Vibrio cholerae 2740-80]
 gi|126509808|gb|EAZ72402.1| iron-regulated protein A, putative [Vibrio cholerae NCTC 8457]
 gi|146315746|gb|ABQ20285.1| putative iron-regulated protein A [Vibrio cholerae O395]
 gi|227009324|gb|ACP05536.1| putative iron-regulated protein A [Vibrio cholerae M66-2]
 gi|227013181|gb|ACP09391.1| putative iron-regulated protein A [Vibrio cholerae O395]
 gi|254844093|gb|EET22507.1| iron-regulated protein A [Vibrio cholerae MO10]
 gi|297542977|gb|EFH79027.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 435

 Score =  381 bits (979), Expect = e-104,   Method: Composition-based stats.
 Identities = 159/414 (38%), Positives = 233/414 (56%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IA+A Y D+ + A+ L   I+  +  
Sbjct: 20  SILSSTILASLTLTTSASFAAAPTQAQVVEHYADIAYAVYADSRVTAQQLQKTIDRFLQA 79

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 80  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 139

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 140 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 198

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 199 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 258

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 259 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 318

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 319 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 378

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 379 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPDTAD 432


>gi|120555744|ref|YP_960095.1| putative iron-regulated protein A [Marinobacter aquaeolei VT8]
 gi|120325593|gb|ABM19908.1| imelysin, Metallo peptidase, MEROPS family M75 [Marinobacter
           aquaeolei VT8]
          Length = 431

 Score =  381 bits (979), Expect = e-104,   Method: Composition-based stats.
 Identities = 160/414 (38%), Positives = 239/414 (57%), Gaps = 9/414 (2%)

Query: 1   MYFITIISIVFTLPSHALSIV--PNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETL 58
           +      ++     +   S       +   V+ +YA +AHA YEDAL+ AR LD A + L
Sbjct: 10  LALTIATALTAGCANAPWSAEQSAQATKASVVTHYADLAHATYEDALITARALDEATDRL 69

Query: 59  VTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSY 118
           +  P + NL+ A+  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV +  
Sbjct: 70  IANPTEANLKAAKEAWLASRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVKADD 129

Query: 119 GKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFL 178
            +    N   TANI+A++ I V  + +D++ ++P+LL  L+   G + N+ TGYH +EFL
Sbjct: 130 YQHELGNAGATANIVASNSINVGGETLDVATLTPELLADLNEVGGSEANVATGYHAVEFL 189

Query: 179 LWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD 237
           LWGQDL       G RP TD+  G +CT G+C RR +YL  V+ +LV DLE M+  W P 
Sbjct: 190 LWGQDLHGFEGGAGERPVTDYAKGNDCTNGNCERRAQYLDAVTDLLVDDLEWMVAQWAPG 249

Query: 238 ---GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYA 294
                 ++    + + G+  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ 
Sbjct: 250 TSDNYRSQLTSANADEGIQKMLFGMGSLSLGELAGERMKVALEANSYEDEHDCFSDNTHN 309

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
           S+  +  GI + YTG Y R++G  + G S+ DL+   N  L   +N +   +M+   ++K
Sbjct: 310 SHYYNGQGIQNVYTGTYRRVDGSVVSGPSLSDLVEQTNPELDARLNRQLDASMEALALMK 369

Query: 355 DRAENIE---SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
            RAE+ +   +FD MI+  N EG +I+   I  L+ QT S+ +    L +   +
Sbjct: 370 ARAESSQNPMAFDTMIAPGNAEGTRIINGAIMALVEQTGSIEQAARQLGIQALS 423


>gi|328474741|gb|EGF45546.1| putative iron-regulated protein A [Vibrio parahaemolyticus 10329]
          Length = 420

 Score =  381 bits (979), Expect = e-104,   Method: Composition-based stats.
 Identities = 160/413 (38%), Positives = 237/413 (57%), Gaps = 6/413 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +        L +   ++   V+ ++V+++YA +AHA + D+L  A+TL+  I+  +  P
Sbjct: 6   VLVQSIAASLLIASGTTVAAQVTKQQVVEHYADVAHAVFADSLTTAKTLEVKIDEFLKAP 65

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           ++  LE+ +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E 
Sbjct: 66  SEAKLEDVKQAWLESRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVAADYQYE- 124

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N    ANIIAN+ + +   ++D++ I+P+LL  L+   G + N+ TGYH IEFLLWGQ
Sbjct: 125 LGNEGAAANIIANTSLTIGPSKLDVAKITPELLASLNEVGGSEANVATGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDG 238
           DL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W       
Sbjct: 185 DLNGTNAGAGQRAYTDFVVGSGCTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADEKGN 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L      GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YRQELLTGSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G  + G SI +L++  ++  A+EI  +F  T      L   AE
Sbjct: 305 NEQGIYNVYTGTYSRQDGTVLTGPSIANLVAQEDKKAAEEIQKQFDVTRSQVGELVTSAE 364

Query: 359 N-IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
              + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +   +    +
Sbjct: 365 KHNQHFDQLIAAGNAQGNALVNDTIMALVAQTGAIERAAGIVGIDSLSPDTAD 417


>gi|59711797|ref|YP_204573.1| hypothetical protein VF_1190 [Vibrio fischeri ES114]
 gi|59479898|gb|AAW85685.1| Uncharacterized iron-regulated protein [Vibrio fischeri ES114]
          Length = 417

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 171/410 (41%), Positives = 238/410 (58%), Gaps = 9/410 (2%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I + +F +PS + +     +  +V+++YA IAHA Y D+L  A+ LD AI T +  P+K
Sbjct: 10  LITASLFVIPSISQAT----TQSEVVEHYADIAHAVYSDSLSTAQKLDKAITTFLNNPSK 65

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
             LE  +L W  AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  E   
Sbjct: 66  DGLETVKLAWKEARVPYQQSEVFRFGNAIVDEWEGQLNAWPLDEGLIDYVADDYQYE-LG 124

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
           N+   ANI+A+  I +  + ID++ I  + L  L+   G + N+ TGYH IEFLLWGQDL
Sbjct: 125 NDGAKANIVASKSIKIGAETIDVTSIKAEQLADLNELGGSEANVATGYHAIEFLLWGQDL 184

Query: 185 KTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQAT 241
                  G RPYTD+ IG+ CT G+C RR EYLK  S++L+ DL  M K W         
Sbjct: 185 NGTNSGAGERPYTDYVIGSACTNGNCERRAEYLKAASELLIKDLSWMEKQWKEGEKNYRA 244

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
           + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  
Sbjct: 245 ELLSESSEQGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQ 304

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NI 360
           GI + YTG Y R +G ++ G SIHDL++  +   A+EI  +F  T      L   AE + 
Sbjct: 305 GIYNVYTGTYTRADGSQLSGPSIHDLVAKKDAKAAKEIKQQFDATRTQVGTLVSAAEKDN 364

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           + FDQ+I+ +N  GN +V   I  L+ QT S+ +    + +   N    +
Sbjct: 365 QHFDQLIAADNAVGNALVNKSIMSLVLQTASIERAANVIGITSLNPDTAD 414


>gi|153839462|ref|ZP_01992129.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AQ3810]
 gi|260363707|ref|ZP_05776491.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus K5030]
 gi|260879726|ref|ZP_05892081.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AN-5034]
 gi|260898800|ref|ZP_05907241.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus Peru-466]
 gi|260901613|ref|ZP_05910008.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AQ4037]
 gi|149747019|gb|EDM58007.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AQ3810]
 gi|308086683|gb|EFO36378.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus Peru-466]
 gi|308093281|gb|EFO42976.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AN-5034]
 gi|308108687|gb|EFO46227.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus AQ4037]
 gi|308113404|gb|EFO50944.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           parahaemolyticus K5030]
          Length = 420

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 160/413 (38%), Positives = 237/413 (57%), Gaps = 6/413 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +        L +   ++   V+ ++V+++YA +AHA + D+L  A+TL+  I+  +  P
Sbjct: 6   VLVQSIAASLLIASGTTVAAQVTKQQVVEHYADVAHAVFADSLTTAKTLEVKIDEFLKAP 65

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           ++  LE+ +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E 
Sbjct: 66  SEAKLEDVKQAWLESRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVAADYQYE- 124

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N    ANIIAN+ + +   ++D++ I+P+LL  L+   G + N+ TGYH IEFLLWGQ
Sbjct: 125 LGNEGAAANIIANTSLTIGPSKLDVAKITPELLASLNEVGGSEANVATGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDG 238
           DL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W       
Sbjct: 185 DLNGTNAGAGKRAYTDFVVGSGCTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADEKGN 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
              + L      GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YRQELLTGSAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G  + G SI +L++  ++  A+EI  +F  T      L   AE
Sbjct: 305 NEQGIYNVYTGTYSRQDGTVLTGPSIANLVAQEDKKAAEEIQKQFDATRSQVGELVTSAE 364

Query: 359 N-IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
              + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +   +    +
Sbjct: 365 KHNQHFDQLIAAGNAQGNALVNDTIMALVAQTGAIERAAGIVGIDSLSPDTAD 417


>gi|153212296|ref|ZP_01948084.1| iron-regulated protein A, putative [Vibrio cholerae 1587]
 gi|153801301|ref|ZP_01955887.1| iron-regulated protein A, putative [Vibrio cholerae MZO-3]
 gi|153829589|ref|ZP_01982256.1| putative iron-regulated protein A [Vibrio cholerae 623-39]
 gi|254291715|ref|ZP_04962502.1| iron-regulated protein A, putative [Vibrio cholerae AM-19226]
 gi|124116674|gb|EAY35494.1| iron-regulated protein A, putative [Vibrio cholerae 1587]
 gi|124123126|gb|EAY41869.1| iron-regulated protein A, putative [Vibrio cholerae MZO-3]
 gi|148874923|gb|EDL73058.1| putative iron-regulated protein A [Vibrio cholerae 623-39]
 gi|150422399|gb|EDN14359.1| iron-regulated protein A, putative [Vibrio cholerae AM-19226]
          Length = 435

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 160/414 (38%), Positives = 233/414 (56%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 20  SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 79

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 80  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 139

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 140 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 198

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 199 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 258

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 259 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 318

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 319 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 378

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 379 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPDTAD 432


>gi|13474605|ref|NP_106174.1| hypothetical protein mlr5523 [Mesorhizobium loti MAFF303099]
 gi|14025359|dbj|BAB51960.1| mlr5523 [Mesorhizobium loti MAFF303099]
          Length = 439

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 194/404 (48%), Positives = 265/404 (65%), Gaps = 2/404 (0%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
              + + T     L        + V++ Y+ IA AKYED+L  A+ LD A++ L+  P+ 
Sbjct: 22  IGATALLTAAVFVLPAKAETDAKAVIRTYSDIALAKYEDSLTTAQALDKAVDALLAKPSA 81

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           + L  AR  W  AR+PYQQ+EVYRFGNKIVD W+ +VN+WPLDEG IDYV  SYG E++ 
Sbjct: 82  ETLNVARDAWKAARVPYQQTEVYRFGNKIVDDWEGEVNSWPLDEGLIDYVAKSYGTESDT 141

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQD 183
           N+LYTAN+IAN +I +N K++D S +SP+ L   L +A G++ N+ TGYH IEFLLWGQD
Sbjct: 142 NSLYTANVIANKEIEINGKKVDASKLSPEFLSGTLQQAGGVEANVATGYHAIEFLLWGQD 201

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
           L       G RPYTD+D+ NCTGG+C RR EYLK  + +LVSDL++M+  W  DG A K+
Sbjct: 202 LHGTGPGAGERPYTDYDLRNCTGGNCDRRAEYLKSATTLLVSDLQKMVNDWKEDGAARKN 261

Query: 244 LMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
           L+    N  ++ I TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+L D IG
Sbjct: 262 LVDGEPNTAISVIFTGMGSLSYGELAGERMKLGLMLHDPEEEQDCFSDNTYNSHLYDAIG 321

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           I ++Y   Y R++G  + G S+HD++   +  + +E++DK   T+     +K RAE  E+
Sbjct: 322 IRAAYLASYTRLDGTVVSGPSVHDMVKAADPAIDKELSDKLDVTVAKMEAIKARAEAGEA 381

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           +DQ I+E N  GN  V+  I+ LI QT+S+ +   +L L     
Sbjct: 382 YDQQIAEGNTAGNATVQAAIDALIDQTKSIERAVGSLKLNAIAF 425


>gi|118592450|ref|ZP_01549842.1| hypothetical protein SIAM614_26521 [Stappia aggregata IAM 12614]
 gi|118435108|gb|EAV41757.1| hypothetical protein SIAM614_26521 [Stappia aggregata IAM 12614]
          Length = 420

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 201/405 (49%), Positives = 264/405 (65%), Gaps = 8/405 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +   S +F  P+ A +         +L  Y  IA AKY D+L  A+TL +AI+ LV  P 
Sbjct: 8   LLAASALFVTPALAAAP------SDILSTYGDIAQAKYADSLATAKTLKTAIDKLVAEPT 61

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           + NLE AR  W  AR PYQQ+E YRFGN IVD W+ KVNAWPLDEG IDYVD+SYG E+E
Sbjct: 62  EANLEAARTAWKDARDPYQQTEAYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGDESE 121

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN+ Y AN+IAN  + V  + ID + I+P LL   L  A  ++TN+ TGYH IEFLLWGQ
Sbjct: 122 ENDFYVANVIANPSLKVGGETIDATEITPALLADTLQEAGEVETNVATGYHAIEFLLWGQ 181

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           DL       G RP TDFD  NCTGG+C RR++YL+  + +L+SDLEEM  AW PDG A +
Sbjct: 182 DLNGTDAGAGKRPATDFDPANCTGGNCERRIQYLQAATDLLISDLEEMAAAWAPDGAARE 241

Query: 243 DLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
           +L  K    GL +I+TGM SLSY ELAGER+ LGL+LHDPE+E DCFSDNT+ S+ NDV+
Sbjct: 242 ELASKGEAGGLATILTGMGSLSYGELAGERIKLGLMLHDPEEEHDCFSDNTHMSHYNDVV 301

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y G Y    G  + GAS+ +L++  +  LA+E+  K   T+  F  +K RAE  E
Sbjct: 302 GIRNVYFGSYKSPVGNDVSGASLAELVAEKDPALAEEMKTKLDATLAAFEAMKARAEAGE 361

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           ++DQMI E N EGN +V+  ++ L+ QT S+ ++   L+L +   
Sbjct: 362 AYDQMIGEGNEEGNAVVQAAVDALVDQTASIERVVKVLELDDIAF 406


>gi|297578856|ref|ZP_06940784.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297536450|gb|EFH75283.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 435

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 161/414 (38%), Positives = 234/414 (56%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 20  SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 79

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 80  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 139

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  ISP+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 140 -LGNEGANANIIANTALTIGATKVDVKEISPELLASLNEIGGSEANVASGYHAIEFLLWG 198

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 199 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 258

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L + +  GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 259 NYRQQLLSESVENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 318

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 319 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 378

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 379 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPDTAD 432


>gi|254503368|ref|ZP_05115519.1| hypothetical protein SADFL11_3407 [Labrenzia alexandrii DFL-11]
 gi|222439439|gb|EEE46118.1| hypothetical protein SADFL11_3407 [Labrenzia alexandrii DFL-11]
          Length = 420

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 198/381 (51%), Positives = 257/381 (67%), Gaps = 2/381 (0%)

Query: 28  KVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
            VL  Y+ IA+AKY D+L  A+TL SAI+ L+  P   NL  AR  WI AR PYQQ+E Y
Sbjct: 26  DVLGTYSDIAYAKYSDSLETAKTLQSAIDKLIAEPTDTNLAAARKAWIEARNPYQQTEAY 85

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           RFGN IVD W+ KVNAWPLDEG IDYVD SYG+++EEN  Y AN+IAN  + V  + ID 
Sbjct: 86  RFGNAIVDDWEGKVNAWPLDEGLIDYVDVSYGEDSEENAFYAANVIANPSLKVGGETIDA 145

Query: 148 SIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTG 206
           S+I+P LL + L  A  ++ N+ TGYH IEFLLWGQDL       GNRP +DFD  NCTG
Sbjct: 146 SVITPALLAESLQEAGEVEANVATGYHAIEFLLWGQDLNGTDAGAGNRPASDFDTANCTG 205

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM-KDINAGLNSIITGMTSLSYN 265
           G+C RR +YL   + +L++DLEEM+ AW P G A ++L  K    GL +I+TGM SLSY 
Sbjct: 206 GNCERRAQYLNSATDLLITDLEEMVAAWAPGGAAREELGGKGEAGGLATILTGMGSLSYG 265

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           ELAGERM LGL+LHDPE+E DCFSDNT+ S+ NDV+GI + Y GEY    G  + GAS+ 
Sbjct: 266 ELAGERMKLGLMLHDPEEEHDCFSDNTHMSHYNDVVGIRNVYFGEYKSPLGNDVKGASLA 325

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           ++++  +  LA+E+  K   T+  F  +K RAE  E++DQMI E N EGN +V+  +N L
Sbjct: 326 EMVAAKDPALAEEMQAKLDATLAAFEAMKARAEAGEAYDQMIGEGNDEGNAVVQAAVNAL 385

Query: 386 ITQTESLRKIRIALDLIEPNR 406
           + QT S+ ++   L+L E   
Sbjct: 386 VDQTTSIERVVKVLELDEIAF 406


>gi|254488016|ref|ZP_05101221.1| insulin-cleaving metalloproteinase outer membrane protein
           [Roseobacter sp. GAI101]
 gi|214044885|gb|EEB85523.1| insulin-cleaving metalloproteinase outer membrane protein
           [Roseobacter sp. GAI101]
          Length = 420

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 181/384 (47%), Positives = 249/384 (64%), Gaps = 2/384 (0%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
              +VL  YA IA AKYED+L+ A+ L +A+  LV+ P+   L  AR  W+ AR+PYQQ+
Sbjct: 23  EKAEVLGTYADIAAAKYEDSLITAQRLQTAVAALVSDPSADTLTAARSAWLAARVPYQQT 82

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EVYRFGN IVD W+ KVN+WPLDEG IDYVD+SYG  ++EN L   N+I++    ++  E
Sbjct: 83  EVYRFGNPIVDDWEGKVNSWPLDEGLIDYVDASYGGPSDENELAGLNVISSPTFTLSGTE 142

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           ID S I+P  L   LH A+GI+ N+ TGYH IEFLLWGQDL  +    GNRP+TD+  G+
Sbjct: 143 IDASTITPAFLSDTLHEADGIEANVATGYHAIEFLLWGQDLNGHGDGAGNRPWTDYAKGD 202

Query: 204 -CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSL 262
            CT  +C RR  YL   + +LVSDL  M   W  DG A  +L +D NAGL +I+TGM SL
Sbjct: 203 ACTNANCDRRGAYLTAATDLLVSDLTWMTAQWADDGAARAELTQDTNAGLAAILTGMGSL 262

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           SY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI S+Y GEY+R++G  + G 
Sbjct: 263 SYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIQSAYLGEYVRIDGTMVSGP 322

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+ D+++  + +L  E+  K S TM     +K  AE   ++DQM++  +  G  ++   +
Sbjct: 323 SLADMVAETDADLNTEMQAKLSKTMMALGRIKTAAEAGFAYDQMLARGDAGGEALIMGGV 382

Query: 383 NDLITQTESLRKIRIALDLIEPNR 406
           + LI QT S+ ++   L L +   
Sbjct: 383 DALIDQTRSIERVVTTLGLDQIAF 406


>gi|197334683|ref|YP_002155989.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           fischeri MJ11]
 gi|197316173|gb|ACH65620.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           fischeri MJ11]
          Length = 417

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 171/410 (41%), Positives = 238/410 (58%), Gaps = 9/410 (2%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I + +F +PS + +     +  +V+++YA IAHA Y D+L  A+ LD AI T +  P+K
Sbjct: 10  LITASLFVIPSISQAA----TQSEVVEHYADIAHAVYSDSLSAAQKLDKAITTFLNNPSK 65

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
             LE  +L W  AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  E   
Sbjct: 66  DGLETVKLAWKEARVPYQQSEVFRFGNAIVDEWEGQLNAWPLDEGLIDYVADDYQYE-LG 124

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
           N+   ANI+A+  I +  + ID++ I  + L  L+   G + N+ TGYH IEFLLWGQDL
Sbjct: 125 NDGAKANIVASKSIKIGAETIDVTSIKAEQLADLNELGGSEANVATGYHAIEFLLWGQDL 184

Query: 185 KTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQAT 241
                  G RPYTD+ IG+ CT G+C RR EYLK  S++L+ DL  M K W         
Sbjct: 185 NGTNSGAGERPYTDYVIGSACTNGNCERRAEYLKAASELLIKDLSWMEKQWKEGEKNYRA 244

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
           + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  
Sbjct: 245 ELLSESSEQGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQ 304

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NI 360
           GI + YTG Y R +G ++ G SIHDL++  +   A+EI  +F  T      L   AE + 
Sbjct: 305 GIYNVYTGTYTRADGSQLSGPSIHDLVAKKDAKAAKEIKQQFDATRTQVGTLVSAAEKDN 364

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           + FDQ+I+ +N  GN +V   I  L+ QT S+ +    + +   N    +
Sbjct: 365 QHFDQLIAADNAAGNALVNKSIMSLVLQTASIERAANVIGITSLNPDTAD 414


>gi|327483952|gb|AEA78359.1| Iron-regulated protein A precursor [Vibrio cholerae LMA3894-4]
          Length = 420

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 160/414 (38%), Positives = 233/414 (56%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWVSGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 364 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPDTAD 417


>gi|156974993|ref|YP_001445900.1| hypothetical protein VIBHAR_02715 [Vibrio harveyi ATCC BAA-1116]
 gi|156526587|gb|ABU71673.1| hypothetical protein VIBHAR_02715 [Vibrio harveyi ATCC BAA-1116]
          Length = 423

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 165/413 (39%), Positives = 246/413 (59%), Gaps = 6/413 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +        L +   ++   V+ ++V+++YA +AHA + D+L  A+TLD  I+  + +P
Sbjct: 9   VLVQSIAASLLIASGSTVAATVTKQQVVEHYADVAHAVFADSLTTAQTLDVKIDEFLKSP 68

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + K LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E 
Sbjct: 69  SAKKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGELNAWPLDEGLIDYVAADYQYE- 127

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N    ANI+AN+ + +   ++D+S I+P+L+  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 128 LGNEGAAANIVANTSLQIGASKLDVSKITPELIADLNEVGGSEANVASGYHAIEFLLWGQ 187

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQ 239
           DL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W  D  G 
Sbjct: 188 DLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADVKGN 247

Query: 240 ATKDLMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
             ++L+ D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 248 YREELLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 307

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y  ++G+++ G SI DL++  ++  A+EI  +F  T      L   AE
Sbjct: 308 NEQGIYNVYTGTYKGVSGKELSGPSIADLVAQKDKKAAEEIQKQFDTTRSQVGELVTSAE 367

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
            N + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +   +    +
Sbjct: 368 KNNQHFDQLIAAGNAQGNALVNDTIMSLVAQTGAIERAANIVGIDSLSPDTAD 420


>gi|153835282|ref|ZP_01987949.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           harveyi HY01]
 gi|148868218|gb|EDL67364.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           harveyi HY01]
          Length = 420

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 165/413 (39%), Positives = 246/413 (59%), Gaps = 6/413 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +        L +   ++   V+ ++V+++YA +AHA + D+L  A+TLD  I+  + +P
Sbjct: 6   VLVQSIAASLLIASGSTVAAIVTKQQVVEHYADVAHAVFADSLTTAQTLDVKIDEFLKSP 65

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + K LE  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E 
Sbjct: 66  SAKKLEEVKQAWLDSRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAADYQYE- 124

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N    ANI+AN+ + +   ++D+S I+P+L+  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 125 LGNEGAAANIVANTSLQIGASKLDVSKITPELIADLNEVGGSEANVASGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQ 239
           DL       G R YTDF +G  CT GHC RR EYLK  + +LV DLE M K W  D  G 
Sbjct: 185 DLNGTNAGAGQRAYTDFVVGSECTNGHCDRRGEYLKAAADLLVQDLEWMEKQWSADVKGN 244

Query: 240 ATKDLMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
             ++L+ D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YREELLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y  ++G+++ G SI DL++  ++  A+EI  +F  T      L   AE
Sbjct: 305 NEQGIYNVYTGTYKGVSGKELSGPSIADLVAQKDKKAAEEIQKQFDTTRSQVGELVTSAE 364

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
            N + FDQ+I+  N +GN +V + I  L+ QT ++ +    + +   +    +
Sbjct: 365 KNNQHFDQLIAAGNAQGNALVNDTIMSLVAQTGAIERAANIVGIDSLSPDTAD 417


>gi|163735580|ref|ZP_02143012.1| lipoprotein, putative [Roseobacter litoralis Och 149]
 gi|161391200|gb|EDQ15537.1| lipoprotein, putative [Roseobacter litoralis Och 149]
          Length = 419

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 178/402 (44%), Positives = 255/402 (63%), Gaps = 2/402 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           I       +   +         VL NYA IA AKYED+L  A+ L SA++TL+ TP+ + 
Sbjct: 4   ILTTTLGSALLAATPALADKAAVLDNYADIALAKYEDSLTTAQALQSAVDTLIATPSAEA 63

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L+ A+  WI+AR+PYQQSEVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG   +EN 
Sbjct: 64  LQAAKEAWIKARVPYQQSEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGATDENE 123

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLK 185
               N+IAN    ++ + +D + I+P LL   LH A+ +++N+ TGYH IEFLLWGQDL 
Sbjct: 124 YAVLNVIANPSFTLSGETLDATEITPALLEGALHEADAVESNVATGYHAIEFLLWGQDLN 183

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
            +    GNRP+TD+ +G+ CTGG+C RR +YL   +++LVSDL+ M+  W   G A   L
Sbjct: 184 GHGPGAGNRPWTDYAVGDACTGGNCDRRGDYLSAATELLVSDLDWMVAQWQDGGAARTQL 243

Query: 245 MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
             D NAG+++I+TGM SLSY E AGERM LGL+L+DPE+E DCF+DNT+ S+  D +GI 
Sbjct: 244 TADENAGISTILTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFADNTHNSHFYDAMGIR 303

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y G Y R++G  + G S+  L++  +  +  E+  K + TM +   +K  AE   ++D
Sbjct: 304 NVYLGSYTRIDGTVVSGPSLSSLVAAADAGVDAELTAKLNTTMLEMSEMKTAAEAGFAYD 363

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
            M+   N  G  ++   ++ L+ QT S+ +  +AL + +   
Sbjct: 364 MMLERGNEAGEALIMGAVDALVDQTRSIERAVVALGVDQIEF 405


>gi|163761540|ref|ZP_02168612.1| hypothetical protein HPDFL43_21352 [Hoeflea phototrophica DFL-43]
 gi|162281254|gb|EDQ31553.1| hypothetical protein HPDFL43_21352 [Hoeflea phototrophica DFL-43]
          Length = 427

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 196/408 (48%), Positives = 275/408 (67%), Gaps = 3/408 (0%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           Y  ++++    +   A +   +V+ E V+++YA IA AKYED+L  A  LD+AIE  + +
Sbjct: 6   YTKSLLAASTLMVGFAGTAFADVAPEAVIKHYADIAQAKYEDSLATANALDAAIEAFLAS 65

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS-SYGK 120
           P++  L+  +  W+ AR+PYQQ+EVYRFGN IVD W+ +VNAWPLDEG IDYVD+ +YG 
Sbjct: 66  PSEAGLQAVKEAWLAARVPYQQTEVYRFGNAIVDDWEGRVNAWPLDEGLIDYVDAGAYGD 125

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLL 179
           E++EN LYTAN+IAN  I +N + ID S I+P+L+ + L  A GI+ N+ +GYH IEFLL
Sbjct: 126 ESDENTLYTANVIANPSITINGETIDASKITPELISETLQEAGGIEANVASGYHAIEFLL 185

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           WGQDL  N    GNRPYTDF + NC+  HC RR +YL   S +L++DLEEM   W   G 
Sbjct: 186 WGQDLNGNDAGAGNRPYTDFSLENCSNDHCDRRRQYLSAASDLLIADLEEMAANWQEGGA 245

Query: 240 ATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
           A KDLM K ++ GL +I+TGM SLSY ELAGERM LGL+L DPE+E DCFSDNT+ S+L 
Sbjct: 246 ARKDLMDKGVSGGLVTILTGMGSLSYGELAGERMKLGLLLGDPEEEHDCFSDNTHNSHLY 305

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D +GI ++Y G Y R++G ++ G S+ +L++ +  ++  E+      T++    +  RAE
Sbjct: 306 DAVGIRNAYLGTYDRVDGTQLTGPSLSELVASSAPDVDAELKADLDATVEAMEAMASRAE 365

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
             E++DQMI+  N EGN  V+  I+DL+ QT S+ ++  ALDL     
Sbjct: 366 TTEAYDQMIANGNAEGNATVQAAIDDLVKQTRSIERVIAALDLGSIEL 413


>gi|323492413|ref|ZP_08097561.1| iron-regulated protein A precursor [Vibrio brasiliensis LMG 20546]
 gi|323313200|gb|EGA66316.1| iron-regulated protein A precursor [Vibrio brasiliensis LMG 20546]
          Length = 420

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 164/414 (39%), Positives = 241/414 (58%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             +        L +       NV+ E+V+++YA +AHA + D+L  A+ LD +IE+ +  
Sbjct: 5   SLLAQSVAASLLLASGSVFAANVTKEQVVEHYADVAHAVFADSLTTAKALDQSIESFLAN 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P     +  +  W+ +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV S Y  E
Sbjct: 65  PTADKFQQVKQVWLASRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVSSDYQYE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANI+AN+K+ +    +D++ I+P+L+  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIVANTKLTIGASTLDVAKITPELIADLNEVGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--G 238
           QDL       G R YTDF +G  CT G+C RR ++LK  +++LV DLE M K W  D  G
Sbjct: 184 QDLNGTNAGAGARAYTDFVVGEACTNGNCDRRGDFLKAAAELLVQDLEWMEKQWSADVKG 243

Query: 239 QATKDLMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
              ++L+ D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYREELLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G  + G SI+DL++  ++  A+EI  +F  T      L   A
Sbjct: 304 YNEQGIYNVYTGLYKREDGSLLSGPSINDLVAQKDKQAAKEIQKQFDVTRSQVGQLVTSA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+  N +GN +V + I  L+ QT  + +    + +   N    +
Sbjct: 364 EKNNQFFDQLIAAGNTQGNALVNDTIMSLVAQTAQIERAAKIVGITSLNPDTAD 417


>gi|229505149|ref|ZP_04394659.1| iron-regulated protein A precursor [Vibrio cholerae BX 330286]
 gi|229511179|ref|ZP_04400658.1| iron-regulated protein A precursor [Vibrio cholerae B33]
 gi|229518298|ref|ZP_04407742.1| iron-regulated protein A precursor [Vibrio cholerae RC9]
 gi|229608169|ref|YP_002878817.1| iron-regulated protein A precursor [Vibrio cholerae MJ-1236]
 gi|255745660|ref|ZP_05419608.1| iron-regulated protein A precursor [Vibrio cholera CIRS 101]
 gi|262159063|ref|ZP_06030175.1| iron-regulated protein A precursor [Vibrio cholerae INDRE 91/1]
 gi|262169421|ref|ZP_06037113.1| iron-regulated protein A precursor [Vibrio cholerae RC27]
 gi|229345013|gb|EEO09987.1| iron-regulated protein A precursor [Vibrio cholerae RC9]
 gi|229351144|gb|EEO16085.1| iron-regulated protein A precursor [Vibrio cholerae B33]
 gi|229357372|gb|EEO22289.1| iron-regulated protein A precursor [Vibrio cholerae BX 330286]
 gi|229370824|gb|ACQ61247.1| iron-regulated protein A precursor [Vibrio cholerae MJ-1236]
 gi|255736735|gb|EET92132.1| iron-regulated protein A precursor [Vibrio cholera CIRS 101]
 gi|262022234|gb|EEY40943.1| iron-regulated protein A precursor [Vibrio cholerae RC27]
 gi|262029248|gb|EEY47900.1| iron-regulated protein A precursor [Vibrio cholerae INDRE 91/1]
          Length = 420

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 159/414 (38%), Positives = 233/414 (56%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IA+A Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSTILASLTLTTSASFAAAPTQAQVVEHYADIAYAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 364 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPDTAD 417


>gi|319779791|ref|YP_004139267.1| peptidase M75, Imelysin [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317165679|gb|ADV09217.1| Peptidase M75, Imelysin [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 429

 Score =  378 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 195/404 (48%), Positives = 264/404 (65%), Gaps = 2/404 (0%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
              + + T     L       ++ V++ Y+ IA AKYED+L  A+ LD A++ L+ TP+ 
Sbjct: 12  IGATALLTAAVFVLPAKAETDVKAVIKTYSDIALAKYEDSLTTAQALDKAVDALLATPSV 71

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           + L  AR  W  +R+PYQQ+EVYRFGNKIVD W+ KVN+WPLDEG IDYV  SYG E++ 
Sbjct: 72  ETLNAARDAWKASRVPYQQTEVYRFGNKIVDDWEGKVNSWPLDEGLIDYVAKSYGTESDA 131

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQD 183
           N LYTAN+IAN +I +N K++D S +SP+ L   L  A GI+ N+ TGYH IEFLLWGQD
Sbjct: 132 NALYTANVIANKEIEINGKKVDASKLSPEFLSGTLQGAGGIEANVATGYHAIEFLLWGQD 191

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
           L       G RPYTD+D+ NCTGG+C RR EYLK  S +LVSDL+EM+  W  DG A K 
Sbjct: 192 LHGTGPGAGERPYTDYDLKNCTGGNCDRRAEYLKSASDLLVSDLQEMVGNWKEDGAARKA 251

Query: 244 LMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
           L+    +  +++I TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+L D IG
Sbjct: 252 LVDGEPSTAISTIFTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLYDAIG 311

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           I ++Y   Y R++G  + G S+ D++   +  + +E++DK   ++     +K RA   E+
Sbjct: 312 IRAAYHASYTRLDGTIVSGPSVADMVKAADPAIDKELSDKLDVSVAKMEAIKARALAGEA 371

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           +DQ I+E N EGN  V+  I+ LI QT+S+ +   +L L     
Sbjct: 372 YDQQIAEGNIEGNATVQAAIDALIDQTKSIERAVGSLKLSTIAF 415


>gi|229515638|ref|ZP_04405097.1| iron-regulated protein A precursor [Vibrio cholerae TMA 21]
 gi|229347407|gb|EEO12367.1| iron-regulated protein A precursor [Vibrio cholerae TMA 21]
          Length = 420

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 159/414 (38%), Positives = 232/414 (56%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+  R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLATRVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 364 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPDTAD 417


>gi|110678258|ref|YP_681265.1| putative lipoprotein [Roseobacter denitrificans OCh 114]
 gi|109454374|gb|ABG30579.1| lipoprotein, putative [Roseobacter denitrificans OCh 114]
          Length = 408

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 179/402 (44%), Positives = 253/402 (62%), Gaps = 2/402 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           I       +   +         VL NYA IA AKYED+L  A+ L SA++TL+ TP+ + 
Sbjct: 4   ILTTTLGSALLAATPALADKAAVLDNYADIALAKYEDSLTTAQALQSAVDTLIATPSAEA 63

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L+ A+  WIRAR+PYQQSEVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG   + N 
Sbjct: 64  LQAAKEAWIRARVPYQQSEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGATDANE 123

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLK 185
               N+IAN    ++ + +D + I+P LL   LH A+ +++N+ TGYH IEFLLWGQDL 
Sbjct: 124 YAVLNVIANPSFTLSGETLDATQITPALLEGALHEADAVESNVATGYHAIEFLLWGQDLN 183

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
            +    GNRP+TD+ +G  CTGG+C RR +YL   +++LVSDLE M+  W   G A   L
Sbjct: 184 GHGPGAGNRPWTDYAVGEACTGGNCDRRGDYLSAATELLVSDLEWMVAQWQDGGAARTQL 243

Query: 245 MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
           + D NAG+++I+TGM SLSY E AGERM LGL+L+DPE+E DCF+DNT+ S+  D +GI 
Sbjct: 244 IADENAGISAILTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFADNTHNSHFYDAMGIR 303

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y G Y R++G  + G S+  L++  +  +  E+  K + TM +   +K  AE   ++D
Sbjct: 304 NVYLGSYTRIDGTIVSGPSLSSLVAAADAGVDAELTAKLNTTMLEMSEMKTAAEAGFAYD 363

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
            M+   N  G  ++   ++ L+ QT S+ +   AL + +   
Sbjct: 364 MMLERGNAAGEALIMGAVDALVEQTRSIERAVAALGVDQIEF 405


>gi|229525863|ref|ZP_04415268.1| iron-regulated protein A precursor [Vibrio cholerae bv. albensis
           VL426]
 gi|229529656|ref|ZP_04419046.1| iron-regulated protein A precursor [Vibrio cholerae 12129(1)]
 gi|229333430|gb|EEN98916.1| iron-regulated protein A precursor [Vibrio cholerae 12129(1)]
 gi|229339444|gb|EEO04461.1| iron-regulated protein A precursor [Vibrio cholerae bv. albensis
           VL426]
          Length = 420

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 160/414 (38%), Positives = 233/414 (56%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 364 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPDTAD 417


>gi|262189894|ref|ZP_06048216.1| iron-regulated protein A precursor [Vibrio cholerae CT 5369-93]
 gi|262034223|gb|EEY52641.1| iron-regulated protein A precursor [Vibrio cholerae CT 5369-93]
          Length = 420

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 161/414 (38%), Positives = 233/414 (56%), Gaps = 6/414 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + A S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSAILASLTLTTAASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 363

Query: 358 E-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           E N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 364 EKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPDTAD 417


>gi|260462002|ref|ZP_05810247.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032249|gb|EEW33515.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 429

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 197/402 (49%), Positives = 263/402 (65%), Gaps = 2/402 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
            + + T     L        + V+  Y+ IA AKYED+L  A+ LD A++ L+  P+   
Sbjct: 14  ATALLTAAVFVLPAKAQTDAKAVVTTYSDIALAKYEDSLTTAQALDKAVDALLANPSADT 73

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  W  +R+PYQQ+EVYRFGNKIVD W+ KVN+WPLDEG IDYV  SYG E++ N+
Sbjct: 74  LNAARDAWKASRVPYQQTEVYRFGNKIVDDWEGKVNSWPLDEGLIDYVAKSYGTESDANS 133

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLK 185
           LYTAN+IAN +I +N K++D S +SP+ L   L  A G++ N+ TGYH IEFLLWGQDL 
Sbjct: 134 LYTANVIANKEIEINGKKVDASKLSPEFLSGTLQEAGGVEANVATGYHAIEFLLWGQDLH 193

Query: 186 TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM 245
                 G RPYTD+D+ NCTGG+C RR EYLK  S +LVSDL+EM+  W  DG A K L 
Sbjct: 194 GTGPGAGERPYTDYDLKNCTGGNCDRRAEYLKSASTLLVSDLQEMVDDWKADGAARKALA 253

Query: 246 KD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
               N  +++I TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI 
Sbjct: 254 DGEPNTAISTIFTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIR 313

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           ++Y   Y R++G  + G S+H+++   +  + +E++DK   T+     +K RAE  E++D
Sbjct: 314 AAYLASYTRLDGTVVSGPSVHEMVKTADPAIDKELSDKLDVTVAKMEAIKARAEAGEAYD 373

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           Q I+E N EGN  V+  I+ LI QT+S+ +   +L L     
Sbjct: 374 QQIAEGNTEGNATVQAAIDALIDQTKSIERAVGSLKLNAIAF 415


>gi|259416101|ref|ZP_05740021.1| hypothetical protein SCH4B_1473 [Silicibacter sp. TrichCH4B]
 gi|259347540|gb|EEW59317.1| hypothetical protein SCH4B_1473 [Silicibacter sp. TrichCH4B]
          Length = 422

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 184/402 (45%), Positives = 259/402 (64%), Gaps = 4/402 (0%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +T  +I       + +     S   VL NYA IA AKYED+L+ A+ L +A++ L+  P
Sbjct: 5   LLTGAAIAALTVGTSAAFAA--SKADVLTNYANIAEAKYEDSLITAKALQAAVDALIADP 62

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + +NLE A+  W+ AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG   
Sbjct: 63  SAENLEAAKHAWLAARVPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPT 122

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           +EN     N++AN +  ++ K ID S I+P+LL + LH A+G++ N+ TGYH IEFLLWG
Sbjct: 123 DENAAAALNVVANPEFTLSGKTIDASDITPELLAETLHEADGVEANVATGYHAIEFLLWG 182

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDL       G R +TD+  G  CT G+C RR  YLK  + +LVSDLE +   W   G+A
Sbjct: 183 QDLNGTEHGAGERAWTDYAAGESCTNGNCDRRGAYLKAATDLLVSDLEWITAQWAEGGEA 242

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
            + ++ D +AG+ +I+TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D 
Sbjct: 243 RETVLSDEDAGITTILTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDG 302

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +GI + Y GEY+R+NG+ + G ++ DL+   +  L  E+  K S TM     +K  AE  
Sbjct: 303 LGIQNVYLGEYVRVNGDLVSGPALADLVEAADSELNAELTGKLSTTMMKLGRIKTAAEAG 362

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
            S+DQM+++ +  G  +V   ++ L+ QT S+ +   AL+L 
Sbjct: 363 FSYDQMLAQGSDAGEALVMGGVDALVDQTRSIERAVAALELD 404


>gi|261253184|ref|ZP_05945757.1| iron-regulated protein A precursor [Vibrio orientalis CIP 102891]
 gi|260936575|gb|EEX92564.1| iron-regulated protein A precursor [Vibrio orientalis CIP 102891]
          Length = 420

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 164/413 (39%), Positives = 240/413 (58%), Gaps = 6/413 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +        L +       NV+ ++V+++YA +AHA + D++  A+ LD +IE  +  P
Sbjct: 6   LLAQSVAASLLIASGSVFAANVTKDQVVEHYADVAHAVFADSVTTAKALDVSIENFLANP 65

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
                E  +  W+ +R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y  E 
Sbjct: 66  TAAKFEQVKQVWLASRVPYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSADYQYE- 124

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
             N    ANI+AN+++ +   ++D++ I+P L+  L+   G + N+ +GYH IEFLLWGQ
Sbjct: 125 LGNEGANANIVANTELTIGASKLDVAKITPQLIADLNEVGGSEANVASGYHAIEFLLWGQ 184

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQ 239
           DL       G R YTDF +G  CT GHC RR ++LK  +++LV DLE M   W  D  G 
Sbjct: 185 DLNGTNAGAGQRAYTDFVVGAECTNGHCDRRGDFLKAAAELLVQDLEWMENQWSADVKGN 244

Query: 240 ATKDLMKD-INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
             ++L+ D  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  
Sbjct: 245 YREELLNDSADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYY 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  GI + YTG Y R +G  + G SIHDL+S N++  AQEI  +F  T      L   AE
Sbjct: 305 NEQGIYNVYTGLYKREDGTLLSGPSIHDLVSQNDKQAAQEIQKQFDMTRSQVGQLVTSAE 364

Query: 359 -NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
            N + FDQ+I+  N +GN +V + I  L+ QT  + +    + +   N    +
Sbjct: 365 KNNQYFDQLIAAGNTQGNALVNDTIMSLVAQTVQIERAAKIVGITSLNPDTAD 417


>gi|89073973|ref|ZP_01160479.1| hypothetical protein SKA34_15425 [Photobacterium sp. SKA34]
 gi|89050301|gb|EAR55805.1| hypothetical protein SKA34_15425 [Photobacterium sp. SKA34]
          Length = 417

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 166/408 (40%), Positives = 240/408 (58%), Gaps = 6/408 (1%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           +++        ++    + ++V+ +YA +AH  Y DAL  A+ LD AI  LV  P++K L
Sbjct: 8   TLIAAAIFTLPTVTQAATKQEVVTHYADLAHNVYSDALTTAKDLDKAIAALVANPSEKTL 67

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
             AR+ W  +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N  
Sbjct: 68  SAARIAWKASRVPYQQSEVFRFGNGIVDDWEGQLNAWPLDEGLIDYVANDYQHE-LGNEG 126

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
             ANI+A++ + V  KEID++ I+P+L+  L+   G + N+ +GYH IEFLLWGQDL   
Sbjct: 127 AKANIVASNTLNVGNKEIDVTKITPELIAGLNELGGSEANVASGYHAIEFLLWGQDLNGT 186

Query: 188 VREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKD 243
               G+R +TDF  G  CT G+C RR EYL   S++L++DL+ M K W         ++ 
Sbjct: 187 KSGAGDRKFTDFVKGEACTNGNCDRRAEYLTASSQLLINDLQWMEKQWSATEAKNYRSEL 246

Query: 244 LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           L +  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI
Sbjct: 247 LAESADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGI 306

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIES 362
            + YTG Y R NGE + G SI+DL++  ++  A EI  +F  T      L D AE + + 
Sbjct: 307 YNVYTGTYTRTNGEVLTGPSINDLVAAQDKKAAAEIKAEFDKTRAQLQTLVDSAEKDNQH 366

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           FDQ+I+ +N  G+ +V   I  L+ QT  + K    + +   N    +
Sbjct: 367 FDQLIATDNKAGHALVNKSIMALVQQTAEIEKAASIIGVSNLNPDTAD 414


>gi|87122310|ref|ZP_01078192.1| hypothetical protein MED121_03527 [Marinomonas sp. MED121]
 gi|86162453|gb|EAQ63736.1| hypothetical protein MED121_03527 [Marinomonas sp. MED121]
          Length = 427

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 175/403 (43%), Positives = 258/403 (64%), Gaps = 1/403 (0%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
              +++    S  +     ++   V+ NY+ IAHA Y D+L  A++L  A++  +  P +
Sbjct: 12  VAATLLTACGSQGVQPNKAITANDVVVNYSDIAHAIYTDSLTTAQSLKVAVDAFIANPTE 71

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
             L NAR  WI +R+PYQQSEVYRFGN IVD W+ KVNAWPLDEG IDYV + YG +++ 
Sbjct: 72  ATLANARQAWIDSRVPYQQSEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVATDYGTDSDV 131

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
           N LYTAN++A++ + +  + +D S I+P LL +LH A+ ++ N+ TGYH IEFLLWGQDL
Sbjct: 132 NPLYTANVVASTSLTIAGQAVDTSNITPSLLEELHEADEVEANVATGYHAIEFLLWGQDL 191

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
                  G RP TD+D+ NCTGG+C RR  YL   + +L++DLEEM   WG +G+A + +
Sbjct: 192 NGTNPGAGERPATDYDVNNCTGGNCDRRAAYLVAATDLLITDLEEMAANWGANGEARQAI 251

Query: 245 M-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           + +    GL +I+TGM SL+Y EL GER  LGL+LHDPE+E DCFSDNT+ S+  D  GI
Sbjct: 252 LDQGDKQGLATILTGMGSLAYGELGGERTKLGLMLHDPEEEHDCFSDNTHYSHFYDAKGI 311

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESF 363
            + Y GEY R++G  + GAS+  L+S  +  L  E+  K  NT +    + D A+  ++F
Sbjct: 312 QNVYLGEYQRVDGSWVKGASLSALVSAQDSILDAEMKGKLENTQEAGQAMVDAAKVGQTF 371

Query: 364 DQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           D +I+  N  GN++V++ ++ L+ +T +  +I   L+L +   
Sbjct: 372 DVLIAMGNQAGNQLVQDFVDSLVAETRTTEEIIRLLELEDITL 414


>gi|260768288|ref|ZP_05877222.1| iron-regulated protein A precursor [Vibrio furnissii CIP 102972]
 gi|260616318|gb|EEX41503.1| iron-regulated protein A precursor [Vibrio furnissii CIP 102972]
 gi|315179995|gb|ADT86909.1| Uncharacterized iron-regulated protein [Vibrio furnissii NCTC
           11218]
          Length = 419

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 162/392 (41%), Positives = 230/392 (58%), Gaps = 6/392 (1%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V+ ++V+ +YA IAHA + D+L  A+ L+ +I++ +  P++  L+  +  WI AR+PYQQ
Sbjct: 26  VTQDQVVAHYADIAHAVFSDSLTTAKNLEKSIDSFLAAPSEAKLQQVKQAWITARVPYQQ 85

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           SEV+RFGN +VD W+ ++NAWPLDEG IDYV   Y  E   N   +ANI+ N+ I +   
Sbjct: 86  SEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVSDDYQYE-LGNEGASANIVGNASITIGAT 144

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
            ID S I+P+L+  L+   G + N+ +GYH IEFLLWGQDL       G RPYTD+  G+
Sbjct: 145 TIDASKITPELIASLNEVGGSEANVASGYHAIEFLLWGQDLHGTQAGAGERPYTDYAQGD 204

Query: 204 -CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP---DGQATKDLMKDINAGLNSIITGM 259
            CT G+C RR +YLK  +++LV DLE M K W            L      GL  ++ GM
Sbjct: 205 ACTHGNCDRRAQYLKASAQLLVQDLEWMEKQWSEKEKGNYREALLTDSSTNGLRKMLFGM 264

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            SLS  ELAGERM + L  +  E E DCFSDNT+ S+  D  GI + YTG Y R +G  +
Sbjct: 265 GSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYDEQGIYNIYTGTYTRADGSTL 324

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIV 378
            GASI+DL++  +   A+EI  +F         L + AE N + FDQ+I+ +N  GN +V
Sbjct: 325 TGASIYDLVAQKDDVAAKEIMKQFDAARAQVGELVNSAEKNNQHFDQLIAADNKAGNALV 384

Query: 379 RNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
              I  L+ QT S+ +    + +   N    +
Sbjct: 385 NKAIMALVAQTASIERAANVIGIDNLNPDTAD 416


>gi|150398713|ref|YP_001329180.1| putative iron-regulated protein [Sinorhizobium medicae WSM419]
 gi|150030228|gb|ABR62345.1| putative iron-regulated protein [Sinorhizobium medicae WSM419]
          Length = 426

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 200/408 (49%), Positives = 277/408 (67%), Gaps = 4/408 (0%)

Query: 3   FITIISIVFTLPSHALS---IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLV 59
           FI   ++     + AL+            V+++YA +AHAKYEDAL  A  LD A++ L+
Sbjct: 5   FIRTAALALMTATSALALQPANAAPDAAAVVKHYAAVAHAKYEDALTTAEALDKAVDALI 64

Query: 60  TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYG 119
            +P+++ L+ AR  W++AR PYQ++EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG
Sbjct: 65  ASPSEETLKAAREAWLKARNPYQETEVYRFGNTIVDEWEGKVNAWPLDEGLIDYVDASYG 124

Query: 120 KENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFL 178
            E++EN L+TAN+IAN  + ++ +++D + I+P+L+   L  A GI+ N+ TGYH IEFL
Sbjct: 125 TESDENALFTANVIANKVLKIDGQDVDATSITPELISGTLQEAGGIEANVATGYHAIEFL 184

Query: 179 LWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           LWGQDL       GNR YTDFD   CT G+C RR  YLK  + +LV+DL+EM+  W PDG
Sbjct: 185 LWGQDLNGTGPGAGNRSYTDFDTEACTNGNCDRRAAYLKAATSLLVADLKEMVANWTPDG 244

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            ATK +  D  AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+L+
Sbjct: 245 AATKAVEADPKAGLVAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTHNSHLH 304

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D IGI S+Y+GEY R++G K+ G S+ +L+   +  L +E+ D    T++    +  RAE
Sbjct: 305 DAIGIQSAYSGEYTRVDGGKLTGPSLSELVGAKDAALDKEMKDNLGATVEKMQAMAKRAE 364

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
            +E++DQMI E N EGN  V+  I+ LI Q +++ ++  AL+L     
Sbjct: 365 TVEAYDQMIGEGNAEGNATVQAAIDGLIAQAKTVERVIAALELGTVEL 412


>gi|163857778|ref|YP_001632076.1| hypothetical protein Bpet3465 [Bordetella petrii DSM 12804]
 gi|163261506|emb|CAP43808.1| putative exported protein [Bordetella petrii]
          Length = 432

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 195/392 (49%), Positives = 265/392 (67%), Gaps = 13/392 (3%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
             + V+Q YA IA A YED+L  A+ L +A+E L+  P+ + L+ AR  W+ AR+PYQQ+
Sbjct: 24  EPKAVVQTYADIALAGYEDSLASAQALRAAVEALIEQPSAQTLQAARAAWLAARVPYQQT 83

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           E +RFGN +VD W+  VNAWPLDEG IDYVD+SYG E+++N  Y  N+IANSKI V  K 
Sbjct: 84  EAFRFGNPVVDDWEGSVNAWPLDEGLIDYVDASYGTESDQNAFYAVNVIANSKISVGGKT 143

Query: 145 IDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE------------P 191
           ID + I+P+LL + LH A+G + N+ TGYH IEFLLWGQDL  +                
Sbjct: 144 IDATTITPELLAETLHEADGNEANVATGYHAIEFLLWGQDLNGSGPAPADRQGTPQERHA 203

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
           GNRP+TDFD   CTGGHC RRV+YL+ V+ +LV+DLE M+  W  DGQA K + +D  AG
Sbjct: 204 GNRPHTDFDPAQCTGGHCERRVQYLRAVTDLLVADLETMVANWKADGQARKAVEQDPKAG 263

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L +++TG+ SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  + IGI + Y G Y
Sbjct: 264 LVAMLTGLGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHFYNQIGIRNVYLGSY 323

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENN 371
            R+NG+ + GAS+ DL+   +  L  E+  K   T+     ++DRA+ +E++DQMI+  N
Sbjct: 324 ARINGKTVAGASVSDLVKARDPKLDAEMRAKLDATVAAMQAMRDRADKVETYDQMIASGN 383

Query: 372 PEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
            EGN +V+  I+ L+ QT SL ++   L+L E
Sbjct: 384 AEGNAVVQAAIDRLVDQTRSLERVIAVLELGE 415


>gi|323497652|ref|ZP_08102669.1| uncharacterized iron-regulated protein [Vibrio sinaloensis DSM
           21326]
 gi|323317401|gb|EGA70395.1| uncharacterized iron-regulated protein [Vibrio sinaloensis DSM
           21326]
          Length = 420

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 159/393 (40%), Positives = 229/393 (58%), Gaps = 6/393 (1%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
            V+ E+V+++YA +AHA +ED+L+ A+ L+  IE+ +  P+    E  +  W+ +R+PYQ
Sbjct: 26  KVTQEQVVEHYADVAHAVFEDSLVTAKQLEKTIESFLAAPSAAKFEEVKQAWLESRVPYQ 85

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNE 142
           QSEV+RFGN IVD W+ ++NAWPLDEG IDYV + Y  E   N   +ANI+AN ++ +  
Sbjct: 86  QSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVSADYQYE-LGNEGASANIVANKQLKIGA 144

Query: 143 KEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG 202
             +D++ ++P  +  L+   G + N+ +GYH IEFLLWGQDL       G R YTDF +G
Sbjct: 145 TTLDVAELTPAAIADLNEVGGSEANVASGYHAIEFLLWGQDLNGTSAGAGQRAYTDFVVG 204

Query: 203 -NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITG 258
             CT G+C RR EYLK  +++LV DLE M K W          + L      GL  ++ G
Sbjct: 205 AECTNGNCDRRGEYLKATAELLVQDLEWMEKQWSADEKGNYRAELLADSAENGLRKMLFG 264

Query: 259 MTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEK 318
           M SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG Y R +G  
Sbjct: 265 MGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNVYTGLYKRQDGTL 324

Query: 319 IHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN-IESFDQMISENNPEGNKI 377
           + G SI+DL++  ++  AQEI  +F  T      L   AE   E FDQ+I+  N +GN +
Sbjct: 325 VSGPSINDLVAQKDKQAAQEIQKQFDTTRAQVGQLVTSAEKEGEFFDQLIASGNAKGNAL 384

Query: 378 VRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           V   I  L+ QT  + +    + +   N    +
Sbjct: 385 VNETIMSLVAQTTQIERAAKIVGINSLNPDTAD 417


>gi|149377143|ref|ZP_01894892.1| iron-regulated protein A, putative [Marinobacter algicola DG893]
 gi|149358561|gb|EDM47034.1| iron-regulated protein A, putative [Marinobacter algicola DG893]
          Length = 442

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 154/404 (38%), Positives = 238/404 (58%), Gaps = 7/404 (1%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           +   +  +   +    ++   V+++YA +AHA +EDAL  A++LDS ++T + +P ++NL
Sbjct: 30  TASTSSSTEEPAAAEAITKSDVVEHYADLAHANFEDALTAAQSLDSTVDTFLESPTEENL 89

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           + A+  W+ +R+PYQQ+EV+RFGN +VD W+ ++NAWPLDEG IDYV     +    N  
Sbjct: 90  QKAKQAWLASRVPYQQTEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVKEDGYQYELGNEG 149

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
            TANIIA+ +I +    +D S ++P+LL +L+   G + N+ TGYH IEFLLWGQDL   
Sbjct: 150 ATANIIASPEINIGGTTVDASSLTPELLAELNEIGGSEANVATGYHAIEFLLWGQDLHGF 209

Query: 188 VREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPDGQATKD 243
            R  G RP TD+  G  CT G+C RR  YL   + +L++DLE M+  W     D   ++ 
Sbjct: 210 DRGAGQRPATDYAQGEECTHGNCDRRAAYLDAATDLLITDLEWMVAQWAPGQEDNYRSQL 269

Query: 244 LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGI 303
           L +  +A +  +  GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  G+
Sbjct: 270 LAEAPDAAIQKMFFGMGSLSLGELAGERMKVALEANSYEDEHDCFSDNTHNSHYYNGQGV 329

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI--- 360
            + Y+G Y R++G ++ G S+ D+++  N  L + ++ +F ++M     +K  AE     
Sbjct: 330 ANIYSGSYTRIDGSELTGPSLSDMVAELNPELDETLSQQFEDSMDALQTMKSSAEAESEP 389

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEP 404
             FD MI+  N +G KIV   I  L+ QT S+ +    L +   
Sbjct: 390 MKFDMMIAPGNEKGAKIVNGAIMALVAQTGSIEQAARELGIDSL 433


>gi|311695455|gb|ADP98328.1| lipoprotein [marine bacterium HP15]
          Length = 428

 Score =  375 bits (962), Expect = e-102,   Method: Composition-based stats.
 Identities = 167/414 (40%), Positives = 241/414 (58%), Gaps = 9/414 (2%)

Query: 1   MYFITIISIVFTLPSHALSIVPN--VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETL 58
           +       +     +H  S   +   +   V+ +YA +AHA YEDAL+ AR LD A + L
Sbjct: 7   LALTVTALLTAGCANHPWSTKDHQPATKNSVVDHYADLAHANYEDALITARALDEATDRL 66

Query: 59  VTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSY 118
           +  P + NL  A+  W+ AR+PYQQ+EV+RFGN IVD W+ ++NAWPLDEG IDYV +  
Sbjct: 67  IANPTEANLATAKEAWLAARVPYQQTEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVKADG 126

Query: 119 GKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFL 178
            +    N   TANIIA+++I V  + ++++ +SP LL  L+   G + N+ TGYH +EFL
Sbjct: 127 YQHELGNAGATANIIASNRINVGGETLNVASLSPALLADLNEVGGSEANVATGYHAVEFL 186

Query: 179 LWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD 237
           LWGQDL       G RP TD+  G +CT G+C RR EYL  V+ +LVSDLE M+  W P 
Sbjct: 187 LWGQDLHGFESGAGERPVTDYAKGADCTNGNCERRGEYLDAVTDLLVSDLEWMVAQWAPG 246

Query: 238 ---GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYA 294
                  +    D N G+  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ 
Sbjct: 247 ASDNYRAQLTAADANQGVQKMLFGMGSLSLGELAGERMKVALEANSYEDEHDCFSDNTHN 306

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
           S+  +  GI + YTG Y R++G  + G S+ DL+  ++  L   +N++   +M+   ++K
Sbjct: 307 SHYYNGQGIQNVYTGTYRRVDGSLVTGPSLSDLVQQSDPELDARLNNQLDASMEALALMK 366

Query: 355 DRAENIE---SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
            RAE+ E   +FD MI+  N EG +IV   I  L+ QT S+ +    L +   +
Sbjct: 367 ARAESSENPMAFDTMIAPGNAEGTRIVNGAIMALVAQTGSIEQAARDLGIEALS 420


>gi|330445729|ref|ZP_08309381.1| imelysin family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489920|dbj|GAA03878.1| imelysin family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 418

 Score =  375 bits (962), Expect = e-102,   Method: Composition-based stats.
 Identities = 173/411 (42%), Positives = 241/411 (58%), Gaps = 9/411 (2%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            +   +F+LP+ A +     + + V+ +YA +AH+ Y DAL  A+TLD AI  LV  P++
Sbjct: 9   LVAVALFSLPAVAQAAT---TKQDVVTHYADLAHSVYSDALTTAQTLDKAIAALVANPSE 65

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           + L  AR  W  +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  E   
Sbjct: 66  QTLSAAREAWKASRVPYQQSEVFRFGNGIVDDWEGQLNAWPLDEGLIDYVAKDYQHE-LG 124

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
           N    ANII+N KI V  KEID++ I+P+L+  L+   G + N+ +GYH IEFLLWGQDL
Sbjct: 125 NEGANANIISNKKINVGNKEIDVAKITPELIADLNELGGSEANVASGYHAIEFLLWGQDL 184

Query: 185 KTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQA 240
                  G+R +TDF  G  CT G+C RR +YL   S++L++DL+ M K W         
Sbjct: 185 NGTGSGAGDRKFTDFVKGEACTNGNCDRRSDYLTASSQLLINDLQWMEKQWSATEAKNYR 244

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
           ++ L +  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  + 
Sbjct: 245 SELLAESADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNE 304

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-N 359
            GI + YTG Y R+NGE + G SIHDL++  +   A EI  +F         L D AE +
Sbjct: 305 QGIFNVYTGSYTRVNGEVLTGPSIHDLVAAKDEKAAAEIKAEFVQARAQLQTLVDSAEKD 364

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
            + FDQ+I+  N  GN +V   I  L+ QT  + K    + +   N    +
Sbjct: 365 NQHFDQLIAAGNKAGNALVNKSIMALVKQTAEIEKAASIIGVSNLNPDTAD 415


>gi|254460033|ref|ZP_05073449.1| insulin-cleaving metalloproteinase outer membrane [Rhodobacterales
           bacterium HTCC2083]
 gi|206676622|gb|EDZ41109.1| insulin-cleaving metalloproteinase outer membrane [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 420

 Score =  375 bits (962), Expect = e-102,   Method: Composition-based stats.
 Identities = 176/406 (43%), Positives = 260/406 (64%), Gaps = 6/406 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +T  ++V  L + A +    V    VL  YA IA AKY D+L  A+TL +A+  L+  P
Sbjct: 5   ILTTTALVTALSTSAFA----VEKADVLGTYADIAAAKYGDSLTTAQTLQAAVNALIANP 60

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +   L+ A+  W+ AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  +
Sbjct: 61  SADALQAAKTAWLAARVPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPS 120

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           +EN     N++AN+   ++ +E+D + I+  LL + L  A+G++ N+ TGYH IEFLLWG
Sbjct: 121 DENEFAALNVVANASFTLSGREVDANEINSALLEETLQEADGVEANVATGYHAIEFLLWG 180

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDL  +    GNRP+TD+  G+ CT  +C RR EYL   + +LVSDLE M   W   G A
Sbjct: 181 QDLNGHGAGAGNRPWTDYAAGHACTNDNCDRRGEYLTAATDLLVSDLEWMTAQWAAGGAA 240

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
             +L ++ +AG+ +++TGM SLSY E+AGERM LG++L+DPE+E  CF+DNT+  + +D 
Sbjct: 241 RTELNRNEDAGIAAVLTGMGSLSYGEVAGERMRLGVMLNDPEEEHSCFADNTHNDHYHDG 300

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +G+ ++Y GEY+R++G  + GAS+ D+++  + +L  E+  K S TMK    +K  AE  
Sbjct: 301 LGVQNAYLGEYVRIDGSVVSGASLSDMVAATDVSLDTEMRAKLSATMKALGRIKTTAEAG 360

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
            ++DQM+   N  G  ++   +N  I QT S+ ++  AL L +   
Sbjct: 361 FAYDQMLERGNEAGEAVIMGGVNGFIDQTRSIERVVSALGLDQIAF 406


>gi|229521377|ref|ZP_04410796.1| iron-regulated protein A precursor [Vibrio cholerae TM 11079-80]
 gi|229341475|gb|EEO06478.1| iron-regulated protein A precursor [Vibrio cholerae TM 11079-80]
          Length = 420

 Score =  375 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 160/401 (39%), Positives = 230/401 (57%), Gaps = 6/401 (1%)

Query: 15  SHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
           + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  P  + LE  +  W
Sbjct: 18  TTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQAPTAQGLEEVKQAW 77

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           + AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E   N    ANIIA
Sbjct: 78  LAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE-LGNEGANANIIA 136

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNR 194
           N+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G R
Sbjct: 137 NTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWGQDLNGTKAGAGAR 196

Query: 195 PYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPDGQATKDLMKDINA 250
            YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D    + L +    
Sbjct: 197 SYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKDNYRQQLLSESAEN 256

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
           GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG 
Sbjct: 257 GLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNIYTGS 316

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISE 369
           Y R +G ++ G S++ L++  + N A+EI  +F         L   AE N + FDQ+I+ 
Sbjct: 317 YTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAAEKNNQHFDQLIAA 376

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           +N  G+ I+   I  L+ QT S+ +    + +   N    +
Sbjct: 377 DNAAGHAIINQAIMALVAQTGSIERAAGIIGIDNLNPDTAD 417


>gi|83944208|ref|ZP_00956664.1| lipoprotein, putative [Sulfitobacter sp. EE-36]
 gi|83845075|gb|EAP82956.1| lipoprotein, putative [Sulfitobacter sp. EE-36]
          Length = 419

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 172/402 (42%), Positives = 250/402 (62%), Gaps = 6/402 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +    +  TL S AL+    V   +V+  YA IA A Y D+L+ A+ L  A++ L+  P+
Sbjct: 5   LMTSVLALTLASPALA----VEKSEVIDTYADIAEAAYGDSLITAQALVDAVDALIAEPS 60

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
              ++ AR  W+ AR+PYQQ+E YRFGN IVD W+ K+NAWPLDEG IDYVD+SYG   +
Sbjct: 61  ADTMQAARTAWLAARVPYQQTEAYRFGNPIVDDWEGKLNAWPLDEGLIDYVDASYGGATD 120

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN     N+IAN    ++  E+D S I+PD L + LH A+G + N+ +GYH +EFLLWGQ
Sbjct: 121 ENAAAALNVIANPTFTLSGTEVDASTITPDFLAETLHEADGNEANVASGYHAVEFLLWGQ 180

Query: 183 DLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           DL       G R +TD+  G +CT  +C RR +YLK  + ++V+DLE M+  W   G A 
Sbjct: 181 DLNGTEHGAGGRDWTDYATGEDCTNDNCDRRGQYLKAAADLIVTDLEYMVAQWAEGGAAR 240

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
            +L  + +  +++++TGM SLSY ELAGERM LGL+L+DPE+E DCFSDNT+ S+  D +
Sbjct: 241 TNLTDNEDGAISAMLTGMGSLSYGELAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGL 300

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y G Y R +G  + G S+ DL++  N +L  E+    S TM+    +K  AE   
Sbjct: 301 GIQNVYLGAYARTDGTLVTGPSLSDLVAAENADLDAEMQLNLSTTMRKLGQIKTAAEAGM 360

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           S+DQM++  N  G  +V   +N LI QT+++ ++   L + +
Sbjct: 361 SYDQMMARGNKGGEALVMGGVNALIAQTKTIERVVATLGVDD 402


>gi|126727963|ref|ZP_01743787.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2150]
 gi|126702766|gb|EBA01875.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2150]
          Length = 419

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 178/403 (44%), Positives = 257/403 (63%), Gaps = 6/403 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           +++   +I   L + AL+    V    VL  YA IA A Y D+L+ A+ L +A+  LV  
Sbjct: 3   HYLLTTAIAVGLATPALA----VETTDVLDTYADIAAANYGDSLITAQRLQTAVNALVAD 58

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ +NL  AR  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  
Sbjct: 59  PSAENLTAARAAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGP 118

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
           ++EN     N+IAN    ++ ++ID + I+P LL   L  A+G++ N+ TGYH IEFLLW
Sbjct: 119 SDENAFAALNVIANPTFTLSGQDIDATSITPALLEDTLQEADGVEANVATGYHAIEFLLW 178

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GQDL  +    G+RP+TD+ +G+ CT G+C RR EYL   + +L+SDLE M  AW   G+
Sbjct: 179 GQDLNGHGTGAGDRPWTDYAMGDDCTNGNCDRRGEYLTAATDLLISDLEYMAGAWADGGE 238

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
           A  +LM D + G+++I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  +
Sbjct: 239 ARTELMSDADVGISAILTGMGSLSYGETAGERMRLGVMLNDPEEEHSCFADNTHNDHYYN 298

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
            +GI + Y GEYIR++G  I G S+ DL++  +  L  E+  K  + +     +K  AE 
Sbjct: 299 GVGIQNVYLGEYIRVDGSLITGPSLSDLVAETDAALDAEMQGKLGDAVMALGRIKIAAEA 358

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
             ++DQM+   N  G  ++   +N LI QT S+ ++  AL + 
Sbjct: 359 GFAYDQMLERGNEAGEALIMGGVNGLIDQTRSIERVITALGVD 401


>gi|254466477|ref|ZP_05079888.1| insulin-cleaving metalloproteinase outer membrane protein
           [Rhodobacterales bacterium Y4I]
 gi|206687385|gb|EDZ47867.1| insulin-cleaving metalloproteinase outer membrane protein
           [Rhodobacterales bacterium Y4I]
          Length = 422

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 190/403 (47%), Positives = 261/403 (64%), Gaps = 3/403 (0%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
                 + +  L   A + +       VL NYA IA AKY+D+L  A+ L +A++ LV  
Sbjct: 3   SLFLAGTALAGLTFGASAALA-AEKSAVLTNYANIAEAKYQDSLTTAQALKAAVDALVAQ 61

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ +NL+ AR  WI AR+PYQQSEV+RFGN IVD W+ KVNAWPLDEG IDYVD++YG  
Sbjct: 62  PSAENLQAARAAWIAARVPYQQSEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDAAYGGP 121

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLW 180
            EEN L   N+IAN    ++ K +D + I+P+LL   LH A+GI+ N+ TGYH IEFLLW
Sbjct: 122 TEENTLAALNVIANPSFELSGKAVDAARITPELLESTLHEADGIEANVATGYHAIEFLLW 181

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GQDL       G RP+TD+  G+ CT G+C RR +YL+  + +L+SDLE M   WG +G 
Sbjct: 182 GQDLNGTGHGAGERPWTDYAQGDACTNGNCGRRGDYLQAATDLLISDLEWMAAQWGAEGD 241

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
           A   L+ D  AG+ +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D
Sbjct: 242 ARTALLADEYAGITAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYD 301

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
            +G+ + Y GEY+R+NGE + G S+ DL++  +  L  E+  K ++TM     +K  AE 
Sbjct: 302 GLGVQNVYLGEYVRVNGELVSGPSLSDLVAEKDAELDTEMRGKLADTMLALGRIKTAAEA 361

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
             S+DQM+++ N  G  +V   +N LI QT S+ ++  ALDL 
Sbjct: 362 GLSYDQMLAQGNAAGEALVMGGVNGLIGQTRSIERVVTALDLD 404


>gi|261211007|ref|ZP_05925297.1| iron-regulated protein A precursor [Vibrio sp. RC341]
 gi|260839982|gb|EEX66582.1| iron-regulated protein A precursor [Vibrio sp. RC341]
          Length = 420

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 154/391 (39%), Positives = 227/391 (58%), Gaps = 6/391 (1%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
           +  +V+++YA IAHA Y D+ + A+ L  +I+  +  P  K L++ +  W+ AR+PYQQS
Sbjct: 28  TQTQVVEHYADIAHAVYADSRVTAQQLQKSIDRFLQKPTAKGLDDVKQAWLAARVPYQQS 87

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           EV+RFGN IVD W+ ++NAWPLDEG IDYV  +Y  E   N    ANI+AN+ + +    
Sbjct: 88  EVFRFGNTIVDDWEGQLNAWPLDEGLIDYVAGTYQHE-LGNAGANANIVANTSLTIGANN 146

Query: 145 IDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-N 203
           ID+  I+P+LL  L+   G + N+ +GYH IEFLLWGQDL       G R YTD+  G  
Sbjct: 147 IDVQEITPELLASLNEIGGSEANVASGYHAIEFLLWGQDLNGTKAGAGTRSYTDYLQGKE 206

Query: 204 CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPDGQATKDLMKDINAGLNSIITGMT 260
           CT G+C RR +YL   +++LV+DLE M K W          + L +    GL  ++ GM 
Sbjct: 207 CTNGNCDRRAQYLNAAAQLLVTDLEWMEKQWANGEKGNYRQQLLSESSENGLRKMLFGMG 266

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
           SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + +TG Y R +G ++ 
Sbjct: 267 SLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQGIYNIFTGTYTRADGSELK 326

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIVR 379
           G S++ L++  + + A+EI  +F         L   AE N + FDQ+I+ +N  G+ I+ 
Sbjct: 327 GPSLYALVAEKDASAAKEILQQFETARTQVGELVTLAEKNNQHFDQLIAADNTAGHAIIN 386

Query: 380 NLINDLITQTESLRKIRIALDLIEPNRVIGN 410
             I  L+ QT S+ +    + +   N    +
Sbjct: 387 QAIMALVVQTGSIERAAGIIGIDNLNPDTAD 417


>gi|254511799|ref|ZP_05123866.1| insulin-cleaving metalloproteinase outer membrane protein
           [Rhodobacteraceae bacterium KLH11]
 gi|221535510|gb|EEE38498.1| insulin-cleaving metalloproteinase outer membrane protein
           [Rhodobacteraceae bacterium KLH11]
          Length = 422

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 189/408 (46%), Positives = 258/408 (63%), Gaps = 2/408 (0%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M  +   +   TL   + +I    S   VL  YA IA AKY+D+L+ A+ L +A+ TL+ 
Sbjct: 1   MTRLFAATSALTLCIASAAIADAPSKADVLNTYANIAEAKYDDSLIAAKRLQAAVNTLIA 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P+   L  AR  W+ AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG 
Sbjct: 61  DPSDATLNAARAAWVAARVPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGG 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLL 179
            ++EN     N+IAN    ++ + ID S I+P+LL   LH A+GI+ N+ TGYH IEFLL
Sbjct: 121 PSDENEFAVLNVIANPSFELSGQTIDASDITPELLSGTLHEADGIEANVATGYHAIEFLL 180

Query: 180 WGQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           WGQDL  +    GNRPYTD+  G+ CTGG+C RR +YL   + +LVSDLE M   W   G
Sbjct: 181 WGQDLNGHNAGAGNRPYTDYVQGDGCTGGNCDRRAQYLSAATDLLVSDLEWMTSQWSEGG 240

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            A   L  D +AG+++I+TGM SLSY E AGERM LGL+L+DPE+E DCF+DNT+ S+  
Sbjct: 241 DARAALTADESAGVSAILTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFADNTHNSHYY 300

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D +GI + Y G Y R++G  + GAS+ DL+   +  L  E+  K + TMK    +K  AE
Sbjct: 301 DGLGIQNVYLGNYTRIDGTPVSGASLSDLVLATDPALDTEMKAKLAATMKALGNIKSTAE 360

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
              ++DQM+   N  G  ++   +N L+ QT+++ +I   LDL +   
Sbjct: 361 AGFAYDQMLERGNEAGEALIMGGVNGLVDQTKTIERIVTVLDLNQIEF 408


>gi|209695263|ref|YP_002263192.1| putative iron-regulated protein [Aliivibrio salmonicida LFI1238]
 gi|208009215|emb|CAQ79471.1| putative iron-regulated protein [Aliivibrio salmonicida LFI1238]
          Length = 417

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 169/410 (41%), Positives = 242/410 (59%), Gaps = 9/410 (2%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            + + +F LP+ + +     +  +V+++YA IAHA Y DAL  A++LD+ +   +  P++
Sbjct: 10  LLTASLFVLPTFSYAA----TQSEVVEHYADIAHAVYSDALTTAQSLDTTLNAFLANPSE 65

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           K LE A++ W  AR+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV   Y  E   
Sbjct: 66  KTLEQAKIAWKAARVPYQQSEVFRFGNPVVDDWEGQLNAWPLDEGLIDYVADDYQYE-LG 124

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
           N+   ANI+++  I +  + ID++ I  D L  L+   G + N+ TGYH IEFLLWGQDL
Sbjct: 125 NDGAKANIVSSKSIKIGAETIDVTNIKADHLAALNELGGSEANVATGYHAIEFLLWGQDL 184

Query: 185 KTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQAT 241
                  G RPYTD+ IG+ CT G+C RR EYLK  S++L+SDL  M K W         
Sbjct: 185 NGTNAGAGERPYTDYAIGSACTNGNCERRAEYLKAASELLISDLSWMEKQWKEGETNYRA 244

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
           + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  
Sbjct: 245 ELLEESSKQGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHYYNEQ 304

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA-ENI 360
           GI + YTG Y R +G  + G SIH+L++  ++  A+EI  +F    +    L   A EN 
Sbjct: 305 GIYNVYTGTYKRTDGTILAGPSIHELVAQKDKQAAKEIQQQFDQAREQVKTLVISAEENN 364

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           + FDQ+I+ NN  GN +V   I  L+TQT S+ +    + +   N    +
Sbjct: 365 QHFDQLIAANNAAGNALVNQSIMALVTQTASIERAANIIGITSLNPDTAD 414


>gi|227824161|ref|YP_002828134.1| hypothetical protein NGR_c36600 [Sinorhizobium fredii NGR234]
 gi|227343163|gb|ACP27381.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 426

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 193/379 (50%), Positives = 264/379 (69%), Gaps = 1/379 (0%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           V+++YA +AHAKYEDAL  A  LD A++ L+  P+++ L+ AR  W++AR PYQ++EVYR
Sbjct: 34  VVKHYAAVAHAKYEDALTTAEALDKAVDALIAGPSEETLKAARDAWLKARNPYQETEVYR 93

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           FGN IVD W+ KVNAWPLDEG IDYVD SYG E++EN L+TAN+IAN  I ++ K++D +
Sbjct: 94  FGNAIVDEWEGKVNAWPLDEGLIDYVDPSYGTESDENALFTANVIANKTIKIDGKDVDAT 153

Query: 149 IISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
            I+P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       G R YTDFD   CT G
Sbjct: 154 NITPEFLAGTLQEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGKRTYTDFDTKACTNG 213

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNEL 267
           +C RR  YLK  + +LV+DL+EM+  W P+G A K +  D  AGL +I+TGM SLSY EL
Sbjct: 214 NCDRRAAYLKAATDLLVADLKEMVANWAPEGAAAKAVEADPKAGLAAILTGMGSLSYGEL 273

Query: 268 AGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL 327
           AGERM LGL+LHDPE+E DC SDNT+ S+L+D IGI S+YTGEY R++G K+ G S+ +L
Sbjct: 274 AGERMKLGLLLHDPEEEHDCSSDNTHNSHLHDAIGIQSAYTGEYTRVDGTKLAGPSLSEL 333

Query: 328 ISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLIT 387
           ++  +  L +E+    + T++    +  RAE  E++DQMI+E N +GN  V+  I+ LI 
Sbjct: 334 VAAKDAALDKEMATNLATTVEKMQAMAKRAEAGEAYDQMIAEGNKDGNATVQAAIDGLIA 393

Query: 388 QTESLRKIRIALDLIEPNR 406
           Q +++ ++  AL+L     
Sbjct: 394 QAKTVERVIAALELGTIEL 412


>gi|313497282|gb|ADR58648.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 444

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 163/398 (40%), Positives = 234/398 (58%), Gaps = 5/398 (1%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           A   V   + + V+++Y  + +A Y D+L  A+TL +A++  +  PN + L+ A+  W  
Sbjct: 45  ASGAVDEAAGKAVVKHYTDMVYAVYSDSLSTAKTLQTAVDAFLAKPNDETLKAAKEAWFA 104

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR+PY QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN+
Sbjct: 105 ARVPYLQSETFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGASANIIANT 163

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
           +I V E+++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP 
Sbjct: 164 EIQVGEEKVDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPA 223

Query: 197 TDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGL 252
           +D+  G   TGGH  RR  YLK V+ +LV+DLEEM+  W P+       K   + +N GL
Sbjct: 224 SDYLEGQGATGGHNDRRRAYLKAVTDLLVTDLEEMVGNWAPNVADNYRAKLEAEPVNDGL 283

Query: 253 NSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYI 312
             ++ GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY 
Sbjct: 284 RKMLFGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYT 343

Query: 313 RMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNP 372
           R +G K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N 
Sbjct: 344 RPDGTKLTGPSLSSLVAKVDPAADATLKADLEATEAKLQVIVDHALKGEHYDQLIAADNA 403

Query: 373 EGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
            GN++VR+ I  L+ QT S+ +    L +   N    +
Sbjct: 404 AGNQVVRDAIAALVKQTGSIEQAAGKLGIANLNPDTAD 441


>gi|83950301|ref|ZP_00959034.1| lipoprotein, putative [Roseovarius nubinhibens ISM]
 gi|83838200|gb|EAP77496.1| lipoprotein, putative [Roseovarius nubinhibens ISM]
          Length = 424

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 185/404 (45%), Positives = 252/404 (62%), Gaps = 2/404 (0%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           T   +  +L S A          +VL  YA IA A Y D+L  AR L  A+  L+  P++
Sbjct: 7   TTSILALSLASAAPLWAEAPEKTEVLNTYADIAAAGYGDSLTTARALQEAVAALIADPSE 66

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
            NL  AR  WI AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG   +E
Sbjct: 67  ANLAAARAAWIDARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGATDE 126

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQD 183
           N     N++AN K  ++ +E+D S I+P LL + LH A+G++ N+ TGYH IEFLLWGQD
Sbjct: 127 NGFAVLNVVANPKFTLSGQEVDASDITPALLAETLHEADGVEANVATGYHAIEFLLWGQD 186

Query: 184 LKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           L  +    G+RP+TDF  G  CT G+C RR  YLK  + +LVSDL+ M   W  DG A  
Sbjct: 187 LNGHAAGAGDRPWTDFASGEACTNGNCDRRAAYLKAATDLLVSDLDWMAAQWASDGAARA 246

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
            L+ D +AG+++++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +G
Sbjct: 247 TLLSDEDAGISAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLG 306

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           + + Y G Y R++G K+ G S+ DL++  +  L  E+  K S TM     LK  A+   S
Sbjct: 307 VQNVYLGAYTRVDGSKVEGPSLADLVAAQDAALDAEMQAKLSTTMDALGALKSAADGGFS 366

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           +D M+   N +G  ++   +N LI QT S+ ++  AL +     
Sbjct: 367 YDMMLERGNDKGEALIMGGVNGLIDQTRSIERVVAALGVDGIAF 410


>gi|146283464|ref|YP_001173617.1| iron-regulated protein A, putative [Pseudomonas stutzeri A1501]
 gi|145571669|gb|ABP80775.1| iron-regulated protein A, putative [Pseudomonas stutzeri A1501]
 gi|327481861|gb|AEA85171.1| iron-regulated protein A, putative [Pseudomonas stutzeri DSM 4166]
          Length = 444

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 164/406 (40%), Positives = 235/406 (57%), Gaps = 4/406 (0%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           S   ++P+         + + V+ +YA +A A + DA   A  L  AI+ L+  P+++ L
Sbjct: 37  STTESVPAEQAQKPDEKAAKAVVSHYADLALAVFSDAHATAVQLQQAIDALLANPSEETL 96

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           + AR  W+ AR+PY Q+EV+RFGN +VD W+ ++NAWPLDEG IDYV+  Y      N  
Sbjct: 97  QAARQAWLAARVPYMQTEVFRFGNPVVDEWEGQLNAWPLDEGLIDYVEGDYQ-HALGNPG 155

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
             ANIIAN+++ V E +ID S I+ +LL  L+   G + N+ TGYH IEFLLWGQDL   
Sbjct: 156 ANANIIANTELQVGEDKIDTSEITAELLTSLNELAGSEANVATGYHAIEFLLWGQDLNGT 215

Query: 188 VREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDL 244
               G RPYTD+  G  CTGG+C RR  YLKV + +LVSDL+EM++ W P          
Sbjct: 216 GPGAGERPYTDYVEGEGCTGGNCDRRRTYLKVATDLLVSDLQEMVEQWQPGAENYRASLE 275

Query: 245 MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
            +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI 
Sbjct: 276 AESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYNARGIR 335

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y GEY R++G  + G S+  L+   +  +   +     +T     +L + A N E+FD
Sbjct: 336 NVYLGEYKRVDGSTLTGPSLASLVQGVSPEVDSTLKTDLESTEAKLQVLVESANNGEAFD 395

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           Q+I+ +N EG + VRN I  L+ QT S+ +   AL + + N    +
Sbjct: 396 QLIAADNAEGQEKVRNAIAALVKQTASIEQAAAALGISDLNPDTAD 441


>gi|254440885|ref|ZP_05054378.1| hypothetical protein OA307_300 [Octadecabacter antarcticus 307]
 gi|198250963|gb|EDY75278.1| hypothetical protein OA307_300 [Octadecabacter antarcticus 307]
          Length = 419

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 170/398 (42%), Positives = 250/398 (62%), Gaps = 2/398 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           I +   L   A         + VL  Y+ IA A Y+D+L  A+TL +A+  L+  P + N
Sbjct: 4   ILLSTALTFVAPIAFAAGHAQDVLTTYSNIAEANYQDSLTTAQTLQTAVNALIVDPTEIN 63

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L+ A+  W  AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN 
Sbjct: 64  LQAAKAAWFAARVPYQQTEVYRFGNSIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDENK 123

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLK 185
               N+IAN    ++   ID S I+PD L  +LH A+G+++N+ TGYH +EFLLWGQDL 
Sbjct: 124 FAALNVIANPTFTLSGANIDASAITPDFLEGQLHEADGVESNVATGYHAVEFLLWGQDLN 183

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
            +    G RP TD+ +G+ CT G+C RR +YL+  + +LV+DLE M + W   G A   +
Sbjct: 184 GHGTGAGMRPATDYAMGDDCTNGNCDRRGDYLQAATDLLVADLEWMAEQWTEGGDARASV 243

Query: 245 MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
           M D +AG+ +I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  + +G+ 
Sbjct: 244 MADEDAGIATILTGMGSLSYGETAGERMRLGVMLNDPEEEHSCFADNTHNDHYYNGVGVQ 303

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y G Y R++G  + GAS+ DL++ ++ +L  E+  K S T+++   +K  AE   ++D
Sbjct: 304 NVYLGSYTRIDGTVVSGASLADLVAGSDGDLDTEMRTKLSATIRELGDIKHAAEAGFAYD 363

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
            M+   N  G  ++   +N  I QT S+ ++   L + 
Sbjct: 364 MMLEAGNAAGEDLIMGGVNAFIDQTRSIERVVAVLGVD 401


>gi|330807971|ref|YP_004352433.1| hypothetical protein PSEBR_a1249 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376079|gb|AEA67429.1| Conserved hypothetical protein; putative outer membrane protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 447

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 164/393 (41%), Positives = 235/393 (59%), Gaps = 5/393 (1%)

Query: 22  PNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPY 81
              + + V+ +YA I +A Y DA   A+TL +A++  +  PN + L+ AR  W+ AR+PY
Sbjct: 53  DEAAAKAVVAHYADIVYAVYSDAESTAKTLQTAVDAFLAKPNAETLKAARTAWVAARVPY 112

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
            QSEV+RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   TANIIAN+++ V 
Sbjct: 113 LQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGATANIIANTEVQVG 171

Query: 142 EKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
           E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+  
Sbjct: 172 EDKVDVKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYLQ 231

Query: 202 G-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIIT 257
           G   TGGH  RR  YLK V+++LV+DLEEM+  W P+           +   +GL  ++ 
Sbjct: 232 GAGATGGHNDRRRAYLKSVTQLLVNDLEEMVGNWKPNVSDNYRATLEAEPAESGLRKMLF 291

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  G+ + Y GEY R++G 
Sbjct: 292 GMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGVRNVYLGEYTRVDGT 351

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKI 377
           K+ GAS+  L++  +      +    ++T     ++ D A   E +DQ+I+  N  GN+I
Sbjct: 352 KMTGASLSSLVAKADPAADTALKADLADTEAKIQVMVDHANKGEHYDQLIAAGNTAGNQI 411

Query: 378 VRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           VR+ I  L+ QT S+ +    L + + N    +
Sbjct: 412 VRDAIAALVKQTGSIEQAAGKLGISDLNPDNAD 444


>gi|83955090|ref|ZP_00963746.1| lipoprotein, putative [Sulfitobacter sp. NAS-14.1]
 gi|83840419|gb|EAP79592.1| lipoprotein, putative [Sulfitobacter sp. NAS-14.1]
          Length = 419

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 171/402 (42%), Positives = 250/402 (62%), Gaps = 6/402 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +    +  TL S AL+    V   +V+  YA IA A Y D+L+ A+ L  A++ L+  P+
Sbjct: 5   LMTSVLALTLASPALA----VEKSEVIDTYADIAEAAYGDSLITAQALVDAVDALIAEPS 60

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
              ++ AR  W+ AR+PYQQ+E YRFGN IVD W+ K+NAWPLDEG IDYVD+SYG   +
Sbjct: 61  ADTMQAARTAWLAARVPYQQTEAYRFGNPIVDDWEGKLNAWPLDEGLIDYVDASYGGATD 120

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN     N+IAN    ++  E+D S I+PD L + LH A+G + N+ +GYH +EF+LWGQ
Sbjct: 121 ENAAAALNVIANPTFTLSGTEVDASTITPDFLAETLHEADGNEANVASGYHAVEFMLWGQ 180

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           DL       G R +TD+  G+ CT  +C RR +YLK  + ++V+DLE M+  W   G A 
Sbjct: 181 DLNGTKHGAGARDWTDYATGDDCTNDNCDRRGQYLKAAADLIVTDLEYMVAQWAEGGAAR 240

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
            +L  + +  +++++TGM SLSY ELAGERM LGL+L+DPE+E DCFSDNT+ S+  D +
Sbjct: 241 TNLTDNEDGAISAMLTGMGSLSYGELAGERMRLGLMLNDPEEEQDCFSDNTHNSHYYDGL 300

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y G Y R +G  + G S+ DL++  N +L  E+    S TM+    +K  AE   
Sbjct: 301 GIQNVYLGAYARTDGTLVTGPSLSDLVAAENADLDAEMQLNLSTTMRKLGQIKTAAEAGM 360

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           S+DQM++  N  G  +V   +N LI QT+++ ++   L + +
Sbjct: 361 SYDQMMARGNKGGEALVMGGVNALIAQTKTIERVVATLGVDD 402


>gi|255264811|ref|ZP_05344153.1| hypothetical protein TR2A62_0089 [Thalassiobium sp. R2A62]
 gi|255107146|gb|EET49820.1| hypothetical protein TR2A62_0089 [Thalassiobium sp. R2A62]
          Length = 419

 Score =  370 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 178/402 (44%), Positives = 257/402 (63%), Gaps = 6/402 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           ++   +I   L + AL+    V    VL  YA IA A Y D+L+ A+ L +A+  LV  P
Sbjct: 4   YLLTTAIAVGLATPALA----VETTDVLDTYADIAAANYGDSLITAQRLQAAVNALVADP 59

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + +NL  AR  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  +
Sbjct: 60  SAENLTAARAAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPS 119

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           +EN     N+IAN    ++ ++ID + I+P LL   L  A+G++ N+ TGYH IEFLLWG
Sbjct: 120 DENAFAALNVIANPTFTLSGQDIDATSITPALLEDTLQEADGVEANVATGYHAIEFLLWG 179

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDL  +    G+RP+TD+ +G+ CT G+C RR EYL   + +L+SDLE M  AW   G+A
Sbjct: 180 QDLNGHGTGAGDRPWTDYAMGDECTNGNCDRRGEYLTAATDLLISDLEYMAGAWAIGGEA 239

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
             +LM D +AG+++I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  + 
Sbjct: 240 RSELMSDADAGISAILTGMGSLSYGETAGERMRLGVMLNDPEEEHSCFADNTHNDHYYNG 299

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +GI + Y GEYIR++G  + G S+ DL++  +  L  E+  K  + +     +K  AE  
Sbjct: 300 VGIQNVYLGEYIRVDGSLVTGPSLSDLMAETDAALDAEMQGKLGDAVMALGRIKIAAEAG 359

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
            ++DQM+   N EG  ++   +N LI QT  + ++  AL + 
Sbjct: 360 FAYDQMLERGNVEGEALIMGGVNGLIDQTRFIERVIAALGVD 401


>gi|126729383|ref|ZP_01745197.1| lipoprotein, putative [Sagittula stellata E-37]
 gi|126710373|gb|EBA09425.1| lipoprotein, putative [Sagittula stellata E-37]
          Length = 419

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 176/408 (43%), Positives = 258/408 (63%), Gaps = 5/408 (1%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M  +T  +   +L +  L    +    +VL  YA IA A YED+L  A+ L  A++ L+ 
Sbjct: 1   MKTLTTTAAAMSLCAAPLFAADSA---EVLDTYADIAQAGYEDSLTTAKALQKAVDALIA 57

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P++  L  AR  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG 
Sbjct: 58  NPSEDTLAAARDAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGG 117

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLL 179
            ++EN     N+IA     ++ +EID S I+P+L+ + LH A+G++ N+ +GYH IEFLL
Sbjct: 118 PSDENQFAGLNVIATPSFTLSGEEIDASEITPELIAETLHEADGVEANVASGYHAIEFLL 177

Query: 180 WGQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           WGQDL       G+R + D+  G+ CT G+C RR EYL+  +++LVSDLE M   W   G
Sbjct: 178 WGQDLNGTDAGAGDRSFADYASGDACTNGNCDRRAEYLQAATELLVSDLEWMAAQWQEGG 237

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
            A   LM+D +AG+ +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  
Sbjct: 238 AARDALMEDEDAGIVAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHFY 297

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           D  G+ + Y G Y R++G ++ GAS+ DL++  +  L +E+  K   TM++   +   AE
Sbjct: 298 DGKGVQNVYLGSYTRVDGTEVTGASLSDLVAEADPALDEEMKAKLHTTMENLGAIVAAAE 357

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           +  S+D M+   N EG  ++   ++ L+ QT S+ ++  AL +   + 
Sbjct: 358 DGFSYDMMLERGNAEGEALIMGGVDALVDQTRSIERVVSALSVDSIDF 405


>gi|328542028|ref|YP_004302137.1| Insulin-cleaving metalloproteinase outer membrane protein
           [polymorphum gilvum SL003B-26A1]
 gi|326411778|gb|ADZ68841.1| Insulin-cleaving metalloproteinase outer membrane protein
           [Polymorphum gilvum SL003B-26A1]
          Length = 439

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 196/408 (48%), Positives = 263/408 (64%), Gaps = 2/408 (0%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +  +   +IV        ++        VL  Y  +A A YED+L  AR L +A+E LV 
Sbjct: 18  LMLLAATAIVAGAVVTGSALADAPKPADVLATYGDVAQAGYEDSLATARALKAAVEALVA 77

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
           +P+   L  AR  W+ AR+PYQQ+E +RFGN IVD W+ KVNAWPLDEG IDYVD++YG 
Sbjct: 78  SPSDDTLAAARQAWLAARVPYQQTEAFRFGNAIVDDWEGKVNAWPLDEGLIDYVDTAYGD 137

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLL 179
            +EEN  Y AN+IAN K+ V  +EID S I+P LL + L  A  I+ N+ TGYH IEFLL
Sbjct: 138 SSEENPFYAANVIANPKLTVAGEEIDASEITPALLSETLQEAGEIEANVATGYHAIEFLL 197

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           WGQDL       G RP +D+D  NCTGG+C RR+ YL+ V+ +L++DLEEM  AW P G 
Sbjct: 198 WGQDLNGTDAGAGARPASDYDTANCTGGNCDRRIAYLRAVTDLLIADLEEMAVAWAPGGA 257

Query: 240 ATKDLMK-DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
           A  +L       GL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+  
Sbjct: 258 ARAELAAKGEGGGLATILTGMGSLSYGELAGERMKLGLMLHDPEEEHDCFSDNTHLSHYY 317

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           DV+GI + Y GEY R++G K+ GAS+ D+++  +  LA+E+  +   T+  F  LK RAE
Sbjct: 318 DVVGIRNVYFGEYARVDGSKVEGASLADMVAARDPALAEEMKARLDATLAAFEALKTRAE 377

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
            +E++DQMI E N EGN +V+  ++ L+ QT S+ ++   L L     
Sbjct: 378 TVEAYDQMIGEGNAEGNAVVQAAVDALVDQTRSIERVVAVLGLEAIAF 425


>gi|167035468|ref|YP_001670699.1| hypothetical protein PputGB1_4475 [Pseudomonas putida GB-1]
 gi|166861956|gb|ABZ00364.1| conserved hypothetical protein [Pseudomonas putida GB-1]
          Length = 445

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 165/394 (41%), Positives = 232/394 (58%), Gaps = 5/394 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+++Y  + +A Y D+L  A+TL +AI+  +  PN + L+ A+  W  AR+P
Sbjct: 50  VDEAAGKAVVKHYTEMVYAVYSDSLSTAKTLQTAIDAFLAKPNDETLKAAKEAWFAARVP 109

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N    ANIIAN++I V
Sbjct: 110 YLQSEAFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPAAGANIIANTEIQV 168

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E+++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+ 
Sbjct: 169 GEEKVDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYL 228

Query: 201 IGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+ +LVSDLEEM+  W P+       K   + +N GL  ++
Sbjct: 229 EGQGATGGHNDRRRAYLKAVTDLLVSDLEEMVGNWAPNVADNYRAKLEAEPVNDGLRKML 288

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +G
Sbjct: 289 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRPDG 348

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN+
Sbjct: 349 TKVSGPSLSSLVAKVDPATDAALKADLEATEAKIQVIVDHALKGEHYDQLIAADNAAGNQ 408

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           IVR+ I  L+ QT S+ +    L +   N    +
Sbjct: 409 IVRDAIAALVKQTGSIEQAAGKLGIANLNPDTAD 442


>gi|254438835|ref|ZP_05052329.1| hypothetical protein OA307_3705 [Octadecabacter antarcticus 307]
 gi|198254281|gb|EDY78595.1| hypothetical protein OA307_3705 [Octadecabacter antarcticus 307]
          Length = 419

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 170/398 (42%), Positives = 250/398 (62%), Gaps = 2/398 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           I +   L   A         + VL  Y+ IA A Y+D+L  A+TL +A+  L+  P + N
Sbjct: 4   ILLSTALTFVAPIAFAAGHAQDVLTTYSNIAEANYQDSLTTAQTLQTAVNALIVDPTEIN 63

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L+ A+  W  AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG  ++EN 
Sbjct: 64  LQAAKAAWSAARVPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPSDENE 123

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLR-KLHRANGIDTNITTGYHVIEFLLWGQDLK 185
               N+IAN    ++   ID S I+PD L  +LH A+G+++N+ TGYH +EFLLWGQDL 
Sbjct: 124 FAALNVIANPTFTLSGANIDASAITPDFLEGQLHEADGVESNVATGYHAVEFLLWGQDLN 183

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
            +    G RP TD+ +G+ CT G+C RR +YL+  + +LV+DLE M + W   G A   +
Sbjct: 184 GHGTGAGMRPATDYAMGDDCTNGNCDRRGDYLQAATDLLVADLEWMAEQWTEGGDARASV 243

Query: 245 MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
           M D +AG+ +I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  + +G+ 
Sbjct: 244 MADEDAGIATILTGMGSLSYGEAAGERMRLGVMLNDPEEEHSCFADNTHNDHYYNGVGVQ 303

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y G Y R++G  + GAS+ DL++ ++ +L  E+  K S T+++   +K  AE   ++D
Sbjct: 304 NVYLGSYTRIDGTVVSGASLADLVAGSDGDLDTEMRTKLSATIRELGDIKHAAEAGFAYD 363

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
            M+   N  G  ++   +N  I QT S+ ++   L + 
Sbjct: 364 MMLEAGNAAGEDLIMGGVNAFIDQTRSIERVVAVLGVD 401


>gi|126666893|ref|ZP_01737869.1| putative iron-regulated protein A [Marinobacter sp. ELB17]
 gi|126628609|gb|EAZ99230.1| putative iron-regulated protein A [Marinobacter sp. ELB17]
          Length = 438

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/389 (40%), Positives = 232/389 (59%), Gaps = 7/389 (1%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V+   V+ +YA +AHA +ED+L+ AR L++A + L+ +P+  NL+ A+  W  AR+PYQQ
Sbjct: 42  VNQNTVVAHYADVAHATFEDSLITARALNAATDRLIASPSDANLKAAKEAWYAARVPYQQ 101

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           SE +RFGN ++D W+ +VNAWPLDEG IDYV S   +    N   TANIIA++ I V  +
Sbjct: 102 SEAFRFGNTLIDDWEGQVNAWPLDEGLIDYVTSDDYQYELGNAGATANIIASTSINVGGE 161

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG- 202
           ++D+S ++ +LL  L+   G + N+ +GYH IEFLLWGQDL       G RP +D+  G 
Sbjct: 162 QLDVSTLTAELLANLNEIGGSEANVASGYHAIEFLLWGQDLNGFDAGNGERPVSDYQQGE 221

Query: 203 NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPDGQATKDLMKDINAGLNSIITGM 259
           +CT G+C RR +YL  V+ +LV DLE M   W     D    +    D   G+  ++ GM
Sbjct: 222 DCTNGNCDRRGQYLDAVTDLLVDDLEWMTVQWARGSSDNYRAQLTSADAGEGVQKMLFGM 281

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + YTG Y R++   +
Sbjct: 282 GSLSLGELAGERMKVALEANSYEDEHDCFSDNTHNSHYYNGQGIQNVYTGTYRRVDNSVV 341

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE---SFDQMISENNPEGNK 376
            G S+ DL+   N  L  E+N +   TM+    +K +AE+ +   +FD MI+  N +G K
Sbjct: 342 TGPSLADLVEQTNPQLNAELNKQLDKTMQALAFMKAKAESSQTPMAFDMMIAPGNGDGAK 401

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPN 405
           IV + I  L+ QT S+ +    L +   +
Sbjct: 402 IVNDAIMALVVQTGSIEQAARELGIQALS 430


>gi|262275616|ref|ZP_06053425.1| iron-regulated protein A precursor [Grimontia hollisae CIP 101886]
 gi|262219424|gb|EEY70740.1| iron-regulated protein A precursor [Grimontia hollisae CIP 101886]
          Length = 417

 Score =  368 bits (944), Expect = e-99,   Method: Composition-based stats.
 Identities = 160/400 (40%), Positives = 233/400 (58%), Gaps = 6/400 (1%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            +       +   V+ +YA +AHA + DA   A+ LD+AI+ L+ +P+  +L +A+  W+
Sbjct: 16  SSTVNAATPTPNDVVSHYADLAHAVFVDAHTSAKQLDAAIDELIKSPSNASLASAKKAWL 75

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  E   N    ANI+AN
Sbjct: 76  AARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAEGYQYE-LGNPGAVANIVAN 134

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
             + V  + +D+S I+P+L+  L+   G + N+ +GYH IEFLLWGQDL       GNR 
Sbjct: 135 MSLTVGSETLDVSTITPELIASLNEIGGSEANVASGYHAIEFLLWGQDLNGTNAGAGNRA 194

Query: 196 YTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPDGQATKDLMKDINAG 251
           YTDF  G  CT G+C RR +YLK  S++LV DL  M   W     D    + +  D   G
Sbjct: 195 YTDFSYGEACTNGNCERRRDYLKAASELLVEDLAWMESQWAADKKDNYRAELIANDARHG 254

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  + +GI +  TG Y
Sbjct: 255 LRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYNELGIYNVLTGSY 314

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISEN 370
            R++G ++ G S+ D++   N   A +I   F +     + L + AE +   FDQ+I+ +
Sbjct: 315 QRIDGSELSGPSLLDMVRAKNDKAATDIKANFDSARSAVYALVESAEKDNVYFDQLIASD 374

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           N  G+K+V N I+ L+ QT+S+  +   + +   N    +
Sbjct: 375 NAVGHKLVNNAISALVAQTQSIELLAGEIGISNLNPDTAD 414


>gi|146279058|ref|YP_001169217.1| hypothetical protein Rsph17025_3028 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557299|gb|ABP71912.1| Uncharacterized iron-regulated protein-like protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 422

 Score =  368 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 179/405 (44%), Positives = 251/405 (61%), Gaps = 6/405 (1%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +   +    LP  AL+    V   +V++ YA IA A Y D+L  AR L  A++ LV  P+
Sbjct: 8   LAATAPCALLPLPALA----VERAEVVETYADIAEATYGDSLATARDLQMAVKALVAQPS 63

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           ++ L  AR  WI AR+PYQQSE +RFGN IVD W+ KVNAWPLDEG IDYVD ++G   E
Sbjct: 64  EQTLAAARTAWIAARVPYQQSEAFRFGNPIVDDWEGKVNAWPLDEGLIDYVDPTHGGATE 123

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN+L T N+IA     ++  E+D + I+P L+   LH A+GI+ N+ +GYH IEFLLWGQ
Sbjct: 124 ENDLATLNVIATPTFTLSGTEVDATEITPALISGTLHEADGIEANVASGYHAIEFLLWGQ 183

Query: 183 DLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           DL       GNRPYTD+  G  CTGG+C RR  YL   + +LVSDLE M+  W   G A 
Sbjct: 184 DLNGTEAGAGNRPYTDYASGGACTGGNCDRRGAYLLAATDLLVSDLEYMVAQWSEGGAAR 243

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
             +  D  AGL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +
Sbjct: 244 NAVSADPAAGLQAMLTGMGSLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYYDGL 303

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y G Y R++G ++ G S+ DL++  +  L + +  +   T++    L+  A    
Sbjct: 304 GIRNVYLGRYERVDGSRVEGPSLSDLVAEADTGLDEVLRGQLDTTLERLDALRTAAAEGM 363

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           ++DQM++  N  G +++   ++ L+TQT S+ +   AL L +   
Sbjct: 364 AYDQMLAPGNKRGEELIMGAVDALVTQTASIERATTALGLAKIEF 408


>gi|90579545|ref|ZP_01235354.1| hypothetical protein VAS14_01246 [Vibrio angustum S14]
 gi|90439119|gb|EAS64301.1| hypothetical protein VAS14_01246 [Vibrio angustum S14]
          Length = 417

 Score =  368 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 174/415 (41%), Positives = 244/415 (58%), Gaps = 10/415 (2%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
                I + +FTLP+ A +     + E+V+ +YA +AH+ Y DAL  A+ LD AI  LV 
Sbjct: 5   FTHTLIAAAIFTLPTVAQAA----TKEEVVTHYADLAHSVYSDALTTAQDLDKAIAALVA 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P++K L  AR  W  +R+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV   Y  
Sbjct: 61  NPSEKTLSAARTAWKASRVPYQQSEVFRFGNGIVDDWEGQLNAWPLDEGLIDYVAKDYQH 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
           E   N    ANI+A+  + V  KEID++ I+P+L+  L+   G + N+ +GYH IEFLLW
Sbjct: 121 E-LGNEGAKANIVASKTLNVGNKEIDVTKITPELIADLNELGGSEANVASGYHAIEFLLW 179

Query: 181 GQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---P 236
           GQDL       G+R +TDF  G  CT G+C RR EYL   S++L++DL+ M K W     
Sbjct: 180 GQDLNGTKSGAGDRKFTDFVKGEACTNGNCDRRAEYLTASSQLLINDLQWMEKQWSATEA 239

Query: 237 DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASY 296
               ++ L +  + GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+
Sbjct: 240 KNYRSELLAESADNGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSH 299

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDR 356
             +  GI + YTG Y R NGE + G SI+DL++  ++  A EI  +F  T     IL D 
Sbjct: 300 YYNEQGIYNVYTGTYTRTNGEVLTGPSINDLVAAKDKKAAAEIKAEFDKTRAQLQILVDS 359

Query: 357 AE-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           AE + + FDQ+I+ +N  G+ +V   I  L+ QT  + K    + +   N    +
Sbjct: 360 AEKDNQHFDQLIATDNKAGHALVNKSIMALVQQTAEIEKAASIIGVSNLNPDTAD 414


>gi|114706077|ref|ZP_01438980.1| hypothetical protein FP2506_16464 [Fulvimarina pelagi HTCC2506]
 gi|114538923|gb|EAU42044.1| hypothetical protein FP2506_16464 [Fulvimarina pelagi HTCC2506]
          Length = 425

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 189/401 (47%), Positives = 265/401 (66%), Gaps = 2/401 (0%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            +      L     ++  +VS E +L+NYA IA A Y DAL  A+TLD+A + L+  P++
Sbjct: 8   ALALSTSILAFSTPALAQDVSKEAILKNYADIALAAYTDALETAKTLDAATDELIAKPSE 67

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           + L  AR  W  +R  YQQ+EVYRFGN IVD W+ +VNAWPLDEG IDYVDSSYG  ++ 
Sbjct: 68  ETLTAARKAWKESRPSYQQTEVYRFGNPIVDAWEGRVNAWPLDEGLIDYVDSSYGTGSDS 127

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQD 183
           N LYTAN+IA  ++ +  + +D+S I+P L++  L  A G++ N+ TGYH +EFLLWGQD
Sbjct: 128 NQLYTANVIAADEVTIGGETVDVSTITPALIQDQLQEAGGVEANVATGYHAVEFLLWGQD 187

Query: 184 LKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           L       G RP TDF  G+ CT G C +R EYL   + +LVSDLEEM+  W   G+A  
Sbjct: 188 LNGTEAGAGERPATDFASGDECTNGSCDKRGEYLDAATDLLVSDLEEMVANWEDGGEARA 247

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
            LM+D N GLN ++TGM SLSY E+AGERM LGL+LHDPE+E DCFSDNT+ S+L DV+G
Sbjct: 248 ALMEDENQGLNMMLTGMGSLSYGEMAGERMKLGLLLHDPEEEHDCFSDNTHVSHLYDVVG 307

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           I + Y G Y +++G  + G ++ DL++  N  L +E+    + T++    + D AE+ E+
Sbjct: 308 IENVYLGRYEKVDGSTVEGPALADLVAAENAELEEEMKADLTATLEAMRAISDAAESGEA 367

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           +DQ I+E N EGN+ V+  ++ LI QT ++ ++  ALD+ E
Sbjct: 368 YDQQIAEGNSEGNERVQAAVDALIAQTRTIERVIAALDIGE 408


>gi|229592249|ref|YP_002874368.1| hypothetical protein PFLU4859 [Pseudomonas fluorescens SBW25]
 gi|229364115|emb|CAY51736.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 447

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 168/395 (42%), Positives = 233/395 (58%), Gaps = 5/395 (1%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
            V   + + V+ +YA +  A Y DA   A+TL +AI+  +  PN + L+ AR  WI AR+
Sbjct: 51  QVDEAAAKAVVAHYADMVFAVYSDAESTAKTLQTAIDAFLAKPNDETLKAARTAWIAARV 110

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKII 139
           PY QSEV+RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   TANIIAN++I 
Sbjct: 111 PYLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGATANIIANTEIQ 169

Query: 140 VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
           V E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+
Sbjct: 170 VGEDKVDVKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDY 229

Query: 200 DIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSI 255
             G+  TGGH  RR  YL+ V+++LVSDLEEM+  W P+           +    GL  +
Sbjct: 230 LTGDGATGGHNERRRTYLRAVTQLLVSDLEEMVGNWKPNVEDNYRATLEAEPATDGLRKM 289

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           + GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R++
Sbjct: 290 LFGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGIRNVYLGEYTRVD 349

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGN 375
           G K+ GAS+  L++  +      +    + T     ++ D A   E +DQ+I+  N  GN
Sbjct: 350 GTKLTGASLSSLVAKADPAADTALKADLAATEAKIQVMVDHANKGEHYDQLIAAGNDAGN 409

Query: 376 KIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           +IVR+ I  L+ QT S+      L + + N    +
Sbjct: 410 QIVRDAIAALVKQTGSIEAAAGKLGISDLNPDNAD 444


>gi|325277944|ref|ZP_08143481.1| hypothetical protein G1E_29817 [Pseudomonas sp. TJI-51]
 gi|324096918|gb|EGB95227.1| hypothetical protein G1E_29817 [Pseudomonas sp. TJI-51]
          Length = 444

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 162/394 (41%), Positives = 236/394 (59%), Gaps = 5/394 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+++YA + +A Y D+L  A+TL +A++  +  P+ + L+ A+  W+ AR+P
Sbjct: 49  VDEAAGKAVVKHYAEMVYAVYSDSLSTAKTLQTAVDAFLAKPDDETLKAAKQAWVAARVP 108

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN++I V
Sbjct: 109 YLQSEAFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPAASANIIANTEIQV 167

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E++ID+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+ 
Sbjct: 168 GEEKIDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYL 227

Query: 201 IGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+++LV+DLEEM+  W P+       K   + +N GL  ++
Sbjct: 228 EGQGATGGHNERRRAYLKAVTQLLVTDLEEMVGNWAPNVADNYRAKLEAEPVNDGLRKML 287

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +G
Sbjct: 288 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRPDG 347

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ G S+  L++  +      +      T     ++ D A+  E +DQ+I+ +N  GN+
Sbjct: 348 TKVSGPSLSSLVAKVDPAADATLKADLEATEAKIQVMVDHAQKGEHYDQLIAPDNAAGNQ 407

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           IVR+ I  L+ QT ++ +    L +   N    +
Sbjct: 408 IVRDAIAALVKQTGAIEQAAGKLGIANLNPDTAD 441


>gi|84684574|ref|ZP_01012475.1| lipoprotein, putative [Maritimibacter alkaliphilus HTCC2654]
 gi|84667553|gb|EAQ14022.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2654]
          Length = 444

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 185/402 (46%), Positives = 260/402 (64%), Gaps = 2/402 (0%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
            ++               +  +VL  YA IAHA YED+L  A+ L+ A+E L+ +P++  
Sbjct: 29  ATLTAAGLILGTVPAFAATKGEVLTTYADIAHAGYEDSLTTAQALNDAVEALIASPSEDT 88

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  W+ AR PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD SYG   +EN 
Sbjct: 89  LAAARAAWVAAREPYQQTEVYRFGNPIVDDWEGKVNAWPLDEGLIDYVDESYGGATDENP 148

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLK 185
               N+IAN ++ +  +E+D S I+P+L+   L+ A+GI++N+  GYH IEFLLWGQDL 
Sbjct: 149 FAAVNVIANPQLTIAGQEVDASSITPELIADTLNEADGIESNVARGYHAIEFLLWGQDLN 208

Query: 186 TNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
                 G+RPY+DF  G+ CT G+C RRV+YL+    +L+SDLEEM+ AWG  G+A + +
Sbjct: 209 GTDAGAGDRPYSDFAQGDDCTNGNCDRRVDYLEASMDLLISDLEEMVAAWGQGGEAREAV 268

Query: 245 MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGII 304
           M + +AG+ +I+TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+ ND +G+ 
Sbjct: 269 MANEDAGIIAILTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHRSHYNDGLGVQ 328

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFD 364
           + Y G Y R++G  + G S+ DL++  N +L  E+ +K   TM     + D AEN  + D
Sbjct: 329 NVYLGSYTRVDGTVVEGPSLSDLVAEANADLDAEMKEKLDTTMTAMTAISDAAENGMAVD 388

Query: 365 QMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           QM++  N EG K++ + I+ LI QT ++ +I   L L     
Sbjct: 389 QMLAPGNEEGEKLMMDAIDGLIDQTATIERIVADLGLEAIEF 430


>gi|326794858|ref|YP_004312678.1| peptidase M75, Imelysin [Marinomonas mediterranea MMB-1]
 gi|326545622|gb|ADZ90842.1| Peptidase M75, Imelysin [Marinomonas mediterranea MMB-1]
          Length = 453

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 174/387 (44%), Positives = 248/387 (64%), Gaps = 3/387 (0%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
           +VS E V+  YA IA A Y D+LM A+TL S +   +  P + NL+  +  WI +R PYQ
Sbjct: 53  SVSAEAVVTQYADIAEAIYGDSLMTAKTLQSGVNAFLLDPTEANLQKVKDAWIASRAPYQ 112

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVD-SSYGKENEENNLYTANIIANSKIIVN 141
           QSEVYRFGN IVD W+ KVNAWPLDEG IDYVD  SYG E++ N+LYTAN+IAN+ +++ 
Sbjct: 113 QSEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDSESYGSESDVNDLYTANVIANTSLMIG 172

Query: 142 EKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            +++D + I+P L+   L  A+G++ N+ +GYH IEFLLWGQDL       G R  TDFD
Sbjct: 173 GEKVDTTYITPALISDVLQEADGVEANVASGYHAIEFLLWGQDLHGTNPGAGERKATDFD 232

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM-KDINAGLNSIITGM 259
           + NCT G+C RR +YLK  + +LVSDLEEM   W   G A  +L  K  + GL +++TGM
Sbjct: 233 LANCTNGNCDRRRDYLKAATDLLVSDLEEMAANWKVGGAARAELAEKGTDGGLATMLTGM 292

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            SL+Y EL GER  LGL+LHDPE+E DCFSDNT+ S+  D  GI + Y G+Y R++G  +
Sbjct: 293 GSLAYGELGGERTKLGLMLHDPEEEHDCFSDNTHWSHYYDAKGIENVYLGKYQRVDGSWV 352

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVR 379
            G S+ +L+++ +  L  ++  + + T      + + A   ++FD +I+ NN  GN +V+
Sbjct: 353 EGPSLSNLVANKDAALDVKMKAQLTKTDAAGKAMTEAAAQGQTFDVLIAMNNEAGNAMVQ 412

Query: 380 NLINDLITQTESLRKIRIALDLIEPNR 406
           N ++ L+ +T     +   L L +   
Sbjct: 413 NFVDQLVAETRVTEDVIQTLGLQDIAL 439


>gi|26987649|ref|NP_743074.1| hypothetical protein PP_0913 [Pseudomonas putida KT2440]
 gi|24982331|gb|AAN66538.1|AE016282_6 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 443

 Score =  366 bits (939), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 162/395 (41%), Positives = 233/395 (58%), Gaps = 5/395 (1%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
            V   + + V+++Y  + +A Y D+L  A+TL +A++  +  PN + L+ A+  W  AR+
Sbjct: 47  AVDEAAGKAVVKHYTDMVYAVYSDSLSTAKTLQTAVDAFLAKPNDETLKAAKEAWFAARV 106

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKII 139
           PY QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN++I 
Sbjct: 107 PYLQSETFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGASANIIANTEIQ 165

Query: 140 VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
           V E+++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+
Sbjct: 166 VGEEKVDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDY 225

Query: 200 DIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSI 255
             G   TGGH  RR  YLK V+ +LV+DLEEM+  W P+       K   + +N GL  +
Sbjct: 226 LEGQGATGGHNDRRRAYLKAVTDLLVTDLEEMVGNWAPNVADNYRAKLEAEPVNDGLRKM 285

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           + GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +
Sbjct: 286 LFGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRPD 345

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGN 375
           G K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN
Sbjct: 346 GTKLTGPSLSSLVAKVDPAADAALKADLEATEAKLQVIVDHALKGEHYDQLIAADNAAGN 405

Query: 376 KIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           ++VR+ I  L+ QT S+ +    L +   N    +
Sbjct: 406 QVVRDAIAALVKQTGSIEQAAGKLGIANLNPDTAD 440


>gi|158424368|ref|YP_001525660.1| uncharacterized iron-regulated protein [Azorhizobium caulinodans
           ORS 571]
 gi|158331257|dbj|BAF88742.1| uncharacterized iron-regulated protein [Azorhizobium caulinodans
           ORS 571]
          Length = 436

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 252/412 (61%), Gaps = 13/412 (3%)

Query: 3   FITIISIVFTLPSHALSIVPNVSL----------EKVLQNYATIAHAKYEDALMCARTLD 52
                ++ F +   A++     +             V+ +YA +A A Y D+   A  + 
Sbjct: 6   VAAAFALAFGMAGPAIAQTAKPAPAPAANAAPSARSVITSYADLAQAMYTDSYTAAAEMQ 65

Query: 53  SAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFID 112
            AI+  +  P+ +  + A+  W +ARI Y ++E +RFGNKIVD W+  VNAWPLDEG ID
Sbjct: 66  KAIDAFIAAPSAETQKAAQEAWRKARISYMKTEGFRFGNKIVDEWEGNVNAWPLDEGLID 125

Query: 113 YVD-SSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTG 171
           YVD  SYG +++EN LYTANIIAN  I + +K ID + ++P+LL KL+ A G++ N+ +G
Sbjct: 126 YVDTKSYGTKSDENPLYTANIIANKSIRIGKKTIDTTNLTPELLHKLNSAGGVEANVASG 185

Query: 172 YHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMM 231
           +H IEFLLWGQDL       G RPYTD+D   CT G+C RR +YLKV +  LV+DL+EM 
Sbjct: 186 WHAIEFLLWGQDLHGTGPGAGERPYTDYDKNACTHGNCERRAQYLKVATDTLVADLKEMA 245

Query: 232 KAWGPDGQATKD-LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSD 290
           + WGP G+A    L K+  AGL +I TG+ SLSY ELAGERM LGLILHDPE+E DCFSD
Sbjct: 246 EDWGPKGKARAALLKKNDKAGLATIFTGIGSLSYGELAGERMKLGLILHDPEEEHDCFSD 305

Query: 291 NTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDF 350
           NT+ S+  D +GI   Y G   R +G    G S+ DL+   +  +A EI+ K        
Sbjct: 306 NTHNSHYYDEVGIADIYYGRTKRYDGSTFTGPSVADLVRAKDAKIADEIDAKIKGADAAL 365

Query: 351 HILKDRAENI-ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            ++KD A++    +D M++E N EGNK++++ ++ L+ Q  ++ +   AL +
Sbjct: 366 KVIKDTADSGRMYYDMMLAEGNAEGNKMIQDGVDALVAQAHAIERGVAALKI 417


>gi|148546195|ref|YP_001266297.1| hypothetical protein Pput_0952 [Pseudomonas putida F1]
 gi|148510253|gb|ABQ77113.1| Uncharacterized iron-regulated protein [Pseudomonas putida F1]
          Length = 444

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 163/394 (41%), Positives = 233/394 (59%), Gaps = 5/394 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+++Y  + +A Y D+L  A+TL +A++  +  PN + L+ A+  W  AR+P
Sbjct: 49  VDEAAGKAVVKHYTDMVYAVYSDSLSTAKTLQTAVDAFLAKPNDETLKAAKEAWFAARVP 108

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN++I V
Sbjct: 109 YLQSETFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGASANIIANTEIQV 167

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E+++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+ 
Sbjct: 168 GEEKVDVKDITPEKLASLNELAGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYL 227

Query: 201 IGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+ +LV+DLEEM+  W P+       K   + +N GL  ++
Sbjct: 228 EGQGATGGHNDRRRAYLKAVTDLLVTDLEEMVGNWAPNVADNYRAKLEAEPVNDGLRKML 287

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +G
Sbjct: 288 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRPDG 347

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ G S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN+
Sbjct: 348 TKLTGPSLSSLVAKVDPAADAALKADLEATEAKLQVIVDHALKGEHYDQLIAADNAAGNQ 407

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           IVR+ I  L+ QT S+ +    L +   N    +
Sbjct: 408 IVRDAIAALVKQTGSIEQAAGKLGIANLNPDTAD 441


>gi|159043116|ref|YP_001531910.1| iron-regulated protein [Dinoroseobacter shibae DFL 12]
 gi|157910876|gb|ABV92309.1| iron-regulated protein [Dinoroseobacter shibae DFL 12]
          Length = 420

 Score =  366 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 176/398 (44%), Positives = 257/398 (64%), Gaps = 6/398 (1%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
              ++   L + A +  P     +VL +YA +A AKYED+L+ A+ L +A++ LV+TP+ 
Sbjct: 7   LSTALALVLATPAFATEPA----EVLDHYADMAVAKYEDSLITAQRLQAAVDALVSTPSA 62

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           + L  AR  W+ AR+PYQQSEVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG   +E
Sbjct: 63  EALTAARAAWLAARVPYQQSEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPTDE 122

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQD 183
           N   + N+IA+    ++  E+D + I+P LL + LH A+G++ N+ TGYH IEFLLWGQD
Sbjct: 123 NAFASLNVIASPTFTLSGAEVDATEITPALLEETLHEADGVEANVATGYHAIEFLLWGQD 182

Query: 184 LKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           L  +   PG+RP+TD+  G+ CT G+C RR  +LK  + +LVSDLE M+  W  DG A  
Sbjct: 183 LNGHGAGPGDRPWTDYAPGDDCTNGNCDRRGAFLKAATDLLVSDLEWMVAQWADDGAARA 242

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
           +L  D  AG+ +I+TGM SLSY E AGERM LG++L+DPE+E  CF+DNT+  +  + IG
Sbjct: 243 ELTADAEAGIAAILTGMGSLSYGETAGERMRLGVMLNDPEEEHSCFADNTHNDHFYNGIG 302

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           I + Y GEY+R++G  + G ++ DL+   +  L  E+  K +  +     +K  AE   +
Sbjct: 303 IQNVYLGEYVRVDGTLVSGPALSDLVVAADPALDAEMQGKLAMAVMQLGRIKTAAEAGFA 362

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
           +DQM+ + N  G  ++   +N L+ QT S+ ++   L+
Sbjct: 363 YDQMLEQGNAAGEALIMGGVNGLVDQTRSIERVIAVLN 400


>gi|330981176|gb|EGH79279.1| iron-regulated protein A, putative [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 409

 Score =  366 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 158/385 (41%), Positives = 220/385 (57%), Gaps = 5/385 (1%)

Query: 30  LQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRF 89
           + NYA +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RF
Sbjct: 23  VANYANMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRF 82

Query: 90  GNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSI 149
           GN I+D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  
Sbjct: 83  GNTIIDDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKE 141

Query: 150 ISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGH 208
           I+ + L  L+   G + N+ TGYH +EFLLWGQDL       G RP +D+  G   TGGH
Sbjct: 142 ITSEKLASLNELGGSEANVATGYHAVEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGH 201

Query: 209 CRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYN 265
             RR  YLK V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  
Sbjct: 202 NDRRRAYLKAVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLG 261

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+ 
Sbjct: 262 ELAGERMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLS 321

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
            L++  +      +     +T     I+ D A   E FDQ+I+  N  GN++VR+ I  L
Sbjct: 322 SLVAKADPATDATLRADLDDTQAKLQIIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAAL 381

Query: 386 ITQTESLRKIRIALDLIEPNRVIGN 410
           + QT ++ +    L + + N    +
Sbjct: 382 VKQTGAIEQAAGKLGITDLNPDNAD 406


>gi|149203191|ref|ZP_01880161.1| lipoprotein, putative [Roseovarius sp. TM1035]
 gi|149143024|gb|EDM31063.1| lipoprotein, putative [Roseovarius sp. TM1035]
          Length = 420

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 175/405 (43%), Positives = 249/405 (61%), Gaps = 6/405 (1%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +T  +++  L   AL+  P      VL  YA IA A Y D+L  A+ L +A+  L+ +P
Sbjct: 5   LLTTTAVIAALGGTALAQTPG----DVLDTYADIAAANYTDSLTAAQALQTAVAALIQSP 60

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +   L+ AR  W+ AR+PYQQSEV+RFGN IVD W+ +VNAWPLDEG IDYVD +YG   
Sbjct: 61  SAATLQAARAAWLAARVPYQQSEVFRFGNAIVDDWEGRVNAWPLDEGLIDYVDGAYGGAT 120

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           ++N L   N+IAN    ++ +EID + I+P LL++ LH A+G++ N+ TGYH IEFLLWG
Sbjct: 121 DQNQLAALNVIANPVFTLSGQEIDATEITPALLQETLHEADGVEANVATGYHAIEFLLWG 180

Query: 182 QDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QDL  +    G+RP+TD+  G +CTGG+C RR EYL   +K+LV DL+ M   W   G A
Sbjct: 181 QDLNGHGDGAGDRPWTDYAQGADCTGGNCDRRAEYLAAATKLLVGDLDWMTTQWADGGAA 240

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              LM D  AGL +I+TGM SLSY E AGERM LGL+L+DPE+E  CF+DNT+  +  + 
Sbjct: 241 RAALMADERAGLAAILTGMGSLSYGETAGERMRLGLMLNDPEEEHSCFADNTHNDHFYNG 300

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +GI + Y G Y R +G  + G S+  L++     L  E+  + ++ +     +K  AE  
Sbjct: 301 VGIRNVYLGSYTRTDGTSVSGPSLSGLVAEIAPTLDVEMRARLADAVLALGRIKTSAEAG 360

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
            ++D+M+   N  G  ++   +  LI QT S+ ++  ALDL    
Sbjct: 361 FAYDEMLERGNAGGEALIMGGVEGLIAQTRSIERVIAALDLGGIE 405


>gi|260432801|ref|ZP_05786772.1| hypothetical protein SL1157_1935 [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416629|gb|EEX09888.1| hypothetical protein SL1157_1935 [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 423

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 184/402 (45%), Positives = 258/402 (64%), Gaps = 2/402 (0%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
                S +  L +   S     +  +VL  YA IA A YED+L  A+ L +AI+ L+ TP
Sbjct: 4   LFCATSALTLLIATTASAGDPPAKAQVLNTYADIAQAAYEDSLAAAKRLRAAIDMLIETP 63

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + + L  AR  WI AR+PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD++YG   
Sbjct: 64  SAEALHAARAAWIAARVPYQQTEVYRFGNPIVDDWEGKVNAWPLDEGLIDYVDAAYGGVT 123

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWG 181
           +EN L   N+IAN    ++ + ID + I+P LL + LH A+G++ N+ TGYH IEFLLWG
Sbjct: 124 DENALAALNVIANPTFQLSGETIDATDITPALLAETLHEADGVEANVATGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           QD+  +    G+RP+TD+  G+ CTGG+C RR +YL+  + +LVSDLE M   W   G A
Sbjct: 184 QDMNGHGPGSGDRPWTDYAQGDACTGGNCDRRAQYLQAATDLLVSDLEWMATQWQDGGAA 243

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
              L ++ +AGL +++TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D 
Sbjct: 244 RAALFENESAGLTAMLTGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDG 303

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           +GI + Y G Y+R++G  + G S+ DL+  +   L  E+  K ++TM+    +K  AE  
Sbjct: 304 LGIQNVYLGSYVRIDGTLVSGPSLSDLVMASAPELDDEMKTKLADTMQALGRIKTTAEAG 363

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
            ++DQM+   N  G  ++   +N LI QT+++ +I  ALDL 
Sbjct: 364 LAYDQMLERGNAGGEALIMGGVNALIDQTKTIERIVTALDLD 405


>gi|90418784|ref|ZP_01226695.1| possible iron-regulated protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336864|gb|EAS50569.1| possible iron-regulated protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 447

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 187/383 (48%), Positives = 251/383 (65%), Gaps = 2/383 (0%)

Query: 23  NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
                 VL NY+ IA A Y+DAL  A+TLD A + L+  P++  L+ AR  W  AR  YQ
Sbjct: 48  APDKAAVLANYSDIALAGYQDALAAAKTLDEATDALIAGPSEATLKAARDAWRAARPSYQ 107

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNE 142
           ++E +RFGN IVD W+ +VNAWPLDEG IDYV  +YG E++ NNLYTAN+IAN  I +  
Sbjct: 108 ETEAFRFGNPIVDDWEGRVNAWPLDEGLIDYVAGTYGTESDANNLYTANVIANPSITIGG 167

Query: 143 KEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
           + ID S I+P+LL+  L  A G++ N+ TGYH +EFLLWGQDL       G RP+TDF  
Sbjct: 168 ETIDASTITPELLQDKLQEAGGVEANVATGYHAVEFLLWGQDLNGTDAGAGERPHTDFAG 227

Query: 202 GN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
           G+ CTGG+C RR +YL   + +LV+DLEEM+  W  DG A K L+     G+++I+TGM 
Sbjct: 228 GDDCTGGNCDRRGQYLDAATDLLVTDLEEMVGNWEKDGAARKALLDSPENGISAILTGMG 287

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
           SLSY ELAGERM LGL+LHDPE+E DCFSDNT+ S+L+D IGI + YTG Y R +G  + 
Sbjct: 288 SLSYGELAGERMKLGLLLHDPEEEHDCFSDNTHISHLHDAIGIRNVYTGRYERTDGTIVE 347

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
           G S+ DL++ +   + QE+  K   T+     +   AE+ E++DQ I E N EGN  V+ 
Sbjct: 348 GPSVSDLVAASAPEIDQELRAKLDATVSAMETMAKAAEDGEAYDQQIGEGNDEGNARVQA 407

Query: 381 LINDLITQTESLRKIRIALDLIE 403
            I+ L+ QT ++ +   ALDL  
Sbjct: 408 AIDGLVDQTRAIERAVAALDLGN 430


>gi|330943761|gb|EGH46039.1| iron-regulated protein A, putative [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 452

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 155/380 (40%), Positives = 216/380 (56%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 ADPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 430 AIEQAAGKLGITDLNPDNAD 449


>gi|66047288|ref|YP_237129.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae B728a]
 gi|63257995|gb|AAY39091.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae B728a]
          Length = 458

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 155/380 (40%), Positives = 216/380 (56%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+
Sbjct: 77  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTII 136

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 137 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 195

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 196 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGHNDRRR 255

Query: 214 EYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGE
Sbjct: 256 AYLKAVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 315

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 316 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 375

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 376 ADPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 435

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 436 AIEQAAGKLGITDLNPDNAD 455


>gi|330973344|gb|EGH73410.1| iron-regulated protein A, putative [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 453

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 155/380 (40%), Positives = 216/380 (56%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+
Sbjct: 72  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTII 131

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 132 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 190

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 191 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 250

Query: 214 EYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGE
Sbjct: 251 AYLKAVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 310

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 311 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 370

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 371 ADPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 430

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 431 AIEQAAGKLGITDLNPDNAD 450


>gi|302189751|ref|ZP_07266424.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae 642]
          Length = 452

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 155/380 (40%), Positives = 216/380 (56%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 ADPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 430 AIEQAAGKLGITDLNPDNAD 449


>gi|330950176|gb|EGH50436.1| iron-regulated protein A, putative [Pseudomonas syringae Cit 7]
          Length = 408

 Score =  361 bits (925), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 155/380 (40%), Positives = 216/380 (56%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+
Sbjct: 27  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTII 86

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 87  DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 145

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 146 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 205

Query: 214 EYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W    PD        +   +GL  ++ GM SLS  ELAGE
Sbjct: 206 AYLKAVTDLLVSDLEEMSGNWKAGVPDNYRATLEAEPGESGLRKMLFGMGSLSLGELAGE 265

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 266 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 325

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 326 VDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 385

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 386 AIEQAAGKLGITDLNPDNAD 405


>gi|146308346|ref|YP_001188811.1| hypothetical protein Pmen_3326 [Pseudomonas mendocina ymp]
 gi|145576547|gb|ABP86079.1| imelysin, Metallo peptidase, MEROPS family M75 [Pseudomonas
           mendocina ymp]
          Length = 445

 Score =  361 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 156/400 (39%), Positives = 229/400 (57%), Gaps = 6/400 (1%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
              + V   + + V+ +YA +A A + DA    + L SA++ L+  P++  L+ AR  W+
Sbjct: 44  AGAAQVDEAAAKAVVNHYADLALAVFSDAASTGKALQSAVDALLADPSEATLKAAREAWL 103

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR+PY Q+EV+RFGN +VD W+ ++NAWPLDEG IDYV   Y      N    ANIIAN
Sbjct: 104 AARVPYMQTEVFRFGNPVVDEWEGQLNAWPLDEGLIDYVADDYQ-HALGNPGAQANIIAN 162

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
           ++I V E +ID++ I+ +LL  L+   G + N+ TGYH IEFLLWGQDL       G RP
Sbjct: 163 TEIQVGEDKIDVAEITGELLASLNELGGSEANVATGYHAIEFLLWGQDLNGTNPGAGERP 222

Query: 196 YTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAG 251
           YTD+ +G   TGGH  RR  YLKV + +LVSDL +M++ W         ++ +      G
Sbjct: 223 YTDYLVGEGATGGHNERRRTYLKVATDLLVSDLNDMVEQWKDGVEGNYRSELVADSGENG 282

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y G Y
Sbjct: 283 LRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYNGKGIRNVYLGVY 342

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISEN 370
            +++G  + G S+ +L++  +      +      T      L D AE N   FDQ+I+E+
Sbjct: 343 KKVDGSTLSGPSLSELVAKVDAQADASLKADLQATEAKLQALVDSAEKNNVHFDQLIAED 402

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           N EG ++VR+ I  L+ QT ++ +    L + + N    +
Sbjct: 403 NAEGQQLVRDAIAALVKQTGAIEQAAAKLGISDLNPDTAD 442


>gi|152986581|ref|YP_001350275.1| hypothetical protein PSPA7_4939 [Pseudomonas aeruginosa PA7]
 gi|150961739|gb|ABR83764.1| hypothetical protein PSPA7_4939 [Pseudomonas aeruginosa PA7]
          Length = 475

 Score =  361 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 156/395 (39%), Positives = 223/395 (56%), Gaps = 6/395 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   +   V++NYA +A A + DAL  AR L  A++  +  P+ + L+ A+  W  AR P
Sbjct: 79  VDEAAARAVIKNYADLAEATFADALSTARELQKAVDAFLAKPDAETLKAAKEAWFAARTP 138

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYV   Y      N   TANI+AN++I V
Sbjct: 139 YSQSEAFRFGNAIIDDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIVANTEIQV 197

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+  I+ + L  L+   G + N+ TGYH IEFLLWGQDL       G+RP TD+ 
Sbjct: 198 GEDKIDVKEITGEKLAGLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGDRPATDYA 257

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSII 256
            G +CTGGHC RR  YLK V+ +LVSDLE M   W          K   + ++ GL  + 
Sbjct: 258 QGKDCTGGHCDRRAAYLKAVTDLLVSDLEYMAGQWKAGVADNYRAKLEAEPVDTGLRKMF 317

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSD+T+ +   +   I + Y GEY R++G
Sbjct: 318 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDDTHHTLFFNAKSIRNIYLGEYKRVDG 377

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGN 375
             + G S+ DL++  +      +    ++T     ++ D AE +   FDQMI+ +N EG 
Sbjct: 378 SVVKGPSLADLVAKADAAANDTLKADLADTEAKLQVIVDSAEKDGVHFDQMIAPDNKEGQ 437

Query: 376 KIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           + +R+ I  L+ QT ++ +    L + +      +
Sbjct: 438 QKIRDAIAALVKQTGAIEQAAGKLGIQDLKPDNAD 472


>gi|56695014|ref|YP_165360.1| putative lipoprotein [Ruegeria pomeroyi DSS-3]
 gi|56676751|gb|AAV93417.1| lipoprotein, putative [Ruegeria pomeroyi DSS-3]
          Length = 420

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 174/389 (44%), Positives = 243/389 (62%), Gaps = 2/389 (0%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
                    VL  YA IA AKY+D+L+ AR L  A++ L+  P+ + L  A+  W+ AR 
Sbjct: 18  PAWAADRAAVLTTYADIAEAKYQDSLITARALQVAVDALIADPSAQTLAAAKQAWLAARD 77

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKII 139
           PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SY   ++EN     N+IA     
Sbjct: 78  PYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYPGASDENGYAALNVIATPVFD 137

Query: 140 VNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
           ++   +D S I+P+LL   LH A+G++ N+ TGYH IEFLLWGQDL       GNRP+TD
Sbjct: 138 LSGTTVDASQITPELLSGTLHEADGVEANVATGYHAIEFLLWGQDLNGTGPGAGNRPWTD 197

Query: 199 FDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIIT 257
           +  G +CTGG+C RR  YL+  + +L+SDLE M   W P G A   +  D  AGL +++T
Sbjct: 198 YAPGADCTGGNCDRRGAYLQAATDLLISDLEWMAAQWAPGGDARTSVTADETAGLVAMLT 257

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           GM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI + Y G Y R++G 
Sbjct: 258 GMGSLSYGEQAGERMRLGLLLNDPEEEHDCFSDNTHNSHYFDGLGIRNVYLGSYTRVDGT 317

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKI 377
            I GAS+ DL++  +  L  E+ D+ + TM     ++  A+   ++DQM++  N EG  +
Sbjct: 318 VISGASLSDLVADADAALDAEVKDRLNITMDALGAIRSAAKGGFAYDQMLARGNAEGEAL 377

Query: 378 VRNLINDLITQTESLRKIRIALDLIEPNR 406
           +   ++ L+ Q  S +++   L L +   
Sbjct: 378 IMAGVDGLVEQARSFQRLFPVLGLDDIAF 406


>gi|331009887|gb|EGH89943.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 452

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 151/380 (39%), Positives = 213/380 (56%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L + ++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAETGAKKLSTVVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W              +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDAPLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 430 AIEQAAGKLGITDLNPDNAD 449


>gi|320322412|gb|EFW78505.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320330120|gb|EFW86107.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330989423|gb|EGH87526.1| putative lipoprotein [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 452

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 152/380 (40%), Positives = 214/380 (56%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W              +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 430 AIEQAAGKLGITDLNPDNAD 449


>gi|28871502|ref|NP_794121.1| iron-regulated protein A [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213970316|ref|ZP_03398446.1| iron-regulated protein A [Pseudomonas syringae pv. tomato T1]
 gi|301385468|ref|ZP_07233886.1| iron-regulated protein A, putative [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063002|ref|ZP_07254543.1| iron-regulated protein A, putative [Pseudomonas syringae pv. tomato
           K40]
 gi|302135286|ref|ZP_07261276.1| iron-regulated protein A, putative [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28854753|gb|AAO57816.1| iron-regulated protein A, putative [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213924988|gb|EEB58553.1| iron-regulated protein A [Pseudomonas syringae pv. tomato T1]
          Length = 452

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 152/380 (40%), Positives = 212/380 (55%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAQGAAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W              +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 TYLKAVTDLLVSDLEEMAGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T      + D A   E FDQ+I   N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDATLRADLDDTQAKLQAIVDHANKGEHFDQLIGAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 430 AIEQAAGKLGITDLNPDNAD 449


>gi|99082039|ref|YP_614193.1| imelysin [Ruegeria sp. TM1040]
 gi|99038319|gb|ABF64931.1| imelysin. Metallo peptidase. MEROPS family M75 [Ruegeria sp.
           TM1040]
          Length = 422

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 182/386 (47%), Positives = 253/386 (65%), Gaps = 2/386 (0%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           S     S  +VL NYA IA AKYED+L+ A+TL +A+  L+  P+ + L  A+  W+ AR
Sbjct: 19  SAAFATSKGEVLINYANIAEAKYEDSLITAKTLQAAVGALIDAPSAETLAAAKKAWLAAR 78

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
           +PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD+SYG   +EN     N++AN   
Sbjct: 79  VPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGPTDENAAAVLNVVANPDF 138

Query: 139 IVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYT 197
            ++ + ID S I+P+LL + LH A+G++ N+ TGYH IEFLLWGQDL       G R +T
Sbjct: 139 SLSGQAIDASEITPELLAETLHEADGVEANVATGYHAIEFLLWGQDLNGTEHGAGARAWT 198

Query: 198 DFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSII 256
           D+  G +CT G+C RR  YLK  + +LVSDLE +   W   G A  +++ D NAG+ +I+
Sbjct: 199 DYATGEDCTNGNCDRRGAYLKAATDLLVSDLEWITAQWAEGGAARAEVLSDENAGITAIL 258

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
           TGM SLSY E AGERM LGL+L+DPE+E DCFSDNT+ S+  D +GI + Y GEY+R+NG
Sbjct: 259 TGMGSLSYGEQAGERMRLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIQNVYLGEYVRVNG 318

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
             + GA++ DL+   +  L  E+  K + TM     +K  AE   S+DQM+++ +  G  
Sbjct: 319 ALVSGAALADLVEAADPALNSELTAKLATTMMKLGRIKTAAEAGFSYDQMLAQGSTAGEA 378

Query: 377 IVRNLINDLITQTESLRKIRIALDLI 402
           +V   ++ L+ QT S+ ++  AL+L 
Sbjct: 379 LVMGGVDALVDQTRSIERVVAALELD 404


>gi|330877884|gb|EGH12033.1| iron-regulated protein A [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 452

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 152/380 (40%), Positives = 213/380 (56%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAEGAAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W              +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMAGNWKAGVADNYRATLKAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T      + D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDATLRADLDDTQAKLQAIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 430 AIEQAAGKLGITDLNPDNAD 449


>gi|289625673|ref|ZP_06458627.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647253|ref|ZP_06478596.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298488573|ref|ZP_07006603.1| Iron-regulated protein A precursor [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156914|gb|EFH98004.1| Iron-regulated protein A precursor [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330870178|gb|EGH04887.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 452

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 157/396 (39%), Positives = 223/396 (56%), Gaps = 5/396 (1%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           S   + + + V+ NYA +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR
Sbjct: 55  SQTDDAAAKAVVANYANMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAAR 114

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
           +PY QSEV+RFGN I+D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I
Sbjct: 115 VPYMQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEI 173

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
            V E ++D+  I+ + L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D
Sbjct: 174 QVGEDKVDVKEITSEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASD 233

Query: 199 FDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNS 254
           +  G   TGGH  RR  YLK V+ +LVSDLEEM   W              +   +GL  
Sbjct: 234 YLEGAGATGGHNDRRRAYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRK 293

Query: 255 IITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRM 314
           ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R 
Sbjct: 294 MLFGMGSLSLGELAGERMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRT 353

Query: 315 NGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEG 374
           +G K+ G S+  L++  +      +     +T     ++ D A   E FDQ+I+  N  G
Sbjct: 354 DGSKVSGPSLSSLVAKVDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAG 413

Query: 375 NKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           N++VR+ I  L+ QT ++ +    L + + N    +
Sbjct: 414 NQVVRDAIAALVKQTGAIEQAAGKLGITDLNPDNAD 449


>gi|331017972|gb|EGH98028.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 452

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 152/380 (40%), Positives = 212/380 (55%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAQGAAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W              +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMAGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T      + D A   E FDQ+I   N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDATLRADLDDTQAKLQAIVDHANKGEHFDQLIGAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 430 AIEQAAGKLGITDLNPDNAD 449


>gi|330966144|gb|EGH66404.1| iron-regulated protein A [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 450

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 152/380 (40%), Positives = 213/380 (56%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 69  NMVSAVFDDAEGAAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 128

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 129 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 187

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 188 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 247

Query: 214 EYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W              +   +GL  ++ GM SLS  ELAGE
Sbjct: 248 AYLKAVTDLLVSDLEEMAGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 307

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 308 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 367

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T      + D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 368 VDPATDATLRADLDDTQAKLQAIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 427

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 428 AIEQAAGKLGITDLNPDNAD 447


>gi|330888530|gb|EGH21191.1| putative lipoprotein [Pseudomonas syringae pv. mori str. 301020]
          Length = 452

 Score =  359 bits (920), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 151/380 (39%), Positives = 213/380 (56%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  R  
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRPR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W              +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 430 AIEQAAGKLGITDLNPDNAD 449


>gi|330874919|gb|EGH09068.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 402

 Score =  359 bits (920), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 152/380 (40%), Positives = 214/380 (56%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 21  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 80

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 81  DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 139

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 140 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 199

Query: 214 EYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W              +   +GL  ++ GM SLS  ELAGE
Sbjct: 200 AYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 259

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 260 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 319

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 320 VDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 379

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 380 AIEQAAGKLGITDLNPDNAD 399


>gi|71734726|ref|YP_276192.1| lipoprotein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71555279|gb|AAZ34490.1| lipoprotein, putative [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 452

 Score =  359 bits (920), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 152/380 (40%), Positives = 214/380 (56%), Gaps = 5/380 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 71  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 130

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 131 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 189

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 190 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEGAGATGGHNDRRR 249

Query: 214 EYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W              +   +GL  ++ GM SLS  ELAGE
Sbjct: 250 AYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELAGE 309

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 310 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 369

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 370 VDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 429

Query: 391 SLRKIRIALDLIEPNRVIGN 410
           ++ +    L + + N    +
Sbjct: 430 AIEQAASKLGITDLNPDNAD 449


>gi|163792732|ref|ZP_02186709.1| hypothetical protein BAL199_17833 [alpha proteobacterium BAL199]
 gi|159182437|gb|EDP66946.1| hypothetical protein BAL199_17833 [alpha proteobacterium BAL199]
          Length = 429

 Score =  358 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 186/402 (46%), Positives = 248/402 (61%), Gaps = 2/402 (0%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
               +S+         +    V  + V+ NY  IAHA Y+DA   A TL SA+  L  TP
Sbjct: 10  LAVTLSVASIGALPIGAHAAAVDAKAVIANYEAIAHAMYQDAHASAVTLKSAVRALAKTP 69

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + KNL+ AR+ WI AR  YQQ+E  RFGN IVD W+ +VNAWPLDEG IDYVD+ YG E 
Sbjct: 70  SAKNLKAARVAWIAARPAYQQTEALRFGNAIVDDWEGRVNAWPLDEGLIDYVDAGYGTEA 129

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           + N LYTAN+IAN KI +    +D S I   L+ +LH A  ++ N++ GYH IEFLLWGQ
Sbjct: 130 DHNPLYTANVIANKKIRIGATMVDASKIDKKLIAELHEAQEVEANVSIGYHAIEFLLWGQ 189

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           DL       GNRP+TDFD   CT G+C RR  YL   + +LV DL EM+  W P G A  
Sbjct: 190 DLNGTGPGAGNRPHTDFDTRKCTNGNCDRRAAYLVAATDLLVDDLAEMVANWAPGGPARA 249

Query: 243 DL-MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
           +L  K    GL +I+TG+ SLSY ELAGERM LGLILHDPE+E DCFSDNT+ S+  D +
Sbjct: 250 ELEAKGPEGGLATILTGIGSLSYGELAGERMKLGLILHDPEEEHDCFSDNTHNSHYYDQV 309

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI- 360
           G+++  +G Y+R +   I G  I DL +  +   A+E+    + T     ++KD A+   
Sbjct: 310 GMVALASGRYVRSDKSVIKGPGILDLAAAKDPAAAKEMTAALATTSAKMQVMKDTADKGT 369

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
            ++DQMI E N  GNKIV+++I+ L+ QT +  ++  AL+L 
Sbjct: 370 MAYDQMIGEGNEAGNKIVQDVIDGLVAQTRATERVVTALNLS 411


>gi|104780332|ref|YP_606830.1| hypothetical protein PSEEN1119 [Pseudomonas entomophila L48]
 gi|95109319|emb|CAK14019.1| conserved hypothetical protein; putative signal peptide
           [Pseudomonas entomophila L48]
          Length = 442

 Score =  358 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 163/388 (42%), Positives = 230/388 (59%), Gaps = 5/388 (1%)

Query: 27  EKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEV 86
           + V+++YA + HA Y D+L  A+ L +A++  + TPN + L+ A+  W  AR+PY QSE 
Sbjct: 53  KAVVKHYAEMVHAVYSDSLSTAKQLQTAVDAFLATPNDQTLKAAKEAWAAARVPYLQSEA 112

Query: 87  YRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEID 146
           +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   +ANIIAN++I V E ++D
Sbjct: 113 FRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPAASANIIANTQIQVGEDKVD 171

Query: 147 LSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CT 205
           +  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+  G   T
Sbjct: 172 VKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYLEGKGAT 231

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDI-NAGLNSIITGMTSL 262
           GGH  RR  YLK V+++LV DLEEM+  W P+        L     N GL  ++ GM SL
Sbjct: 232 GGHNDRRRAYLKAVTELLVKDLEEMVGNWAPNVADNYRATLENGPVNDGLRKMLFGMGSL 291

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           S  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R++G K+ G 
Sbjct: 292 SLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRVDGSKLTGP 351

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN+IVR+ I
Sbjct: 352 SLSSLVAKVDPATDATLKADLEATEAKIQVMVDHALKGEHYDQLIAADNAAGNQIVRDAI 411

Query: 383 NDLITQTESLRKIRIALDLIEPNRVIGN 410
             L+ QT ++ +    L +   N    +
Sbjct: 412 ASLVKQTGAIEQAAGKLGIDNLNPDTAD 439


>gi|254470644|ref|ZP_05084047.1| insulin-cleaving metalloproteinase outer membrane protein
           [Pseudovibrio sp. JE062]
 gi|211959786|gb|EEA94983.1| insulin-cleaving metalloproteinase outer membrane protein
           [Pseudovibrio sp. JE062]
          Length = 422

 Score =  358 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 202/408 (49%), Positives = 269/408 (65%), Gaps = 2/408 (0%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M FI    +         ++    +   VL  Y  IA A +ED+L  A+TL  AI+ LV 
Sbjct: 1   MSFIRGALLGTVALGSLSTVAVAATPSDVLATYGDIAQAAFEDSLTTAKTLQVAIDKLVA 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P + NL+ AR  WI AR PYQQ+EVYRFGN IVD W+ KVNAWPLDEG IDYVD +YG 
Sbjct: 61  EPTEDNLKAARRAWIAARNPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDGAYGN 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLL 179
           E+EEN  Y ANIIAN+K+ V  +EID + I+P LL   L  A  ++ N+ TGYH IEFLL
Sbjct: 121 ESEENPYYAANIIANAKVTVAGEEIDATEITPALLADQLQEAGEVEANVATGYHAIEFLL 180

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           WGQDL    +  GNRP +DFD  NCTGG+C RRV+YL+  + +L++DLEEM+ AW  DG 
Sbjct: 181 WGQDLNGTGKGAGNRPASDFDTANCTGGNCERRVQYLQAATTLLITDLEEMVAAWQADGA 240

Query: 240 ATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
           A KDL  K   AG+ +I+TGM SLSY ELAGERM LGL+L+DPE+E DCFSDNT+ S+ N
Sbjct: 241 ARKDLADKGEAAGIATILTGMGSLSYGELAGERMKLGLMLNDPEEEHDCFSDNTHMSHYN 300

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           DV+GI + + G+Y R++G  + GAS+ DL++  +  ++ E+  K + ++  F  LK RAE
Sbjct: 301 DVVGINNVFQGKYTRVDGTVVEGASLKDLLAKADSAVSAELEGKLNASLGAFTALKTRAE 360

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
             E++DQMI E N EGN +V+  ++ L+ QT S+ +    L L +   
Sbjct: 361 TTEAYDQMIGEGNTEGNAVVQAAVDSLVDQTSSIERAVKVLKLEQIAF 408


>gi|330504568|ref|YP_004381437.1| hypothetical protein MDS_3654 [Pseudomonas mendocina NK-01]
 gi|328918854|gb|AEB59685.1| hypothetical protein MDS_3654 [Pseudomonas mendocina NK-01]
          Length = 445

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 156/395 (39%), Positives = 227/395 (57%), Gaps = 6/395 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+ +YA +A A + DA    + L +A++ L+  P++  L+ AR  W+ AR+P
Sbjct: 49  VDEAAAKAVVNHYADLALAVFSDAASTGKALQAAVDALLADPSEATLKAAREAWLAARVP 108

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y Q+EV+RFGN +VD W+ ++NAWPLDEG IDYV   Y      N    ANIIAN++I V
Sbjct: 109 YMQTEVFRFGNPVVDEWEGQLNAWPLDEGLIDYVADDYQ-HALGNPGAQANIIANTEIQV 167

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+S I+ +LL  L+   G + N+ TGYH IEFLLWGQDL       G RPYTD+ 
Sbjct: 168 GEDKIDVSEITGELLASLNELGGSEANVATGYHAIEFLLWGQDLNGTNPGAGERPYTDYL 227

Query: 201 IGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---PDGQATKDLMKDINAGLNSII 256
           +G   TGGH  RR  YLK  + +LVSDL+EM++ W         ++ +      GL  ++
Sbjct: 228 VGEGATGGHNERRRTYLKAATDLLVSDLDEMVEQWKDGVEGNYRSELVADSAENGLRKML 287

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY + +G
Sbjct: 288 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYKKADG 347

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGN 375
             + G S+ +L++  +      +      T      L D AE N   FDQ+I+ +N EG 
Sbjct: 348 TTLTGPSLSELVAKADAQADATLKADLQETEAKLQALVDSAEKNNVHFDQLIAADNAEGQ 407

Query: 376 KIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           ++VR+ I  L+ QT ++ +    L + + N    +
Sbjct: 408 QLVRDAIAALVKQTGAIEQAAGKLGISDLNPDTAD 442


>gi|116052404|ref|YP_792715.1| metalloproteinase outer membrane [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115587625|gb|ABJ13640.1| Insulin-cleaving metalloproteinase outer membrane [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 446

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 156/397 (39%), Positives = 224/397 (56%), Gaps = 6/397 (1%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           + V   + + V++NYA +A A + DAL  A+ L  AI+  +  P+ + L+ A+  W  AR
Sbjct: 48  TKVDEAAAKAVIKNYADLAEATFADALSTAKDLQKAIDAFLAKPDAETLKAAKEAWFAAR 107

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
            PY QSE +RFGN I+D W+ +VNAWPLDEG IDYV   Y      N   TANI+AN++I
Sbjct: 108 TPYSQSEAFRFGNAIIDDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIVANTEI 166

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
            V E +ID+  I+ + L  L+   G + N+ TGYH IEFLLWGQDL       GNRP TD
Sbjct: 167 QVGEDKIDVKEITGEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATD 226

Query: 199 FDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNS 254
           +  G +CTGGHC RR  YLK V+ +LVSDLE M   W          K   + ++ GL  
Sbjct: 227 YAQGKDCTGGHCDRRAAYLKAVTDLLVSDLEYMAGQWKAGVADNYRAKLEAEPVDTGLRK 286

Query: 255 IITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRM 314
           +  GM SLS  ELAGERM + L  +  E E DCFSD+T+ +   +   I + Y GEY R+
Sbjct: 287 MFFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDDTHHTLFFNGKSIRNIYLGEYKRI 346

Query: 315 NGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPE 373
           +G  + G S+ DL++  +      +    ++T      + D AE +   FDQMI+ +N +
Sbjct: 347 DGSVVKGPSLADLVAKADAAANDTLKADLADTEAKLQAIVDSAEKDGVHFDQMIAPDNKD 406

Query: 374 GNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           G + +R+ I  L+ QT ++ +    L + +      +
Sbjct: 407 GQQKIRDAIAALVKQTGAIEQAAGKLGIQDLKPDNAD 443


>gi|15599566|ref|NP_253060.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa PAO1]
 gi|218893461|ref|YP_002442330.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa LESB58]
 gi|254238967|ref|ZP_04932290.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa C3719]
 gi|254244820|ref|ZP_04938142.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa 2192]
 gi|296391077|ref|ZP_06880552.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa PAb1]
 gi|9950599|gb|AAG07758.1|AE004853_1 Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa PAO1]
 gi|126170898|gb|EAZ56409.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa C3719]
 gi|126198198|gb|EAZ62261.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa 2192]
 gi|218773689|emb|CAW29503.1| Insulin-cleaving metalloproteinase outer membrane protein precursor
           [Pseudomonas aeruginosa LESB58]
          Length = 446

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 156/395 (39%), Positives = 223/395 (56%), Gaps = 6/395 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V++NYA +A A + DAL  A+ L  AI+  +  P+ + L+ A+  W  AR P
Sbjct: 50  VDEAAAKAVIKNYADLAEATFADALSTAKDLQKAIDAFLAKPDAETLKAAKEAWFAARTP 109

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYV   Y      N   TANI+AN++I V
Sbjct: 110 YSQSEAFRFGNAIIDDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIVANTEIQV 168

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+  I+ + L  L+   G + N+ TGYH IEFLLWGQDL       GNRP TD+ 
Sbjct: 169 GEDKIDVKEITGEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYA 228

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSII 256
            G +CTGGHC RR  YLK V+ +LVSDLE M   W          K   + ++ GL  + 
Sbjct: 229 QGKDCTGGHCDRRAAYLKAVTDLLVSDLEYMAGQWKAGVADNYRAKLEAEPVDTGLRKMF 288

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSD+T+ +   +   I + Y GEY R++G
Sbjct: 289 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDDTHHTLFFNGKSIRNIYLGEYKRIDG 348

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGN 375
             + G S+ DL++  +      +    ++T      + D AE +   FDQMI+ +N +G 
Sbjct: 349 SVVKGPSLADLVAKADAAANDTLKADLADTEAKLQAIVDSAEKDGVHFDQMIAPDNKDGQ 408

Query: 376 KIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           + +R+ I  L+ QT ++ +    L + +      +
Sbjct: 409 QKIRDAIAALVKQTGAIEQAAGKLGIQDLKPDNAD 443


>gi|288961780|ref|YP_003452090.1| hypothetical protein AZL_c02530 [Azospirillum sp. B510]
 gi|288914060|dbj|BAI75546.1| hypothetical protein AZL_c02530 [Azospirillum sp. B510]
          Length = 424

 Score =  355 bits (910), Expect = 8e-96,   Method: Composition-based stats.
 Identities = 175/380 (46%), Positives = 238/380 (62%), Gaps = 5/380 (1%)

Query: 27  EKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEV 86
           + V +NYA IAHA YEDA   A+ L  A++ L+  P ++NL  AR  W  AR+PY Q+E 
Sbjct: 29  KDVAKNYADIAHAAYEDATNGAKALKKAVDALIANPTEENLTKARDVWKAARVPYMQTEA 88

Query: 87  YRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEID 146
           +RFGN IVD W+ KVNAWPLDEG IDYVD SY      N    AN+IAN KI    K ID
Sbjct: 89  FRFGNPIVDEWEGKVNAWPLDEGLIDYVDESYAGGES-NPYAKANVIANPKITAGGKTID 147

Query: 147 LSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-C 204
            + I+ +LL + LH A  ++ N+ TGYH IEFLLWGQDL       G R  TD+  G  C
Sbjct: 148 ATKITKELLAEKLHEAGKVEANVATGYHAIEFLLWGQDLHGTGPGAGERKATDYAKGKAC 207

Query: 205 TGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDIN-AGLNSIITGMTSLS 263
           T  HC RR +YLKV +++LV DL EM   W   G+A   + K     G+  ++TG+ SLS
Sbjct: 208 TNDHCDRRAQYLKVATQMLVDDLAEMTADWSAKGKARVSIAKAPESEGVARMLTGLGSLS 267

Query: 264 YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
           Y ELAGERM LGL+LHDPE+E DCFSDNT+ S+  D +G+++ Y G Y R +G+ + GAS
Sbjct: 268 YGELAGERMKLGLMLHDPEEEHDCFSDNTHNSHYYDEVGMVNVYNGSYKRTDGKTVSGAS 327

Query: 324 IHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI-ESFDQMISENNPEGNKIVRNLI 382
           +  L++  + +    +    ++TMK    +KD A++   ++DQMI  +NPEGNK+V + I
Sbjct: 328 LSQLVAAKSADADAAVKAAMADTMKAMQAIKDTADSGKMAYDQMIGADNPEGNKLVSDGI 387

Query: 383 NDLITQTESLRKIRIALDLI 402
           + L+ Q ++L     AL + 
Sbjct: 388 DRLVAQKKALEGAVAALGVS 407


>gi|107100046|ref|ZP_01363964.1| hypothetical protein PaerPA_01001067 [Pseudomonas aeruginosa PACS2]
          Length = 443

 Score =  355 bits (910), Expect = 8e-96,   Method: Composition-based stats.
 Identities = 156/395 (39%), Positives = 223/395 (56%), Gaps = 6/395 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V++NYA +A A + DAL  A+ L  AI+  +  P+ + L+ A+  W  AR P
Sbjct: 47  VDEAAAKAVIKNYADLAEATFADALSTAKDLQKAIDAFLAKPDAETLKAAKEAWFAARTP 106

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSE +RFGN I+D W+ +VNAWPLDEG IDYV   Y      N   TANI+AN++I V
Sbjct: 107 YSQSEAFRFGNAIIDDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIVANTEIQV 165

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E +ID+  I+ + L  L+   G + N+ TGYH IEFLLWGQDL       GNRP TD+ 
Sbjct: 166 GEDKIDVKEITGEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYA 225

Query: 201 IG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSII 256
            G +CTGGHC RR  YLK V+ +LVSDLE M   W          K   + ++ GL  + 
Sbjct: 226 QGKDCTGGHCDRRAAYLKAVTDLLVSDLEYMAGQWKAGVADNYRAKLEAEPVDTGLRKMF 285

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  +  E E DCFSD+T+ +   +   I + Y GEY R++G
Sbjct: 286 FGMGSLSLGELAGERMKVALEANSTEDEHDCFSDDTHHTLFFNGKSIRNIYLGEYKRIDG 345

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE-NIESFDQMISENNPEGN 375
             + G S+ DL++  +      +    ++T      + D AE +   FDQMI+ +N +G 
Sbjct: 346 SVVKGPSLADLVAKADAAANDTLKADLADTEAKLQAIVDSAEKDGVHFDQMIAPDNKDGQ 405

Query: 376 KIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           + +R+ I  L+ QT ++ +    L + +      +
Sbjct: 406 QKIRDAIAALVKQTGAIEQAAGKLGIQDLKPDNAD 440


>gi|237799577|ref|ZP_04588038.1| putative lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331022433|gb|EGI02490.1| putative lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 436

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 152/367 (41%), Positives = 210/367 (57%), Gaps = 5/367 (1%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 70  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNNETLKAARDAWVAARVPYMQSEVFRFGNTII 129

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+P+ 
Sbjct: 130 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITPEK 188

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+  G   TGGH  RR 
Sbjct: 189 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYIEGAGATGGHNERRR 248

Query: 214 EYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIITGMTSLSYNELAGE 270
            YLK V+ +LVSDLEEM   W              +   +GL  ++ GM SLS  ELAGE
Sbjct: 249 AYLKAVTDLLVSDLEEMSGNWRAGVADNYRASLEAEPGESGLRKMLFGMGSLSLGELAGE 308

Query: 271 RMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH 330
           RM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++ 
Sbjct: 309 RMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLVAK 368

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            +      +     +T      + D A   E FDQ+I+  N  GN++VR+ I  L+ QT 
Sbjct: 369 VDPATDATLRADLDDTQAKLQAIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTG 428

Query: 391 SLRKIRI 397
           ++ +   
Sbjct: 429 AIEQAAG 435


>gi|77460709|ref|YP_350216.1| hypothetical protein Pfl01_4488 [Pseudomonas fluorescens Pf0-1]
 gi|77384712|gb|ABA76225.1| imelysin. Metallo peptidase. MEROPS family M75 [Pseudomonas
           fluorescens Pf0-1]
          Length = 448

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 165/394 (41%), Positives = 233/394 (59%), Gaps = 5/394 (1%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
           V   + + V+ +YA +  A Y DA   A+TL +AI+  +  P+   L+ A+  W+ AR+P
Sbjct: 53  VDEAAGKAVVAHYADMVFAVYSDAESTAKTLQTAIDAFLAKPDADTLKAAKAAWVAARVP 112

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y QSEV+RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   TANIIAN+++ V
Sbjct: 113 YLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGATANIIANTEVQV 171

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
            E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL +     GNRP +D+ 
Sbjct: 172 GEDKVDVKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNSTGPGAGNRPASDYL 231

Query: 201 IGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSII 256
            G   TGGH  RR  YLK V+++LVSDLEEM+  W P+           +   +GL  ++
Sbjct: 232 EGKGATGGHNDRRRAYLKAVTQLLVSDLEEMVANWKPNVADNYRATLEAEPAESGLRKML 291

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R++G
Sbjct: 292 FGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGIRNVYLGEYTRVDG 351

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K+ GAS+  L++  +      +    + T     ++ D A   E +DQ+I+  N  GN+
Sbjct: 352 TKLTGASLSSLVAKVDPAADTALKADLAATEAKIQVMVDHANKGEHYDQLIAAGNTAGNQ 411

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           IVR+ I  L+ QT S+      L + + N    +
Sbjct: 412 IVRDAIASLVKQTGSIEAAAGKLGISDLNPDNAD 445


>gi|154247126|ref|YP_001418084.1| putative iron-regulated protein [Xanthobacter autotrophicus Py2]
 gi|154161211|gb|ABS68427.1| putative iron-regulated protein [Xanthobacter autotrophicus Py2]
          Length = 428

 Score =  353 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 165/385 (42%), Positives = 235/385 (61%), Gaps = 3/385 (0%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
                    V+ +YA +A A Y  +   A+ +   I + +  P+   L  AR  W  AR+
Sbjct: 25  PKDAPKPRDVIVHYADLAQAMYGSSAATAKDMQKVILSFLDAPSADTLAKARDAWKAARV 84

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVD-SSYGKENEENNLYTANIIANSKI 138
            Y Q+E +RFGNK VD  +  VNAWPLDEG IDYVD  SYG++++EN LYTAN+I++  I
Sbjct: 85  FYMQTEGFRFGNKAVDKIEGDVNAWPLDEGLIDYVDKKSYGEKSDENPLYTANVISSKSI 144

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
            + +K ID + I+P+LL  L+ A G++ N+ +G+H IEFLLWGQ+L       G+RPYTD
Sbjct: 145 RIGKKTIDTTKITPELLHSLNTAGGVEANVGSGWHAIEFLLWGQNLHDPKINAGSRPYTD 204

Query: 199 FDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK-DINAGLNSIIT 257
           FD+ NCT  +C RR EYLKV +  LV+DLE+M   WGP G     L+K      L  I T
Sbjct: 205 FDLKNCTNANCDRRAEYLKVATATLVADLEDMAALWGPQGAGRTTLLKMKDKPALAVIFT 264

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           G+ SLSY ELAGERM LGLILHD E+  DCFS+NT+ S+  D +GI   Y G Y + +G 
Sbjct: 265 GLGSLSYGELAGERMKLGLILHDTEEAQDCFSNNTHNSHYYDEVGIRDIYYGRYTKPDGT 324

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE-SFDQMISENNPEGNK 376
              G S+ DLI   +  +A EI+ K    +     +KD A++ E  +DQM++E N +G +
Sbjct: 325 VFSGPSVADLIRAADPKIADEIDQKSDAALAALKKIKDTADSGEIYYDQMLAEGNVKGGQ 384

Query: 377 IVRNLINDLITQTESLRKIRIALDL 401
           ++++ ++ L+ Q  ++ +   AL L
Sbjct: 385 LIQDGVDALVAQAHAIERGVSALKL 409


>gi|298291366|ref|YP_003693305.1| peptidase M75, Imelysin [Starkeya novella DSM 506]
 gi|296927877|gb|ADH88686.1| Peptidase M75, Imelysin [Starkeya novella DSM 506]
          Length = 431

 Score =  351 bits (901), Expect = 9e-95,   Method: Composition-based stats.
 Identities = 181/385 (47%), Positives = 243/385 (63%), Gaps = 3/385 (0%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
                 +  ++  YA IA A Y D+L  A+ L SA++  +  P + NL+ A+  W  AR+
Sbjct: 29  QTQAPKVRDIVTTYADIAEAMYGDSLKTAKDLQSAVDAFLADPTEANLDKAKTAWKAARV 88

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVD-SSYGKENEENNLYTANIIANSKI 138
           PYQQ+E YRFGN IVD W+ +VNAWPLDEG IDYVD  SYG  ++EN LYTAN+IAN+KI
Sbjct: 89  PYQQTEGYRFGNAIVDDWEGRVNAWPLDEGLIDYVDKKSYGDSSDENPLYTANVIANTKI 148

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
            V +K ID + I+P LL  L  A G+++N+  GYH IEFLLWGQDL       G RP TD
Sbjct: 149 RVGKKTIDATKITPKLLDSLQEAGGVESNVAIGYHAIEFLLWGQDLNGTGPGAGKRPATD 208

Query: 199 FDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKD-INAGLNSIIT 257
           +   NCT G+C RR  YLK  + +LV+DL +M K WG  G+A   + K    A L +I+T
Sbjct: 209 YSATNCTNGNCDRRGAYLKAATDLLVADLTDMTKWWGAKGKARAAVAKQKDKAALGTILT 268

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           G+ SLSY ELAGERM LGLILHDPE+E DCFSDNTY S+  D +GI S Y G+Y R++G 
Sbjct: 269 GLGSLSYGELAGERMKLGLILHDPEEEHDCFSDNTYNSHYYDELGIASIYRGKYTRVDGS 328

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI-ESFDQMISENNPEGNK 376
            + GAS+    +      A+E + K    +     +KD  ++  E++DQMI E N  GN 
Sbjct: 329 VVEGASVAAYAAAKAPKAAEEADAKVDAALAALKAIKDEGDSGKEAYDQMIGEGNAAGNA 388

Query: 377 IVRNLINDLITQTESLRKIRIALDL 401
           +V+  ++ L+ QT ++  +  AL L
Sbjct: 389 LVQKGVDSLVAQTRAIEGVVAALKL 413


>gi|330895180|gb|EGH27518.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 366

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 151/364 (41%), Positives = 208/364 (57%), Gaps = 5/364 (1%)

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+D W+ +VNAWPLDEG 
Sbjct: 1   LSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTIIDDWEGQVNAWPLDEGL 60

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           IDYV   Y      N   TANIIAN++I V E ++D+  I+ + L  L+   G + N+ T
Sbjct: 61  IDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEKLASLNELGGSEANVAT 119

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEE 229
           GYH IEFLLWGQDL       G RP +D+  G   TGGH  RR  YLK V+ +LVSDLEE
Sbjct: 120 GYHAIEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGHNDRRRAYLKAVTDLLVSDLEE 179

Query: 230 MMKAWG---PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEID 286
           M   W    PD        +   +GL  ++ GM SLS  ELAGERM + L  +  E E D
Sbjct: 180 MSGNWKAGVPDNYRATLEAESGESGLRKMLFGMGSLSLGELAGERMKVALEANSSEDEHD 239

Query: 287 CFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNT 346
           CFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L++  +      +     +T
Sbjct: 240 CFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVRGPSLSSLVAKADPATDATLRADLDDT 299

Query: 347 MKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
                ++ D A   E FDQ+I+  N  GN++VR+ I  L+ QT ++ +    L + + N 
Sbjct: 300 QAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAALVKQTGAIEQAAGKLGITDLNP 359

Query: 407 VIGN 410
              +
Sbjct: 360 DNAD 363


>gi|170720165|ref|YP_001747853.1| hypothetical protein PputW619_0979 [Pseudomonas putida W619]
 gi|169758168|gb|ACA71484.1| conserved hypothetical protein [Pseudomonas putida W619]
          Length = 445

 Score =  351 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 158/388 (40%), Positives = 227/388 (58%), Gaps = 5/388 (1%)

Query: 27  EKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEV 86
           + V+++Y  + +A Y D+L  A++L SAI+  +  PN   L+ A+  W  AR+PY QSE 
Sbjct: 56  KAVVKHYTEMVYAVYSDSLSTAKSLQSAIDAFLAKPNDDTLKAAKEAWAAARVPYLQSEA 115

Query: 87  YRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEID 146
           +RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   ++NIIAN++I V E+++D
Sbjct: 116 FRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPAASSNIIANTEIQVGEEKVD 174

Query: 147 LSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN-CT 205
           +  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+  G   T
Sbjct: 175 VKDITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYLEGKGAT 234

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIITGMTSL 262
           GGH  RR  YLK V+++LV DLEEM+  W P+           +    GL  ++ GM SL
Sbjct: 235 GGHNERRRAYLKSVTELLVKDLEEMVGNWAPNVADNYRATLEAEPATDGLRKMLFGMGSL 294

Query: 263 SYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           S  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R +G K+ G 
Sbjct: 295 SLGELAGERMKVSLEANSPEDEQDCFSDNTHYSHFYDAKGIRNVYLGEYTRADGTKLTGP 354

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           S+  L++  +      +      T     ++ D A   E +DQ+I+ +N  GN++VR+ I
Sbjct: 355 SLSSLVAKADPAADATLKADLEATEAKLQVIVDHALKGEHYDQLIAADNAAGNQVVRDAI 414

Query: 383 NDLITQTESLRKIRIALDLIEPNRVIGN 410
             L+ QT ++ +    L +   N    +
Sbjct: 415 ASLVKQTGAIEQAAGKLGIANLNPDTAD 442


>gi|312962702|ref|ZP_07777191.1| iron-regulated protein [Pseudomonas fluorescens WH6]
 gi|311283077|gb|EFQ61669.1| iron-regulated protein [Pseudomonas fluorescens WH6]
          Length = 447

 Score =  348 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 165/395 (41%), Positives = 230/395 (58%), Gaps = 5/395 (1%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
            V   + + V+ +YA +  A Y DA   A+TL +AI+  +  PN + L+ AR  W+ AR+
Sbjct: 51  QVDETAAKAVVAHYADMVFAVYSDAESTAKTLQTAIDAFLAKPNDETLKAARAAWVAARV 110

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKII 139
           PY QSEV+RFGN I+D W+ +VNAWPLDEG IDY D SY +    N   TANIIAN++I 
Sbjct: 111 PYLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYTDKSY-EHALGNPGATANIIANTQIQ 169

Query: 140 VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
           + E +ID+ +I+P+ L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+
Sbjct: 170 IGEDKIDVKVITPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGKRPASDY 229

Query: 200 DIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSI 255
             G   TGGH  RR  YL  V+++LVSDLEEM+  W P+           +    GL  +
Sbjct: 230 LTGSGATGGHNERRRAYLSAVTQLLVSDLEEMVGNWKPNVEDNYRATLEAEPATDGLRKM 289

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           + GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI + Y GEY R++
Sbjct: 290 LFGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGIRNVYLGEYTRVD 349

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGN 375
           G K+ GAS+  L++  +      +    + T     ++ D A   E +DQ+I+  N  GN
Sbjct: 350 GTKMTGASLSSLVAKADPAADTALKADLAATEAKIQVMVDHANKGEHYDQLIAAGNEAGN 409

Query: 376 KIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           +IVR+ I  L+ QT S+      L + + N    +
Sbjct: 410 QIVRDAIAALVKQTGSIEAAAGKLGISDLNPDSAD 444


>gi|226945830|ref|YP_002800903.1| hypothetical protein Avin_37840 [Azotobacter vinelandii DJ]
 gi|171854884|dbj|BAG16626.1| iron-regulated protein-like protein homolog [Azotobacter
           vinelandii]
 gi|226720757|gb|ACO79928.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 441

 Score =  346 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 158/393 (40%), Positives = 226/393 (57%), Gaps = 5/393 (1%)

Query: 22  PNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPY 81
              +   V+ +YA +A A + D+L  A+ L  AI+ L+  P    L+ AR  WI AR+PY
Sbjct: 47  DEAAARAVVNHYADLALAVFGDSLSTAKALQQAIDALLAKPAADTLQAAREAWIAARVPY 106

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
            QSEV+RFGN +VD W+ ++NAWPLDEG IDYV + Y      N   TANIIAN++I V 
Sbjct: 107 MQSEVFRFGNPVVDEWEGQLNAWPLDEGLIDYVAADYQ-HALGNPGATANIIANTEIQVG 165

Query: 142 EKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
           E++ID++ I+ + L  L+   G + N+ TGYH IEFLLWGQDL       G RP +DF  
Sbjct: 166 EEKIDVTEITGEALASLNELAGSEANVATGYHAIEFLLWGQDLNGTAPGAGQRPASDFQA 225

Query: 202 GN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP--DGQATKDLMKDINA-GLNSIIT 257
           G  CTGGHC RR  YL+ V+ +LVSDL+ M++ W P         L KD  A GL  ++ 
Sbjct: 226 GEACTGGHCERRRAYLEAVTDLLVSDLQYMVEQWQPQVADNYRASLEKDPAANGLRKMLF 285

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           GM SLS  ELAGERM + L  +  E E DCFSDNT+ ++  +  GI + Y GEY +++G 
Sbjct: 286 GMGSLSLGELAGERMKVPLEANSTEDEQDCFSDNTHNAHFYNGKGIRNVYLGEYRKLDGS 345

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKI 377
            + G ++  L++  +      +      +      L D A   + FDQ+I+ +N  G ++
Sbjct: 346 LLSGPNLSSLVAKADAQADATLKADLEASEARLQALVDNAAKDQHFDQLIAADNAAGQQL 405

Query: 378 VRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           VR+ I  L+ QT S+ +    L + + N    +
Sbjct: 406 VRDAIAALVKQTSSIEQAAARLGIGDLNPDSAD 438


>gi|89092302|ref|ZP_01165256.1| hypothetical protein MED92_05803 [Oceanospirillum sp. MED92]
 gi|89083390|gb|EAR62608.1| hypothetical protein MED92_05803 [Oceanospirillum sp. MED92]
          Length = 427

 Score =  345 bits (884), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 179/405 (44%), Positives = 259/405 (63%), Gaps = 2/405 (0%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++   + S   +     +   +L NYA IAHA YED+L+ A+TL+  I+  + +P+
Sbjct: 7   LAAMAVSVAVLSTTQTQAAAPATTDILNNYANIAHATYEDSLLTAQTLNKVIDQFLASPS 66

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           + NL+ AR  W+ AR+PYQQSE YRFGN +VD W+ KVNAWPLDEG IDYVD+ YG E++
Sbjct: 67  EANLKKARAAWVAARVPYQQSEAYRFGNALVDDWEGKVNAWPLDEGLIDYVDAGYGSESD 126

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQ 182
           EN  YTANIIAN  + V    +D + I   LL + LH  + ++ N+ TGYH IEFLLWGQ
Sbjct: 127 ENPFYTANIIANKTLKVGGVTVDSTNIDKKLLAETLHEIDEVEANVATGYHAIEFLLWGQ 186

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           DL       GNRP +DFD+ NCTGG+C RR +YLK  +++L+ DL++M  +W  +G A +
Sbjct: 187 DLNGTNPGAGNRPASDFDLKNCTGGNCDRRRDYLKAATELLIDDLQDMTSSWANNGAARQ 246

Query: 243 D-LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
           D + K    GL +I+TGM SL+Y ELAGER  LGL++HDPE+E DCF+DNT+AS+  D +
Sbjct: 247 DLMAKGPQGGLATILTGMGSLAYGELAGERTKLGLMVHDPEEEHDCFADNTHASHFYDAL 306

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           GI + Y GEY R++G K+ GAS+  L++     + Q + +K   T     ++ D A    
Sbjct: 307 GIKNVYLGEYTRVDGSKVSGASLSQLVNAEAPVVDQNLRNKLDATQAAAQVMVDEAAKGN 366

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           +FD +I ENN  GN++V+  ++ L+ + E++      L L     
Sbjct: 367 TFDVLIGENNAAGNQVVQTFVDALVAEAEAIEHTIAVLKLDGIEL 411


>gi|153827295|ref|ZP_01979962.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae MZO-2]
 gi|149738786|gb|EDM53128.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae MZO-2]
          Length = 379

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 152/376 (40%), Positives = 217/376 (57%), Gaps = 6/376 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKKAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 303

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  +F         L   A
Sbjct: 304 YNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQQFEAARTQVGELVTAA 363

Query: 358 E-NIESFDQMISENNP 372
           E N + FDQ+I+ +N 
Sbjct: 364 EKNNQHFDQLIAADNA 379


>gi|110833100|ref|YP_691959.1| hypothetical protein ABO_0239 [Alcanivorax borkumensis SK2]
 gi|110646211|emb|CAL15687.1| Uncharacterized iron-regulated protein [Alcanivorax borkumensis
           SK2]
          Length = 429

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 168/418 (40%), Positives = 225/418 (53%), Gaps = 11/418 (2%)

Query: 3   FITIISIVFTLPSHALSIVPNVSL-------EKVLQNYATIAHAKYEDALMCARTLDSAI 55
            +              S    V+        +KV+ +YA +A A Y DAL  AR L + I
Sbjct: 10  LLLATLFFSACSDEPQSSGAVVAQAYDQTQGKKVVSHYADVALATYTDALAEARKLKTQI 69

Query: 56  ETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVD 115
           + L+  P + +L  AR  W  AR+PY QSEV+RFGN +VD W+ +VNAWPLDEG IDYVD
Sbjct: 70  DALLAAPTEDSLTAARDAWRAARVPYMQSEVFRFGNVVVDEWEGQVNAWPLDEGLIDYVD 129

Query: 116 SSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVI 175
             Y      N    ANIIA+  + + E+ +DL+ +S +LL  L+   G + N+ TGYH I
Sbjct: 130 EDY-HAVMGNPGARANIIASESLKIGEQALDLTDLSAELLASLNELGGSEVNVATGYHAI 188

Query: 176 EFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW 234
           EFLLWGQDL       G RP TDF  G   TGGH  RR EYL VV+ +L++DLE M+  W
Sbjct: 189 EFLLWGQDLNGTDAGAGERPATDFATGPQATGGHNARRREYLSVVTDLLINDLEVMVDEW 248

Query: 235 GPD--GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNT 292
            P       +     +  GL  ++ GM SLS  ELAGERM + L  H PE E DCFSDNT
Sbjct: 249 RPGEENYRAELEADSVENGLRKMLFGMGSLSLGELAGERMKVALAAHSPEDEHDCFSDNT 308

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHI 352
           +AS+  +  GI + Y GEY R+NGE + G S+ DL++ N   +  ++      +      
Sbjct: 309 HASHFYNGKGIRNVYLGEYRRVNGETLTGPSLSDLVAANKPAIDNQLKADLEASRAALQG 368

Query: 353 LKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           L D A     FDQ+I+  N EG   V   I+ L+ QT S+      L++   N    N
Sbjct: 369 LVDSANKGIHFDQLIAPGNSEGAATVNAAIDTLVAQTTSIEAAAAVLNIQALNPDTAN 426


>gi|70732153|ref|YP_261909.1| putative lipoprotein [Pseudomonas fluorescens Pf-5]
 gi|68346452|gb|AAY94058.1| lipoprotein, putative [Pseudomonas fluorescens Pf-5]
          Length = 446

 Score =  341 bits (875), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 167/405 (41%), Positives = 233/405 (57%), Gaps = 5/405 (1%)

Query: 10  VFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
             T  + A   V   + + V+ +YA +  A Y D+   A+TL +AI+  +  PN   L+ 
Sbjct: 40  TATPAADAAGKVDEAAAKAVVAHYADMVFAVYSDSESTAKTLQTAIDAFLAKPNDDTLKA 99

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           A+  W+ AR+PY QSEV+RFGN I+D W+ +VNAWPLDEG IDYVD SY +    N   T
Sbjct: 100 AKAAWVAARVPYLQSEVFRFGNTIIDDWEGQVNAWPLDEGLIDYVDKSY-EHALGNPGAT 158

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
           ANIIAN++I V E ++D+  I+P+ L  L+   G + N+ TGYH IEFLLWGQDL     
Sbjct: 159 ANIIANTEIQVGEDKVDVKDITPEKLASLNELGGAEANVATGYHAIEFLLWGQDLNGTGP 218

Query: 190 EPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLM 245
             G RP +D+  G   TGGH  RR  YLK V+++LV+DLEEM+  W PD           
Sbjct: 219 GAGARPASDYLEGAGATGGHNDRRRAYLKAVTQLLVNDLEEMVGNWKPDVADNYRATLEA 278

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIIS 305
           +    GL  ++ GM SLS  ELAGERM + L  + PE E DCFSDNT+ S+  D  GI +
Sbjct: 279 EPAETGLRKMLFGMGSLSLGELAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGIRN 338

Query: 306 SYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQ 365
            Y GEY R +G K+ GAS+  L++  +      +    + T     ++ D A   E +DQ
Sbjct: 339 VYLGEYTRTDGTKMSGASLSSLVAKADPAADAALKADLAATEAKIQVMVDHANKGEHYDQ 398

Query: 366 MISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           +I+  N  GN+IVR+ I  L+ QT S+ +    L + + N    +
Sbjct: 399 LIAAGNESGNQIVRDAIAALVKQTGSIEQAAGKLGISDLNPDNAD 443


>gi|254427956|ref|ZP_05041663.1| hypothetical protein ADG881_1186 [Alcanivorax sp. DG881]
 gi|196194125|gb|EDX89084.1| hypothetical protein ADG881_1186 [Alcanivorax sp. DG881]
          Length = 429

 Score =  335 bits (859), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 163/399 (40%), Positives = 223/399 (55%), Gaps = 4/399 (1%)

Query: 15  SHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
           +           ++V+ +YA +A A + DAL  AR L + I+ L+  P + NL  AR  W
Sbjct: 29  ADTAPAYDQAQGKRVVSHYADVALATFGDALSGARALKTQIDALLAAPTEANLAAARDAW 88

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
             AR+PY Q+EV+RFGN +VD W+ +VNAWPLDEG IDYVD  Y      N    ANIIA
Sbjct: 89  RAARVPYMQTEVFRFGNAVVDEWEGQVNAWPLDEGLIDYVDEDYQ-AVMGNPGARANIIA 147

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNR 194
           +  + + E+ +DL+ ++ +LL  L+   G + N+ TGYH IEFLLWGQDL       G R
Sbjct: 148 SESLKIGEQTLDLTDLNAELLASLNELGGSEVNVATGYHAIEFLLWGQDLNGTDAGAGQR 207

Query: 195 PYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDINAG 251
           P TDF  G + TGGH  RR EYL VV+ +L+ DLE M+  W P       +     +  G
Sbjct: 208 PATDFATGPDATGGHNERRREYLSVVTDLLIDDLEVMVDEWRPGEENYRAELEADSVENG 267

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L  ++ GM SLS  ELAGERM + L  H PE E DCFSDNT+AS+  +  GI + Y GEY
Sbjct: 268 LRKMLFGMGSLSLGELAGERMKVALAAHSPEDEHDCFSDNTHASHFYNGKGIRNVYLGEY 327

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENN 371
            R NGE + G S+ DL++ N      ++    + +     +L D A     FDQ+I+  N
Sbjct: 328 QRTNGETLAGPSLSDLVAANQPAADSQLKTDLNASEAALQVLVDSANQGTHFDQLIAPGN 387

Query: 372 PEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
            +G   V   I+ L+ QT S+ K    L++   N    N
Sbjct: 388 AQGADTVNAAIDALVVQTTSIEKAARVLNIQALNPDTAN 426


>gi|88799522|ref|ZP_01115099.1| putative iron-regulated protein A [Reinekea sp. MED297]
 gi|88777832|gb|EAR09030.1| putative iron-regulated protein A [Reinekea sp. MED297]
          Length = 407

 Score =  323 bits (826), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 153/407 (37%), Positives = 238/407 (58%), Gaps = 12/407 (2%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M  +  ++++    +HA      ++ + V++ Y  IA+  Y DAL  A  L S IE LV 
Sbjct: 1   MKHLIAVTLLAAGVAHA-----EITSQDVVEGYTDIAYTNYADALQTAEALQSTIENLVD 55

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P+ + L  A+  W+ AR  YQQSEV+RFGN +VD W+ ++NAWPLDEG IDYVD    +
Sbjct: 56  HPSAEALAAAKAAWLEARPSYQQSEVFRFGNAVVDDWEGQLNAWPLDEGLIDYVDDRAYE 115

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
               N+  TAN++AN ++     ++ +S + P+ L  L+   G + N+ TGYH IEFLLW
Sbjct: 116 FELGNDGGTANLVANKRV----GDLKVSRLKPETLASLNEFGGSEANVATGYHAIEFLLW 171

Query: 181 GQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           GQDL  +    G RP+TD+  G +CT  +C+RR +YL+  +++LV DLE M+  W PDG 
Sbjct: 172 GQDLNGHQAGAGERPWTDYAKGNDCTNENCKRRGQYLEAAAELLVEDLEYMVAQWAPDGD 231

Query: 240 ATKDLM-KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
             + L+ +D    LN ++ GM SL+  ELAGER+ + L  +  E E DCFSDNT+ S+  
Sbjct: 232 YRQQLLQEDEQTVLNKMLFGMGSLALGELAGERIKVALTANSTEDEHDCFSDNTHNSHYY 291

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHD-LISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
           +  G+ + Y G Y   +GE      + D L+ + + +L  + +  F+ T +    +  RA
Sbjct: 292 NAKGVANLYFGSYTNADGETTRVVGLRDLLLVNGHADLIADADRAFAATQQSMAAMVTRA 351

Query: 358 ENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEP 404
           EN E+FDQMI+  N  G  ++ + IN L+ +T ++  + +AL + + 
Sbjct: 352 ENGEAFDQMIAPGNTSGAALLNDAINRLVEETAAIESMALALGIEQL 398


>gi|254226417|ref|ZP_04920004.1| iron-regulated protein A, putative [Vibrio cholerae V51]
 gi|125621039|gb|EAZ49386.1| iron-regulated protein A, putative [Vibrio cholerae V51]
          Length = 346

 Score =  316 bits (809), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 136/328 (41%), Positives = 193/328 (58%), Gaps = 5/328 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IA+A Y D+ + A+ L   I+  +  
Sbjct: 20  SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAYAVYADSRVTAQQLQKTIDRFLQA 79

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 80  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 139

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 140 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 198

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 199 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 258

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E E DCFSDNT+ S+ 
Sbjct: 259 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDNTHNSHY 318

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIH 325
            +  GI + YTG Y R +G ++ G S++
Sbjct: 319 YNEQGIYNIYTGSYTRADGSELKGPSLY 346


>gi|300021838|ref|YP_003754449.1| peptidase M75, Imelysin [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523659|gb|ADJ22128.1| Peptidase M75, Imelysin [Hyphomicrobium denitrificans ATCC 51888]
          Length = 427

 Score =  316 bits (809), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 166/400 (41%), Positives = 247/400 (61%), Gaps = 7/400 (1%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           T +++   +   A +  P V  + + + Y  +A A Y D+L  A+ LD AI+  +  P+ 
Sbjct: 12  TGLALAGAVARPAFADAPAV--KDITKTYGDLAEAMYSDSLAKAKDLDKAIDAFLAAPDA 69

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVD-SSYGKENE 123
              + A+  W  ARIPY Q+E +RFGNKIVD W+  VN+WPLDEG IDYVD +SYG   E
Sbjct: 70  TTQKAAQDAWKAARIPYMQTEGFRFGNKIVDDWEGNVNSWPLDEGLIDYVDKASYGDAKE 129

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
           EN LYTANIIAN  + +  K +D S I   ++ +L+ A  +++N+ TGYH IEFLLWGQ+
Sbjct: 130 ENPLYTANIIANKSVRLGPKVLDASKIDKTVIAQLNSALEVESNVGTGYHAIEFLLWGQN 189

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
           L       G RP +DFD+ NCT  +C RR +YLK  S +L+ DL EM   W   G A + 
Sbjct: 190 LHGTSAGAGERPASDFDLKNCTHDNCDRRRDYLKAASSLLIDDLSEMAGNWKAGGAAREA 249

Query: 244 L-MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
           L  +D NA L++I+TG+ SLSY ELAGERM LG++LHDPE+  DCFS+NT+ S+  D +G
Sbjct: 250 LSKQDANAQLSTILTGIGSLSYGELAGERMKLGVLLHDPEEAHDCFSNNTHNSHYYDQVG 309

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE- 361
           +I  + G+Y       + GASI +L      + A+ +++   NT    + +K +A++ E 
Sbjct: 310 MIEIWNGKYDGA--TAVSGASIAELARAKAPDAAKRVDEAMENTKAKLNAIKVKADSGEM 367

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            ++QM++  N  GNK++ + ++ L+ Q  ++  +  AL+L
Sbjct: 368 GYNQMLAAGNDAGNKLILDGVDALVAQARAVEAVVAALNL 407


>gi|83643091|ref|YP_431526.1| putative iron-regulated protein [Hahella chejuensis KCTC 2396]
 gi|83631134|gb|ABC27101.1| uncharacterized iron-regulated protein [Hahella chejuensis KCTC
           2396]
          Length = 459

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 149/445 (33%), Positives = 227/445 (51%), Gaps = 40/445 (8%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           F   + +       A S    V  ++V+ ++A +AHA Y D+L  A  L+ +I+  + TP
Sbjct: 11  FAVPLLMSACAGHQASSTSQVVEPKQVVDHFANMAHAMYADSLQAATQLNKSIDVFLATP 70

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRF---------------GNKIVDTWDKKVNAWPLD 107
            + NL+ A+  + +AR+PYQQSEV RF               G   +D W+ +VNAWPLD
Sbjct: 71  TQANLDAAKAAYAQARVPYQQSEVLRFDVENGHVTEGLDADGGLASIDAWEGQVNAWPLD 130

Query: 108 EGFIDYVDSSYGKENEENNLYTANIIANSK-IIVNEKEIDLSIISPDLLRKLHRANGIDT 166
           E  IDYV  SY    E       NII ++    V  + ID+S I+P+L+  ++   G + 
Sbjct: 131 EALIDYVSGSY----EGEYNSPKNIINSTGVFTVGGQSIDISTITPELIAGMNEIGGAEA 186

Query: 167 NITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF----DIGNCTGGH-------CRRRVEY 215
           N+T+G H IEFLLWGQDL       G RP +D+      G CT G        C+RR +Y
Sbjct: 187 NVTSGVHAIEFLLWGQDLNGTGPGAGARPVSDYYTDSSQGACTSGDKKSDYKICQRRAQY 246

Query: 216 LKVVSKILVSDLEEMMKAWGPDGQATKDLMKDI----NAGLNSIITGMTSLSYNELAGER 271
           LK  + +LVSDL+ M   W P   A K  +++       GL  I+  M  ++  ELA ER
Sbjct: 247 LKAAADLLVSDLQAMEAEWTPAAGAKKGTLRNDFLTRGDGLQRILDSMGDMAIGELASER 306

Query: 272 MNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN 331
           M + ++    E E DCFSD T+ +  N+ +G++ +Y G Y R++G  + G SI DL++H+
Sbjct: 307 MKVAILFGSTEDEHDCFSDLTHIAIYNNAMGVVDAYRGSYARLDGSVVSGPSIADLVAHH 366

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAE---NIESFDQMISENNPEGNKIVRNLINDLITQ 388
           N  L Q++++  S        + D+AE     + FDQ++   + E  K+V +    L++ 
Sbjct: 367 NPALKQQMDEHMSLIESRMRAIVDKAEAKSGGKKFDQLVG-GSAEDKKLVLDAAAALVSL 425

Query: 389 TESL-RKIRIALDLIEPNRVIGNVP 412
            E L   +   L L       G  P
Sbjct: 426 EEPLSEGVSKVLALSLQEFDAGTCP 450


>gi|160896972|ref|YP_001562554.1| putative iron-regulated protein [Delftia acidovorans SPH-1]
 gi|160362556|gb|ABX34169.1| putative iron-regulated protein [Delftia acidovorans SPH-1]
          Length = 428

 Score =  301 bits (770), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 122/389 (31%), Positives = 198/389 (50%), Gaps = 37/389 (9%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
           S+ +V+++Y T+ HA Y D++  A+T+  AI   +  P+++ L  AR  W+ AR  Y Q+
Sbjct: 66  SVAEVVKHYGTLVHANYSDSISSAKTMQKAIAAFLAAPSEQGLNQARKAWLDAREYYGQT 125

Query: 85  EVYRFGNKIVDT---WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
           E +RF    +D     + ++NAWP+DE ++DYV+ +            A II N K    
Sbjct: 126 EAFRFYAGPIDNDQGPEGQINAWPMDESYVDYVEGN----------PNAGIINNRK---- 171

Query: 142 EKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
                   I+   L +L+  +G + N++TG+H IEF+LWGQDL       G RPYTDF  
Sbjct: 172 ------EAITKKRLAELNEHDGEE-NVSTGWHAIEFMLWGQDLNDKGP--GARPYTDFVD 222

Query: 202 GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDINAGLNSIITGM 259
           G  +  +  RR EYLKVV+ +L+ DL+ +   W P           K  +  L  I  G+
Sbjct: 223 GKKS--NADRRREYLKVVTALLIEDLQSVADQWKPGSPKNFRAQFEKKPDDALRRIFVGL 280

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            SLS  ELAGER+ + L   D E E  CFSDNT+   + +  GI++ + G Y R++G ++
Sbjct: 281 GSLSRGELAGERLEVALASRDQEDEHSCFSDNTHRDAVTNAQGILNVWQGSYKRLDGSEL 340

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI-SENNPEGNKIV 378
            G  I D ++  +  LA     + + +++    +         FDQ I    +      +
Sbjct: 341 QGPGIKDWVASKDSALADRTTRQITQSVQAAQAIPAP------FDQAIQGARDSASRAKI 394

Query: 379 RNLINDLITQTESLRKIRIALDLIEPNRV 407
           +  I+ L+ Q++ L +   A+ + + N V
Sbjct: 395 QATIDSLVQQSKDLVEAANAVGITQLNLV 423


>gi|330957925|gb|EGH58185.1| putative lipoprotein [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 324

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 130/322 (40%), Positives = 177/322 (54%), Gaps = 5/322 (1%)

Query: 93  IVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISP 152
           I+D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ 
Sbjct: 1   IIDDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITA 59

Query: 153 DLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRR 211
           D L  L+   G + N+ TGYH IEFLLWGQDL       GNRP +D+  G   TGGH  R
Sbjct: 60  DKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYLEGAGATGGHNDR 119

Query: 212 RVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIITGMTSLSYNELA 268
           R  YLK V+ +LVSDLEEM   W              +   +GL  ++ GM SLS  ELA
Sbjct: 120 RRAYLKAVTDLLVSDLEEMSGNWRAGVADNYRATLEAESGESGLRKMLFGMGSLSLGELA 179

Query: 269 GERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLI 328
           GERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+  L+
Sbjct: 180 GERMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLSSLV 239

Query: 329 SHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQ 388
           +  +      +     +T      + D A   E FDQ+I+  N  GN++VR+ I  L+ Q
Sbjct: 240 AKVDPATDATLRADLDDTQAKLQAIVDHASKGEHFDQLIASGNTAGNQVVRDAIAALVKQ 299

Query: 389 TESLRKIRIALDLIEPNRVIGN 410
           T ++ +    L + + N    +
Sbjct: 300 TGAIEQAAGKLGITDLNPDNAD 321


>gi|326318038|ref|YP_004235710.1| peptidase M75, Imelysin [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323374874|gb|ADX47143.1| Peptidase M75, Imelysin [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 409

 Score =  289 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 115/400 (28%), Positives = 192/400 (48%), Gaps = 35/400 (8%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           +         + +   V  +YA + HA YED L  ART+ +AI+     P+ + L  AR 
Sbjct: 38  VAQAGGKQATSATPAAVAAHYAVLVHANYEDTLNAARTMQAAIKAFTARPSAETLAEARK 97

Query: 73  QWIRARIPYQQSEVYRFGNKIVDT---WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
            W+ AR  Y Q+E +RF    +D     + ++NAWP+DE ++D V+              
Sbjct: 98  TWLAAREFYGQTEAFRFYGGPIDDDKGPEGQLNAWPMDESYVDSVEG----------RPD 147

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
           + ++ + K            I+   L   +   G + N+ TG+H IEF LWGQDL     
Sbjct: 148 SGLVNDRKF----------AITKKNLAAQNERGGEE-NVATGWHAIEFFLWGQDLSETGP 196

Query: 190 EPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKD 247
             G+R + DF  G   G +  RR +YL VV+ +L+ DL  ++KAW P          +K 
Sbjct: 197 --GDRNFEDFVDGK--GRNADRRRQYLNVVTDLLIDDLASLVKAWDPKTPNNYRAKFVKG 252

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSY 307
               +  ++ G+ SLS  ELAGER+ + L   D E E  CFSDNT+   + + +GI + +
Sbjct: 253 GQESVRKMLVGLGSLSRGELAGERLEVALNSQDQEDEHSCFSDNTHRDAVTNALGIRNVW 312

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI 367
            GEY R +G  + GAS+ DL++  +  LA     + + ++K    ++   +      ++I
Sbjct: 313 LGEYRRADGSLVQGASLRDLVAAKDAALADRTTQQIAASVKAAEGIQAPFDR-----EII 367

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRV 407
              +  G   ++  I+ L  Q++ L +   A+ + +   V
Sbjct: 368 GGKDAPGRLRIQKTIDSLTQQSKDLVEAANAIGITKLTLV 407


>gi|124007535|ref|ZP_01692240.1| insulin-cleaving metalloproteinase outer membrane protein
           [Microscilla marina ATCC 23134]
 gi|123987018|gb|EAY26774.1| insulin-cleaving metalloproteinase outer membrane protein
           [Microscilla marina ATCC 23134]
          Length = 392

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 129/419 (30%), Positives = 185/419 (44%), Gaps = 45/419 (10%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVS---LEKVLQNYATIAHAKYEDALMCARTLDSAIET 57
           +  +  + ++        +  P      + +VL+ YA IAH  Y D+      L ++I+ 
Sbjct: 7   LPLLVFVMLLNACKKKEETTPPTPDATQVAEVLETYAKIAHQSYSDSYDKVVALKTSIDA 66

Query: 58  LVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT----WDKKVNAWPLDEGFIDY 113
            V  P++   + A+  W  AR PY Q+EV+RF    +D      +  +NAWPLDE FIDY
Sbjct: 67  FVANPDQAKFDAAKQAWKDAREPYGQTEVFRFYEGPIDNSATGPEGAINAWPLDENFIDY 126

Query: 114 VDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYH 173
           V  +           TA II +              I    LR  +   G + NI+ GYH
Sbjct: 127 VAGN----------ATAGIINDLT----------QTIDAATLRGNNEKGG-EKNISIGYH 165

Query: 174 VIEFLLWGQDLKTNV--REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMM 231
            IEFLLWGQD          G R +TD+     T  +  RR  YL V   +L+ DL+ + 
Sbjct: 166 AIEFLLWGQDTNPGGDYSNAGQRAFTDYT----TATNADRRKTYLHVTIDLLLEDLKTVR 221

Query: 232 KAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDN 291
            AW          + D N  +  I+TGM SLS  ELAGERM + L  HD E E  CFSDN
Sbjct: 222 DAWAEGASYRTSFVADGNKSIVRILTGMGSLSEAELAGERMKVALFNHDQEDEHSCFSDN 281

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH 351
           T+   + +  GI + Y G Y       + G  I  L+   ++ L  +I  +   T     
Sbjct: 282 THRDIVTNAQGIYNVYWGTYG-----SVTGKGIASLVEVVDKELYAQIKTELEATKAATL 336

Query: 352 ILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
            ++        FD+ IS+ N  GN+ V   I  L  QT S+  I   L+L        +
Sbjct: 337 AIQAP------FDKEISQGNTAGNQRVEVAITALRAQTRSIESIAQKLNLGNLTLETSD 389


>gi|149927624|ref|ZP_01915877.1| iron-regulated protein A, putative [Limnobacter sp. MED105]
 gi|149823678|gb|EDM82906.1| iron-regulated protein A, putative [Limnobacter sp. MED105]
          Length = 389

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 113/411 (27%), Positives = 199/411 (48%), Gaps = 40/411 (9%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +  +++ F         V   S + V++ Y  + +A Y D+++ A+ L S+I+  +  P
Sbjct: 13  MVAGLALAFC-----NVAVAAPSDQDVVKGYGQLVYANYTDSVIAAQKLQSSIDAFLKAP 67

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT---WDKKVNAWPLDEGFIDYVDSSYG 119
           ++  LE A+  W+ AR  Y Q+E +RF    +D     + ++NAWP+DE ++DYV  +  
Sbjct: 68  SEAGLEAAKKAWLNAREFYGQTEAFRFYGGPIDDENGPEGQINAWPMDESYVDYVQGN-- 125

Query: 120 KENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
                     +  I N +  ++   +                 G + NI TG+H IEFLL
Sbjct: 126 --------ARSGFINNPEFKISRDALIEEN-----------ERGGEENIATGWHAIEFLL 166

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD-- 237
           WGQDL  N    G RPYTD+  G   G +  RR  YL+ ++ +L+ DL+ +  AW P   
Sbjct: 167 WGQDLNENGP--GQRPYTDYVKGK--GQNAERRATYLREITALLIHDLQTVQSAWAPKKP 222

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYL 297
                +  KD    +  I+ G+ SLS  ELAGER+ + L   D E E  CFSDNT+   +
Sbjct: 223 DNFRANFEKDGKESIRKILVGLGSLSRGELAGERLEVALFSQDQEDEHSCFSDNTHRDAV 282

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
            +  GI++ +TG Y + +G  +   S+ +L+      +A++   +  N++K    ++   
Sbjct: 283 TNAQGILNVWTGTYKQADGAVLKVPSLAELVGARAPEVAKKTTQQIQNSVKAASAIQAPF 342

Query: 358 ENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVI 408
           +      ++I   N  G + V+  ++ L+ Q+  L +   A+ + +    +
Sbjct: 343 DR-----EIIGGANAPGPQRVKATVDSLVEQSTLLVESANAIGITQLTLTL 388


>gi|124266651|ref|YP_001020655.1| iron-regulated protein A [Methylibium petroleiphilum PM1]
 gi|124259426|gb|ABM94420.1| iron-regulated protein A, putative [Methylibium petroleiphilum PM1]
          Length = 399

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 118/381 (30%), Positives = 189/381 (49%), Gaps = 35/381 (9%)

Query: 32  NYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGN 91
           +YA + HA YED+L  AR L  A+   V TP+ + L  AR +W+ AR  Y Q+E +RF  
Sbjct: 47  HYAVLVHANYEDSLQAARALQQAVVAFVATPSAEALAEARKRWLAAREFYGQTEAFRFYG 106

Query: 92  KIVDT---WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
             +D     + ++NAWP+DE F+D V    G          + +I N K           
Sbjct: 107 GPIDDDKGPEGRINAWPMDESFVDGVQGKPG----------SGLIGNRKF---------- 146

Query: 149 IISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGH 208
           +IS   L   +   G + NI TG+H IEFLLWGQD        G+R + DF  G     +
Sbjct: 147 VISKKNLAAQNERGGEE-NIATGWHAIEFLLWGQDRSETGP--GDRSFEDFVDGKAP--N 201

Query: 209 CRRRVEYLKVVSKILVSDLEEMMKAWGP--DGQATKDLMKDINAGLNSIITGMTSLSYNE 266
             RR +YL VV+++L+ DL  ++KAW P   G       +     +  I+ G+ SLS  E
Sbjct: 202 ADRRRQYLTVVTELLIDDLAGLVKAWAPATKGNYRARFEQGGKESVRKILVGLGSLSRGE 261

Query: 267 LAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD 326
           LAGER+ + L   D E E  CFSDNT+   +N+  GI + + G Y+R +G  + GAS+ +
Sbjct: 262 LAGERLEVALNSQDQEDEHSCFSDNTHRDAVNNAKGIENVWLGRYVRADGSTLQGASLRE 321

Query: 327 LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLI 386
           L++  +  LA+    + + ++     ++   +      +++   +  G + ++  I  L 
Sbjct: 322 LVAEKDAALAERGTRQIAASVAAAEAIQAPFDR-----EIVGAKDAPGRQRIQKTIASLT 376

Query: 387 TQTESLRKIRIALDLIEPNRV 407
            Q++ L     A+ + +   V
Sbjct: 377 QQSKDLVAAANAVGITKLTLV 397


>gi|332529697|ref|ZP_08405651.1| iron-regulated protein A [Hylemonella gracilis ATCC 19624]
 gi|332040718|gb|EGI77090.1| iron-regulated protein A [Hylemonella gracilis ATCC 19624]
          Length = 418

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 122/425 (28%), Positives = 204/425 (48%), Gaps = 52/425 (12%)

Query: 4   ITIISIVFTLPSHALS--------IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAI 55
           ++ ++     P+H  +            V+ + V+ +YAT+ HA YED L+ A  L  ++
Sbjct: 25  LSSLNAAAQTPAHTPAGKVETAAAPAAAVTAKTVVAHYATLVHANYEDTLLAALELQKSV 84

Query: 56  ETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT---WDKKVNAWPLDEGFID 112
              +  P++  LE AR  W+ AR  Y Q+E +RF    +D     + ++NAWP+DE ++D
Sbjct: 85  RAFIAAPSQARLEAARKAWLDAREVYGQTEAFRFYGGPIDDEEGPEGRINAWPMDESYVD 144

Query: 113 YVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGY 172
            VD   G          + +I + K            I+   L + +  +G + NI TG+
Sbjct: 145 GVDGKPG----------SGLINDRKFK----------ITKASLSEANEKDGEE-NIATGW 183

Query: 173 HVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMK 232
           H IEF+LWGQDL  N    G R +TDF  G     +  RR  YL VV+ +L+ DL  +++
Sbjct: 184 HAIEFMLWGQDLDDNGP--GQRAHTDFVDGKTP--NADRRRLYLNVVTDLLIDDLRFLVQ 239

Query: 233 AWGP-----DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDC 287
           AW P              +  +  +  II G+ SLS  EL+GERM + L   D E E  C
Sbjct: 240 AWTPAKAGAKKNYRVTFEQGGSESVRKIIVGLGSLSRGELSGERMEVALNTQDQEDEHSC 299

Query: 288 FSDNTYASYLNDVIGIISSYTGEYIRMNG----EKIHGASIHDLISHNNRNLAQEINDKF 343
           FSDNT+   + +  GI + + G Y R  G    + + G S+  L++  ++ LA  +  + 
Sbjct: 300 FSDNTHRDIVANATGIQNVWLGSYKRRPGAKGPQTLEGPSLRALVAAKDKALADRVTAQI 359

Query: 344 SNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           + ++ D   +         FD+ I + +P G  +++  I  L+ Q++ L +   A+ + +
Sbjct: 360 AQSVADAERIPAP------FDRAILDGSP-GQPLIKKTIASLVEQSKLLVESASAIGITQ 412

Query: 404 PNRVI 408
              V 
Sbjct: 413 LTLVE 417


>gi|93006910|ref|YP_581347.1| hypothetical protein Pcryo_2086 [Psychrobacter cryohalolentis K5]
 gi|92394588|gb|ABE75863.1| imelysin. Metallo peptidase. MEROPS family M75 [Psychrobacter
           cryohalolentis K5]
          Length = 482

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 138/436 (31%), Positives = 213/436 (48%), Gaps = 42/436 (9%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
             S   S      ++++L +YA +AHA Y+D+L  A+ L SA+ T V TP + NL+ A+ 
Sbjct: 49  TASKTSSAADKAHMDRLLISYADMAHAAYKDSLEMAKLLQSAVNTYVETPTQANLDAAKA 108

Query: 73  QWIRARIPYQQSEVYRFGN-----------KIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
            +  AR PY Q+EV+RF                D+W+ +VNAWPLDE  IDYV + Y   
Sbjct: 109 AYKAARQPYSQTEVFRFDEGFVTANDNRNIGSTDSWEGQVNAWPLDEALIDYVSADY--- 165

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
            E       NII +  I V   + D S I+P+LL +++   G ++N+TTGYH IEF+LWG
Sbjct: 166 -EGEYNSKDNIINSDSISVGSLKQDTSTITPELLAEMNEIGGSESNVTTGYHAIEFMLWG 224

Query: 182 QDLKTNVREPGNRPYTDF--DIGNCTGGH--------CRRRVEYLKVVSKILVSDLEEMM 231
           QD        GNRP++D+    G CT G         C RR +YLK  +++LV DL  M 
Sbjct: 225 QDTNGVAEGAGNRPFSDYLMTDGQCTSGESVNPEASICERRGQYLKAATQLLVDDLTAME 284

Query: 232 KAWGPDGQ---ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCF 288
             W PD +    +  + +  +  L  I+  M SL+  ELA +R+ +  +    E E +CF
Sbjct: 285 AQWQPDSENTLRSDMMARRDSNSLRQIMYQMGSLALGELASQRIQVAFVTGSTEDEHECF 344

Query: 289 SDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLI-SHNNRNLAQEINDKFSNTM 347
           SD T+ SY N+  GI + + G Y  + G+ + G  + + +    N   A ++   F+   
Sbjct: 345 SDLTHLSYANNARGIQNVFNGSYKTVAGKTVGGYGLKNYLIDTGNTEAADKLAADFAKVE 404

Query: 348 KDFHILKDRAEN-IESFDQMISENN---------PEGNKI---VRNLINDLITQTESLRK 394
             F+++ ++ E      DQMI+             E NK    +   I  L   T  +  
Sbjct: 405 AAFNVIVEKGEKENIKIDQMIATVGQASKHGVSAEEQNKRRGWIETSITSLQELTAGIEN 464

Query: 395 IRIALDLIEPNRVIGN 410
              A+ +   +   G+
Sbjct: 465 AAKAVGIDNLDADAGS 480


>gi|120610605|ref|YP_970283.1| putative iron-regulated protein [Acidovorax citrulli AAC00-1]
 gi|120589069|gb|ABM32509.1| putative iron-regulated protein [Acidovorax citrulli AAC00-1]
          Length = 407

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 111/381 (29%), Positives = 186/381 (48%), Gaps = 35/381 (9%)

Query: 32  NYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGN 91
           +YA + HA Y DAL  A+T+ +AI      P+ + L  AR  W+ AR  Y Q+E +RF  
Sbjct: 55  HYAVLVHANYADALAAAKTMQAAIRAFTAKPSAETLAEARKTWLAAREFYGQTEAFRFYG 114

Query: 92  KIVDT---WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
             +D     + ++NAWP+DE ++D V+              A ++ + K           
Sbjct: 115 GPIDDDKGPEGQINAWPMDESYVDSVEG----------RPDAGLVNDRKF---------- 154

Query: 149 IISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGH 208
            I+   L   +   G + N+ TG+H IEF LWGQDL       G+R   DF  G   G +
Sbjct: 155 AITKKNLAAQNERGGEE-NVATGWHAIEFFLWGQDLSETGP--GDRNVDDFVDGK--GKN 209

Query: 209 CRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDINAGLNSIITGMTSLSYNE 266
             RR +YL VV+ +L+ DL  +++AW P          ++     +  ++ G+ SLS  E
Sbjct: 210 ADRRRQYLNVVTDLLIDDLSFLVQAWDPKVPNNYRAKFVRGGQESVRKMLVGLGSLSRGE 269

Query: 267 LAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD 326
           LAGER+ + L   D E E  CFSDNT+   + + +GI + + GEY R +G  + GAS+ D
Sbjct: 270 LAGERLEVALNSQDQEDEHSCFSDNTHRDAVTNALGIRNVWLGEYKRADGSLVKGASLRD 329

Query: 327 LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLI 386
           L++  +  LA     + + +++    ++   +      ++I   +  G   ++  I+ L 
Sbjct: 330 LVAAKDAALAGRTTRQIAASVEAAEGIQAPFDR-----EIIGGKDAPGRLRIQKTIDSLT 384

Query: 387 TQTESLRKIRIALDLIEPNRV 407
            Q++ L +   A+ + +   V
Sbjct: 385 QQSKDLVEAANAIGITKLTLV 405


>gi|262197051|ref|YP_003268260.1| peptidase M75, Imelysin [Haliangium ochraceum DSM 14365]
 gi|262080398|gb|ACY16367.1| Peptidase M75, Imelysin [Haliangium ochraceum DSM 14365]
          Length = 441

 Score =  276 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 129/413 (31%), Positives = 190/413 (46%), Gaps = 48/413 (11%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
                 A   V  VS  +V+++YATI HA Y+DAL  A  L S I+  +  P     E  
Sbjct: 50  AGADVDAAPPVAQVSRAEVVEHYATIVHANYKDALDRALHLQSTIDLFLAEPTASRFETV 109

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDT---WDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           +  W+ AR+PY QSE YRF    +D     + ++NAWP+DE ++DYV     +E      
Sbjct: 110 KRAWLEARVPYGQSEAYRFYEGPIDDADGPEGQLNAWPMDEAYVDYVIDPQTEETI---- 165

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGI-----------DTNITTGYHVIE 176
               I+ + +            I+ + L  L+                +  ++TGYH IE
Sbjct: 166 -ITGIVNDPE----------REITKEALASLNEGGEGDIFDGGDNFDPEKAVSTGYHAIE 214

Query: 177 FLLWGQDLKTNVREPGNRPYTDFDIG---NCTGGHCRRRVEYLKVVSKILVSDLEEMMKA 233
           FLLWGQDL      PG RP+ D+      + T  +  RR EYLKVV+++L+ DL  ++ A
Sbjct: 215 FLLWGQDLND--EAPGERPFQDYLASDDPDATAPNGERRGEYLKVVTELLIDDLSGLVDA 272

Query: 234 WGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSD 290
           W P   D         D +  L  +++G+  LS  EL  ERM++ L   D E E  CFSD
Sbjct: 273 WAPDTADNYRASFTGGDPDDALRDVLSGIGVLSKGELGAERMDVALRSLDQEDEHSCFSD 332

Query: 291 NTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDF 350
           NT+     +  GI + Y G Y       + G SI DL+   +  L  E+   F  ++   
Sbjct: 333 NTHVDIAMNAQGIQNVYLGRY-----SYLSGPSISDLVRQEDPALDAEMRAAFEKSLAAV 387

Query: 351 HILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
             +         FDQ I     EG  +V   +N L  Q+E++ ++  AL L  
Sbjct: 388 QAIP------VPFDQNIDAQGSEGWNLVNEAVNALFDQSETIIEVGEALGLGN 434


>gi|254448122|ref|ZP_05061585.1| insulin-cleaving metalloproteinase outer membrane protein [gamma
           proteobacterium HTCC5015]
 gi|198262248|gb|EDY86530.1| insulin-cleaving metalloproteinase outer membrane protein [gamma
           proteobacterium HTCC5015]
          Length = 462

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 141/450 (31%), Positives = 218/450 (48%), Gaps = 50/450 (11%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +S+         +      ++ +L N A++A+A Y D++  A+ L SAIETLV  P 
Sbjct: 8   LVALSLAVLSACSPSAEEKKAEIQAILSNDASMAYAAYSDSVTTAQQLQSAIETLVKAPT 67

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTW-------------DKKVNAWPLDEGF 110
             +L  A+  WI+AR PY Q+EVYRF    +D               + ++NAWPL E  
Sbjct: 68  DTHLSEAKSAWIKAREPYGQTEVYRFREGPIDALKGDGTLGTEGDGPEGEINAWPLGEAL 127

Query: 111 IDYVDS-----SYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGID 165
           IDYV +           E      A+IIA++ I +N +++D    + + L     ANG +
Sbjct: 128 IDYVAATPPIADGVDHAENFPAVNASIIADTSIPLNGEDLDS---TIETLAAFQEANGDE 184

Query: 166 TNITTGYHVIEFLLWGQDLKTNVRE--------PGNRPYTDFDIG-----------NCTG 206
            N+ TGYH IEFLLWGQDL     +        PG RP +D+              + +G
Sbjct: 185 ANVATGYHAIEFLLWGQDLNQGQAQWGKQRDNSPGQRPVSDYAQNEQCTVDAQGNTDSSG 244

Query: 207 GHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNE 266
             C+RR  YL+ V++ LV DL  +  AW P     +  +      L S++  M  LS+ E
Sbjct: 245 KICQRRAIYLRAVAQKLVDDLSRVRDAWAPQSPLRQQYIDGGKHSLASVLESMGRLSFGE 304

Query: 267 LAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR----MNGEKIHGA 322
           LAGER+N+ L     E E  CFSDNT+   L +  GI +SY G+Y       +   + G 
Sbjct: 305 LAGERINIALTQDSQEDEHSCFSDNTHRDILLNAKGIQNSYLGQYGNTTLYTDATAVSGD 364

Query: 323 SIHDLISHN-NRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS-----ENNPEGNK 376
           SI  L+    +  LA+++    ++T      +   A++   FDQ I+       +P+ N+
Sbjct: 365 SIDALLRKRGHTELAKQLKGALAHTQSLAQAIDQTAQSGTPFDQQIAGGEIDPKHPKANQ 424

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPNR 406
            +R+LI  L+ QTE + +   AL+L   + 
Sbjct: 425 TIRDLIQALVAQTELIEQAIAALELTADDL 454


>gi|332968652|gb|EGK07705.1| iron-regulated protein A [Psychrobacter sp. 1501(2011)]
          Length = 484

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 142/433 (32%), Positives = 212/433 (48%), Gaps = 41/433 (9%)

Query: 15  SHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
             A       S+ K+L NYA +A A YED+L  A+ L  A++  +  P + NLE AR  +
Sbjct: 54  GTATVAGDEASVNKLLTNYADMAQAAYEDSLTEAKKLQQAVDVFIADPTEANLEAARAAY 113

Query: 75  IRARIPYQQSEVYRF-----------GNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
             AR PY Q+E++RF               VD W+ +VNAWPLDE  IDYV   Y  E  
Sbjct: 114 KAARQPYSQTEIFRFDEGFVTANDKRALGSVDGWEGQVNAWPLDEALIDYVSEGYAGEYN 173

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
             +    NII +  I V   E D   I+PDLL +++   G + N+TTGYH IEFLLWGQD
Sbjct: 174 SKD----NIINSDHITVGSVEQDTKNITPDLLAEMNEIGGSEANVTTGYHAIEFLLWGQD 229

Query: 184 LKTNVREPGNRPYTDF-DIGNCTGGH--------CRRRVEYLKVVSKILVSDLEEMMKAW 234
                   GNRP TD+     CT G         C +R +YLK  +++LV+DL  M+  W
Sbjct: 230 NNGTAEGAGNRPVTDYMTNEQCTSGEGNTVDASVCAKRGQYLKAATQLLVNDLTTMVAEW 289

Query: 235 GPDGQ---ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDN 291
            P+ +    +  + +  N  +  +   M SL+  ELA ERM +  +    E E +CFSD 
Sbjct: 290 QPNSENTLRSDLMARSSNNAVRQLFYQMGSLALGELASERMQVAFVTGSTEDEHECFSDL 349

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLI-SHNNRNLAQEINDKFSNTMKDF 350
           T+ SY N+  GI + + G+Y  ++G  +    I   +     +  A ++  +F+   K F
Sbjct: 350 THLSYANNARGIDNVFKGQYKTVSGSTVGNYGIKQFLIDAGQQEAADKLEAEFNKVEKSF 409

Query: 351 HILKDRAE-NIESFDQMISENN---------PEGNKI---VRNLINDLITQTESLRKIRI 397
             + ++ E N    DQMI+             E NK    V + INDL + T+++     
Sbjct: 410 DTIVEQGEKNGIKVDQMIATVGQASKHNVSAEEQNKRRGWVESAINDLKSLTDAIEYSAK 469

Query: 398 ALDLIEPNRVIGN 410
           ++ +   +   G+
Sbjct: 470 SIGIENLDADTGS 482


>gi|218515129|ref|ZP_03511969.1| hypothetical protein Retl8_16281 [Rhizobium etli 8C-3]
          Length = 293

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 141/278 (50%), Positives = 191/278 (68%), Gaps = 1/278 (0%)

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
           AN+IAN  I ++ K++D S ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL    
Sbjct: 2   ANVIANKTIKIDGKDVDASKLTPEFLSGTLAEAGGIEANVATGYHAIEFLLWGQDLNGTG 61

Query: 189 REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDI 248
              GNR  TD+D+ NCT G+C RR EYLK  S +LVSDL+EM   W PDG A K++  D 
Sbjct: 62  PGAGNRLATDYDLKNCTHGNCDRRAEYLKSASTLLVSDLQEMTDNWKPDGAAAKNVEADP 121

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
            AGL +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YT
Sbjct: 122 KAGLVAILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYT 181

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
           G Y R++G K+ G S+HDL++  ++ L  E+  K + T+   + +  R E +E +DQMI+
Sbjct: 182 GNYTRVDGTKLSGPSLHDLVAAKDKALDAELEGKLNKTLDAMNAMAKRGETVEKYDQMIA 241

Query: 369 ENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNR 406
           E N +GN +V+  ++ LI QT+S++++  ALDL     
Sbjct: 242 EGNKDGNAVVQAAVDGLIDQTKSIQRVIAALDLGTVQL 279


>gi|71066359|ref|YP_265086.1| imelysin [Psychrobacter arcticus 273-4]
 gi|71039344|gb|AAZ19652.1| imelysin. Metallo peptidase. MEROPS family M75 [Psychrobacter
           arcticus 273-4]
          Length = 480

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 139/440 (31%), Positives = 213/440 (48%), Gaps = 42/440 (9%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           T +       S   S      ++++L +YA +AHA Y+DAL  A+ L +A+ T V TP +
Sbjct: 41  TPVETAEKTGSKTSSAAGQAHMDRLLISYADMAHAAYKDALETAKILQTAVNTYVETPTQ 100

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGN-----------KIVDTWDKKVNAWPLDEGFIDY 113
            NL+ A+  +  AR PY Q+EV+RF                D+W+ +VNAWPLDE  IDY
Sbjct: 101 ANLDAAKAAYKAARQPYSQTEVFRFDEGFVTANEQRKIASTDSWEGQVNAWPLDEALIDY 160

Query: 114 VDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYH 173
           V ++Y    E       NII +  I V   + D S I+P+LL ++    G + N+TTGYH
Sbjct: 161 VSTNY----EGKYNSQDNIINSDSITVGSIKQDTSTITPELLAEMTEIGGSEANVTTGYH 216

Query: 174 VIEFLLWGQDLKTNVREPGNRPYTDF--DIGNCTGGH--------CRRRVEYLKVVSKIL 223
            IEF+LWGQD        GNRP++D+    G CT G         C RR +YLK  +++L
Sbjct: 217 AIEFMLWGQDTNGVAEGAGNRPFSDYLTTDGQCTSGESKNPEASVCERRGQYLKAATQLL 276

Query: 224 VSDLEEMMKAWGPDGQ---ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHD 280
           V DL  M   W PD +    +  + +     L+ I+  M SL+  ELA +R+ +  +   
Sbjct: 277 VDDLTAMEAEWQPDSENTLRSDIMARKDKNSLHQIMYQMGSLALGELASDRIQVAFVTGS 336

Query: 281 PEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDL-ISHNNRNLAQEI 339
            E E +CFSD T+ SY N+  GI + + G+Y  + G+ I G  + +  +   N   A ++
Sbjct: 337 TEDEHECFSDLTHLSYANNARGIQNVFNGDYKTVAGKTIGGYGLKNYLVDTGNTEAADKL 396

Query: 340 NDKFSNTMKDFHILKDRAEN-IESFDQMISENN---------PEGNKI---VRNLINDLI 386
              F+     F+++ ++ E      DQMI+             E NK    +   I  L 
Sbjct: 397 AADFAKVEAAFNVIVEKGEKENIKIDQMIATVGQGIKQGVTAEEQNKRRGWIETSITSLQ 456

Query: 387 TQTESLRKIRIALDLIEPNR 406
             T  +     A+ +   + 
Sbjct: 457 ELTAGIENAAKAVGIDNLDA 476


>gi|148653942|ref|YP_001281035.1| hypothetical protein PsycPRwf_2145 [Psychrobacter sp. PRwf-1]
 gi|148573026|gb|ABQ95085.1| Uncharacterized iron-regulated protein-like protein [Psychrobacter
           sp. PRwf-1]
          Length = 486

 Score =  269 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 138/428 (32%), Positives = 213/428 (49%), Gaps = 41/428 (9%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
                S+ K+L +YA +A A YED+L  A+ L +A++ LV  P ++NLE A+  +  AR 
Sbjct: 61  AGDEASVNKLLTSYADMAQAAYEDSLSEAKKLQAAVDALVANPTQQNLEAAQAAYKAARQ 120

Query: 80  PYQQSEVYRFGN-----------KIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
           PY Q+EV+RF               +D W+ +VNAWPLDE  IDYV   Y  E    +  
Sbjct: 121 PYSQTEVFRFDEGFVGKDDKRAIGSIDGWEGQVNAWPLDEALIDYVADGYAGEYNSKD-- 178

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
             NII + KI V     D   I+P+LL +++   G + N+TTGYH IEFLLWGQDL    
Sbjct: 179 --NIINSDKITVGSTSQDTKTITPELLAEMNEIGGSEANVTTGYHAIEFLLWGQDLNGVG 236

Query: 189 REPGNRPYTDFDIGN-CTGGH--------CRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
              G RP TD+   + CT G         C +R EYLK  +++LV+DL +M+  W P+ +
Sbjct: 237 EGAGQRPVTDYMANDSCTSGEGNSAEAAVCAKRGEYLKAATQLLVNDLTDMVAQWQPNTE 296

Query: 240 ---ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASY 296
               +  + +  +  +  I   M SL+  ELA ERM +  +    E E +CFSD T+ SY
Sbjct: 297 NTLRSDLMARSSDNAVRQIFYQMGSLALGELASERMQVAFVTGSTEDEHECFSDLTHLSY 356

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLI-SHNNRNLAQEINDKFSNTMKDFHILKD 355
            N+  GI + + G+Y  ++G  +    I   +     ++ A++++  F      F+ + +
Sbjct: 357 ANNARGIANIFNGQYKTVSGSTVGDYGIKQYLIDAGQKDSAEQLDAAFKKVEASFNTIAE 416

Query: 356 RAE-NIESFDQMISENNPEGNKIVRN------------LINDLITQTESLRKIRIALDLI 402
           + E N    DQMI+       + V               INDL + T+ L     ++ + 
Sbjct: 417 QGEKNGIKIDQMIATVGQATKQGVSAEEQNKRRGWMESAINDLKSLTDVLESSAKSIGID 476

Query: 403 EPNRVIGN 410
             +   G+
Sbjct: 477 NLDADTGS 484


>gi|158336553|ref|YP_001517727.1| iron-regulated protein [Acaryochloris marina MBIC11017]
 gi|158306794|gb|ABW28411.1| iron-regulated protein, putative [Acaryochloris marina MBIC11017]
          Length = 405

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 111/393 (28%), Positives = 176/393 (44%), Gaps = 49/393 (12%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
              NV L   ++NYA +    Y+DA   A  +  AI   +  PN+ + + A+  W++AR 
Sbjct: 42  AAKNVDLTPYVENYAEVVFRNYQDARTQAAMMQVAITAFLDNPNETSHKAAQDAWVQARQ 101

Query: 80  PYQQSEVYRFGNKIVDTWD---------KKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
            Y Q+E +RF    +D  D          ++NAWP++E FIDYV               +
Sbjct: 102 SYLQTEAFRFYEGPIDFVDAKTGEEGPEGRINAWPMNEAFIDYV----------KEKPDS 151

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
            +I N K  ++   I             +     + ++TTG+H IEFLLWGQD       
Sbjct: 152 GLINNPKFEISIAAIME-----------NDQVTDEADVTTGWHAIEFLLWGQDFNN--EG 198

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDI 248
           PG R + DF        +  RR +YL +V++ LVSDL  +   W P+      K L  D 
Sbjct: 199 PGQRSFEDFIPNQ---NNNDRRRQYLTLVTEQLVSDLTFLETEWKPNAENYRAKFLKGDP 255

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
            A +  I T + +LS  E+A ERM + L   + E E  CFSD TY  ++ +  GI + Y 
Sbjct: 256 KATVGKIFTALATLSAFEMASERMTVALDSGNQEDEHSCFSDTTYQDFVFNAKGISNVYF 315

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
           G+Y         G    +L++  N +L Q+I    + T +    +       + FDQ+++
Sbjct: 316 GDY-----AGYQGKGFDELLAQMNPDLNQKITAALTTTEESASQID------QPFDQVLA 364

Query: 369 -ENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
                     V  ++  L  Q E+ +++   L 
Sbjct: 365 SAQGSPQRAEVEAVVTALENQGEAFKELGPVLG 397


>gi|313676340|ref|YP_004054336.1| peptidase m75, imelysin [Marivirga tractuosa DSM 4126]
 gi|312943038|gb|ADR22228.1| Peptidase M75, Imelysin [Marivirga tractuosa DSM 4126]
          Length = 386

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 125/406 (30%), Positives = 191/406 (47%), Gaps = 38/406 (9%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +  + ++  +F+      S    +S ++V++NYA I +A Y DA   A  L   I+    
Sbjct: 5   LSIVILVLFLFSC-----STKQEISKKEVVENYANIVYANYLDAHEHALALRREIKHFTE 59

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT---WDKKVNAWPLDEGFIDYVDSS 117
            P++   +  +  W+  R  Y Q+E +RF    +D     + ++NAWPLDE +IDYV S 
Sbjct: 60  NPSQNGFDRTKEAWLLTRESYGQTEAFRFYGGPIDGENGPEGQLNAWPLDEAYIDYVAS- 118

Query: 118 YGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEF 177
                       ANII + +            I+ D +  ++   G +TN+++GYH IEF
Sbjct: 119 --------ENNNANIINSPE--------TFPEITADFIASMNEK-GSETNVSSGYHAIEF 161

Query: 178 LLWGQDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP 236
           LLWGQDL       G R YTD+  G   T  +  RR  YL   + +LVSDL+ +M+ W P
Sbjct: 162 LLWGQDLSD-GPGAGERKYTDYIDGEEATAKNANRRKTYLLETANLLVSDLKSVMEEWAP 220

Query: 237 DG-QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYAS 295
           +        + + +  +  I++G+  LS  ELAGERM +   L   E E  CFSDNT+  
Sbjct: 221 NQQNYRATFISNPDQSIEKIVSGLGKLSKGELAGERMFVAYDLRSKEDEHSCFSDNTHRD 280

Query: 296 YLNDVIGIISSYTGEYIRM-NGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
            + +  GI + Y G+Y    N   I G SI+DL+      LA+E+    +      + L 
Sbjct: 281 IVANATGIQNVYLGKYKTFRNDSTISGPSIYDLVKQQEEALAEELKQTIA------NGLA 334

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
           D  +    FDQ I   N EG K +   I+    Q + L        
Sbjct: 335 DSKKIEAPFDQQI--KNEEGRKQIAKTISLFRKQGDLLAASASKFG 378


>gi|88859144|ref|ZP_01133785.1| hypothetical protein PTD2_09069 [Pseudoalteromonas tunicata D2]
 gi|88819370|gb|EAR29184.1| hypothetical protein PTD2_09069 [Pseudoalteromonas tunicata D2]
          Length = 475

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 126/426 (29%), Positives = 192/426 (45%), Gaps = 47/426 (11%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V+ + V++  A  A+A Y D+L+ A+ L   +   V  P+ ++   A+  W+ AR PY Q
Sbjct: 52  VTTQDVIKTNAQHAYAVYADSLIAAKALKEQLAIFVANPSDESFSLAKKAWLAAREPYGQ 111

Query: 84  SEVYRFGNKIVDTW----------------DKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           SEV+RF    +D                  +  +NAWPL E  IDY     G +N EN  
Sbjct: 112 SEVFRFREGPIDNLTQDAAGNWVLAPEAGPEGAINAWPLAEALIDYTQDMDGLQNPENPS 171

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
                       +        +I    ++        + N+T+GYH IEFLLWGQDL  +
Sbjct: 172 TLPAGGN-----IIADIDSFPVIDKATIQAQFERGDDEANVTSGYHAIEFLLWGQDLNAD 226

Query: 188 VR-------EPGNRPYTDFDIGNCTGGHCR------------RRVEYLKVVSKILVSDLE 228
                      G R  +DF       G C             RR +YL   + +L+ DL+
Sbjct: 227 GTYTANRDYSAGYRKASDFYTVGNQMGQCTSGEAGAANVICIRRSQYLLAAADLLIDDLK 286

Query: 229 EMMKAWGPDGQATKDLM---KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEI 285
            ++ AW P            +     L  I+ GM  LSY ELAGERM++ L     E E 
Sbjct: 287 SVVDAWTPGTGFHYQAFIKEETQKQSLAKILEGMGRLSYGELAGERMSIALRTDSQEDEH 346

Query: 286 DCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHD-LISHNNRNLAQEINDKFS 344
            CFSDNT+     +  GI +++ G+Y+R +GE + GASI++ L+      LA ++     
Sbjct: 347 SCFSDNTHRDIFLNAKGIQNTFNGQYVRFDGEVLQGASIYNLLVVAGKPELANKLRGALE 406

Query: 345 NTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEP 404
           +TM    ++   A+   SFD  I +  PE    V N I  L TQT+ ++++  AL +   
Sbjct: 407 DTMAKAAVIDTTAKLGYSFDVQIQQ--PELKGAVTNTIEALKTQTQVIKEVIEALGVTTG 464

Query: 405 NRVIGN 410
           +   G+
Sbjct: 465 DL-EGD 469


>gi|121729789|ref|ZP_01682225.1| anthranilate synthase component II [Vibrio cholerae V52]
 gi|121628464|gb|EAX60954.1| anthranilate synthase component II [Vibrio cholerae V52]
          Length = 289

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 118/286 (41%), Positives = 165/286 (57%), Gaps = 5/286 (1%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IAHA Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSAILASLTLTTSASFAAAPTQAQVVEHYADIAHAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183

Query: 182 QDLKTNVREPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---GPD 237
           QDL       G R YTD+  G  CT  HC RR +YLK  +++LV+DLE M K W     D
Sbjct: 184 QDLNGTKAGAGARSYTDYLQGKACTNNHCDRRAQYLKAAAQLLVTDLEWMEKQWASGEKD 243

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQ 283
               + L +    GL  ++ GM SLS  ELAGERM + L  +  E 
Sbjct: 244 NYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANSTED 289


>gi|88803059|ref|ZP_01118586.1| hypothetical protein PI23P_10715 [Polaribacter irgensii 23-P]
 gi|88781917|gb|EAR13095.1| hypothetical protein PI23P_10715 [Polaribacter irgensii 23-P]
          Length = 413

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 119/415 (28%), Positives = 196/415 (47%), Gaps = 34/415 (8%)

Query: 1   MYFITIISIVFTLPSHALSIVPN---------VSLEKVLQNYATIAHAKYEDALMCARTL 51
           +  ++ ++IV    S   +I  N         V  ++ + NY  I  A Y DAL     L
Sbjct: 8   VLILSCLAIVGIACSSEDTIEDNILDPTIAIEVKKKEFVTNYTNIVFASYADALNKLNEL 67

Query: 52  DSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD----TWDKKVNAWPLD 107
            +A++T V TPN+   + A+  W+ +R PY Q+E YRF +  +D      +  +NAWPLD
Sbjct: 68  KTAVDTFVATPNENTFQTAKDTWLASREPYGQTEAYRFYDGPIDGGEGEPEGYINAWPLD 127

Query: 108 EGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTN 167
           E  IDYV +  G ++  ++    NII N +            ++ + L++L   +  ++N
Sbjct: 128 EALIDYVTTGTGGQDLSDDRQ--NIINNKE--------KYPSLTKETLKELSGYDSNESN 177

Query: 168 ITTGYHVIEFLLWGQDLK-TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSD 226
           +T G+H IEFLLWGQD    + +  G R  TDF     T  +  RR EYL  V+ +LV D
Sbjct: 178 VTVGFHAIEFLLWGQDNTQPSEKMAGQRALTDFT----TATNAVRRGEYLVAVTALLVDD 233

Query: 227 LEEMMKAWGPDGQATKDLMK-DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEI 285
           ++ ++  W P    +   +    +  +  I+TG   LS  ELAGERM + +   + E E 
Sbjct: 234 VKSVVDQWKPGASYSSSFLAMSSDDAITKILTGAAKLSKGELAGERMAVAVENQNQEDEH 293

Query: 286 DCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSN 345
            CFSDNT+     +   I +   G Y   +G  + G S+ D+++  N + A  +    S 
Sbjct: 294 SCFSDNTHRDVYLNAKSIDNIIHGSYKNTDGSIVSGTSLLDILALVNNDEATALTATASE 353

Query: 346 TMKDFHILKDRAENIESFD-QMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            M    ++         FD Q++ E     N  + + +  L  Q + L +   ++
Sbjct: 354 VMNKVTVIFTIG----YFDNQLMDETLDNFNNPIMSAVLTLRKQGDELAQAGKSI 404


>gi|121605456|ref|YP_982785.1| putative iron-regulated protein [Polaromonas naphthalenivorans CJ2]
 gi|120594425|gb|ABM37864.1| putative iron-regulated protein [Polaromonas naphthalenivorans CJ2]
          Length = 400

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 117/409 (28%), Positives = 188/409 (45%), Gaps = 35/409 (8%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           T ++     P+   +    VS   V  +YA +  A Y D L  A+T+  AI+    +P+ 
Sbjct: 19  TAMAQTAPAPAGVTAPAGAVSFNAVASHYAALVEASYADTLTAAKTMQQAIDAFAKSPSA 78

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDT---WDKKVNAWPLDEGFIDYVDSSYGKE 121
            +L  AR  W+ AR  Y Q+E +RF    +D     + ++NAWP+DE ++D V+S  G  
Sbjct: 79  DSLAAARKAWLAAREFYGQTEAFRFYGGPIDDANGPEGRINAWPMDESYVDGVNSKPG-- 136

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
                   + +I   K            IS   L   +   G + NI TG+H IEFLLWG
Sbjct: 137 --------SGLINKRKF----------AISKKALAAQNERGGEE-NIATGWHAIEFLLWG 177

Query: 182 QDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQ 239
           QD+       G+R + DF  G     +  RR +YL  V+++LV DL  + K W P     
Sbjct: 178 QDVSETGP--GDRSFEDFVDGKKP--NADRRRQYLTTVTELLVDDLSGVAKQWAPGVKTN 233

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
                 K     +  I+ G+ SLS  ELAGER+ + L   D E E  CFSDNT+   +N+
Sbjct: 234 YRAKFEKGGQESVRKILLGLGSLSRGELAGERLEVALNSQDQEDEHSCFSDNTHRDVVNN 293

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
             GI + + GEY R +   + GAS+ DL++  +  LA+    + + ++     ++   + 
Sbjct: 294 ARGIQNVWLGEYKRADDSVLKGASLRDLVAVKDAGLAERTTKQITGSVVAAEGIQAPFDR 353

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVI 408
                +++   +  G   ++  I  L  Q++ L     A+ +       
Sbjct: 354 -----EIVGAKDAAGRLRIQKTIASLTQQSKDLAASAKAVGITRVAFDA 397


>gi|119944460|ref|YP_942140.1| uncharacterized iron-regulated protein [Psychromonas ingrahamii 37]
 gi|119863064|gb|ABM02541.1| uncharacterized iron-regulated protein [Psychromonas ingrahamii 37]
          Length = 429

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 131/409 (32%), Positives = 193/409 (47%), Gaps = 45/409 (11%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           T  +       H  +    VS  +V  NY  +A+A YED+L  A  L + I  L+ +P++
Sbjct: 18  TAFAAFADKAEHRSASSTQVSESEVKANYVKMAYAAYEDSLNSALYLQNNIGKLLASPSE 77

Query: 65  KNLENARLQWIRARIPYQQSEVYRF--------------GNKIVDTWDKKVNAWPLDEGF 110
             L  A+  +  ARIPYQQ+E+ R+              G   VD W+ +VNAWPLDE  
Sbjct: 78  GQLLQAKAAYKLARIPYQQTEIMRWDTDITITAELDKDGGPASVDQWEGQVNAWPLDEQA 137

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           IDYV  +            A II                I+PD L   +   G + N+TT
Sbjct: 138 IDYVQGN----------ANAGIINKKN---------GPAINPDYLIAQNGMGG-EANVTT 177

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDI---GNCTGGHCRRRVEYLKVVSKILVSDL 227
           G+H IEFLLWGQDL       G R   DF     G C+  +C RR  YL+  S++LV+DL
Sbjct: 178 GFHAIEFLLWGQDLNGTNAGAGQRNVNDFQTDLSGKCSVNNCDRRRTYLQAASQLLVADL 237

Query: 228 EEMMKAWGPDGQATKDLMK----DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQ 283
            EM   W       +  +       + G+  I+  M S++ +ELA  RMN GL   DPEQ
Sbjct: 238 REMRDQWSATASRQQGTLAYNFLASDDGIRYILFAMKSMATDELASARMNEGLDGLDPEQ 297

Query: 284 EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKF 343
           E DCFSD ++ +   +   I +++ G Y    G+ + GAS+ D I   +  + ++ +D+F
Sbjct: 298 EHDCFSDLSHLAIYYNFQAIRNAFYGGYQNTMGQYVSGASLGDYIHQQSPAIFKQFDDQF 357

Query: 344 SNTMKDFHILKDRAENIES---FDQMIS-ENNPEGNKIVRNLINDLITQ 388
           ++  K+  I+ D  E I +   FDQ+I             N +  L+  
Sbjct: 358 NDIEKNMKIVFDAGERINNPIRFDQIIGQAETAPQRTAAFNAVYQLVDL 406


>gi|149921138|ref|ZP_01909596.1| hypothetical protein PPSIR1_24909 [Plesiocystis pacifica SIR-1]
 gi|149818025|gb|EDM77484.1| hypothetical protein PPSIR1_24909 [Plesiocystis pacifica SIR-1]
          Length = 375

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 131/408 (32%), Positives = 202/408 (49%), Gaps = 44/408 (10%)

Query: 3   FITIISIVFTLPSHALSIVP--NVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
            I    ++    +   S  P     +  V +NYA I  A Y DA M A  L +AI+T V 
Sbjct: 2   LICSALLLGACSTDEPSDTPLSADEVAPVAENYADIVAANYADARMTAEALATAIDTFVG 61

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTW----DKKVNAWPLDEGFIDYVDS 116
            P++ NL  AR  W+ AR PY Q+EV+RF +  +D      + ++NAWP+DE +IDYVD 
Sbjct: 62  DPSEANLTAAREAWLAAREPYGQTEVFRFYDGPIDNPTDGPEGQLNAWPMDEAYIDYVDG 121

Query: 117 SYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIE 176
                     +  A II +              I+P+LL +L+ A G +TNI++GYH +E
Sbjct: 122 ----------MPDAGIINDL--------ATYPDITPELLAELNEAGG-ETNISSGYHAVE 162

Query: 177 FLLWGQDLKTNVREPGNRPYTDF-DIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG 235
           FLLWGQDL  +    G RP TD+   GN T  +  RR  YL+    +L+ DLE +  A  
Sbjct: 163 FLLWGQDLSADGP--GARPATDYLTDGNGTAMNQDRRAAYLQAAVTLLIEDLEGLETA-W 219

Query: 236 PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYAS 295
                   + +     +  I+ GM SLS  ELAGERM + L   + E E  CFSDNT+  
Sbjct: 220 AGSYRDSFVGEAPEEIVRRILLGMGSLSGAELAGERMEVALETQEQEDEHSCFSDNTHRD 279

Query: 296 YLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKD 355
            + + +GI + Y G Y  ++G+     S++DL++  + +LA  + D+ + ++     +  
Sbjct: 280 VVTNALGIQNVYLGRYGALDGQ-----SVYDLVAARDADLADRLRDEIAASVSAAEAIPA 334

Query: 356 RAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
                  FD+ I ++     + V+  I+ L  Q +S+       D+  
Sbjct: 335 P------FDRAIVDD----VESVQATIDALRVQADSIADAAALFDINL 372


>gi|296271911|ref|YP_003654542.1| Peptidase M75, Imelysin [Arcobacter nitrofigilis DSM 7299]
 gi|296096086|gb|ADG92036.1| Peptidase M75, Imelysin [Arcobacter nitrofigilis DSM 7299]
          Length = 451

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 120/450 (26%), Positives = 198/450 (44%), Gaps = 55/450 (12%)

Query: 1   MYFITIISIVFTLPSHALSIVPN---VSLEKVLQNYATIAHAKYEDALMCARTLDSAIET 57
           +  +T I++         +  PN   V    +L+ YA IA   Y +AL  A+ L+ AI  
Sbjct: 11  LSVVTAIALTGCATGTNAASTPNKEVVKSNTILEAYANIALDSYTNALNDAKALEKAINK 70

Query: 58  LVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD-----------TWDKKVNAWPL 106
               P +K L+ A+  W+ +R  Y Q+E +R  N  +D           + + ++NAWPL
Sbjct: 71  FAANPTEKTLQEAKDAWLTSRETYGQTESFRLSNGPIDAEEGWIAKDYGSLEGQINAWPL 130

Query: 107 DEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDT 166
           DE  IDY   + GK+   N + T           + K +D++ I+P+ + +L+  +G + 
Sbjct: 131 DENMIDYTIDANGKKTSGNIIDTVGKFNPGG--EDAKAVDVTKITPEAISELNE-DGGEA 187

Query: 167 NITTGYHVIEFLLWGQDLKTNVR----------EPGNRPYTDFDIGNCTGGHCRRRVEYL 216
           N+ +GYH +EFLLWGQD   +              G RP +DF     +     RR+EYL
Sbjct: 188 NVASGYHAVEFLLWGQDQDYSNFLKDSITHGPLTAGQRPLSDFT----SSVDAPRRLEYL 243

Query: 217 KVVSKILVSDLEEMMKAWGPDGQATKDLMKDI----------------NAGLNSIITGMT 260
           K  S+ +VSDLE +  AW  +   TK L +                  N  L  II GM 
Sbjct: 244 KSASQKIVSDLEIVTSAWAKNLNGTKGLYRAAILDQLKGDNASKNISRNDALKQIIAGMG 303

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
               +ELA ER+ + ++    E E  CFSDNT+     +     +  T  Y      K +
Sbjct: 304 VFMKSELANERIAVAVLTPSEEDEHSCFSDNTHRDIAMNYQSFKNILTSTYDG----KKY 359

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
           G S+ D +  + +    +I    S+  +   ++   A+  E FD  I   +P    IV+ 
Sbjct: 360 GPSLLDKVDGSAKA---KIEKLMSSIEEKIALIDKTAKTKEHFDYQIKPTSPMSKVIVKL 416

Query: 381 LINDLITQTESLRKIRIALDLIEPNRVIGN 410
             N++    +++  +  A  +      + +
Sbjct: 417 K-NEMRKLGDTMVDVASANGISLTKDDVTD 445


>gi|110637086|ref|YP_677293.1| imelysin [Cytophaga hutchinsonii ATCC 33406]
 gi|110279767|gb|ABG57953.1| imelysin, Metallo peptidase, MEROPS family M75 [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 410

 Score =  247 bits (630), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 114/416 (27%), Positives = 184/416 (44%), Gaps = 43/416 (10%)

Query: 3   FITIISIVFTLPSHALSIVPNVS---LEKVLQNYATIAHAKYEDALMCARTLDSAIETLV 59
               I++            P  S     KV++NYA I +A Y+DAL+ A+ L +     V
Sbjct: 17  LAIAIAVTTFSCKKNKEDEPAPSGSEQAKVVENYANIVYATYDDALITAKNLRAKAADFV 76

Query: 60  TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT-------WDKKVNAWPLDEGFID 112
            +P++  LE  R  +I +R PY QSE +RF +  +D         +  +N+WPL+E +ID
Sbjct: 77  ASPSEAGLEEVRAAYIASRTPYIQSEAFRFYSGPIDQDLGGGLTIESSINSWPLEEVYID 136

Query: 113 YVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGY 172
           YV               A II +         ID ++I    L    +    + ++++GY
Sbjct: 137 YVVGD----------ANAGIINDVAHF---PTIDKNVI----LENNQKEGAGENSVSSGY 179

Query: 173 HVIEFLLWGQDLKTNVREPGNRPYTDFDIG--NCTGGHCRRRVEYLKVVSKILVSDLEEM 230
           H +EFLLWGQDL       G+R YTD+ +   + T  +  RR +YL     +++ +L+ +
Sbjct: 180 HAVEFLLWGQDLSETGP--GDRKYTDYLVNSDDATNLNQARRGQYLLACIDLIIDNLQTL 237

Query: 231 MKAWGPDG--QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL----HDPEQE 284
            +AW            + D    + + + G+   + +EL+ ERM + L         EQE
Sbjct: 238 KEAWKSGNASNYRAGFIADPKGSIGNFLKGVIGYADDELSVERMQVALDTEGDAERQEQE 297

Query: 285 IDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFS 344
             CFSD TY   +    GI + Y GEY+R++G  + G S+ DL+   +  L   +  K  
Sbjct: 298 QSCFSDQTYNDIILGQKGIKNVYVGEYVRIDGTIVSGMSVSDLVKAADPKLDSTVRAKIY 357

Query: 345 NTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
           +T      +         FD  I   N  G   V+N IN L  +    +     + 
Sbjct: 358 DTDIKVAAIHAP------FDNEILTANTAGTIRVQNAINALHVEAAQYKNAANKIG 407


>gi|149910670|ref|ZP_01899307.1| uncharacterized iron-regulated protein [Moritella sp. PE36]
 gi|149806297|gb|EDM66273.1| uncharacterized iron-regulated protein [Moritella sp. PE36]
          Length = 425

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 134/412 (32%), Positives = 200/412 (48%), Gaps = 44/412 (10%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
               V+ + V  NY  +AHA Y D+L  A TL + +ETL+  P  +NL+NA+  +  AR+
Sbjct: 30  ATITVTEQDVKDNYIMMAHAAYADSLTTALTLQAKVETLLAAPTVQNLDNAKEAYKLARV 89

Query: 80  PYQQSEVYRF--------------GNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
           PYQQSE+ R+              G   VD W+ +VNAWPLDE  IDYV+ +        
Sbjct: 90  PYQQSEILRWDTDITINAGLDKDGGLNSVDEWEGQVNAWPLDEQAIDYVEGNE------- 142

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
               + II              + I+ D L   +   G + N+TTG+H IEFLLWGQDL 
Sbjct: 143 ---NSGIINQKN---------GADITIDYLIAQNGVGG-EANVTTGFHAIEFLLWGQDLN 189

Query: 186 TNVREPGNRPYTDFD---IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
                 G R   DF     G C+  +C RR +YL VV+++LV DL  M   W      TK
Sbjct: 190 GTKAGAGERSVNDFQMDKSGTCSASNCDRRRDYLNVVTQLLVDDLTAMTAEWTEQAADTK 249

Query: 243 DLMK----DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
             +         G+  ++  M +++ +ELA  RMN GL   DPEQE DCFSD ++ +   
Sbjct: 250 GTLANNFKTSADGIRYMLFAMKAMATDELASARMNEGLEGLDPEQEHDCFSDLSHVAIYY 309

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           ++  + + + G Y  ++GEK+ GAS+ D I+  N  L ++ +D  +   K+  ++ +  E
Sbjct: 310 NLQSVRNVFYGSYQTIDGEKVSGASLADFINQQNPALFKQFDDALNAIEKNMLVVYNAGE 369

Query: 359 NIES--FDQMIS-ENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRV 407
             E   FDQ+I   ++    K     +  L+    S   +   L L   N  
Sbjct: 370 QAEPIRFDQIIGQADDAPEKKAAYAAVYQLVDLQSSFNSVEELLSLQALNLS 421


>gi|157737979|ref|YP_001490663.1| hypothetical protein Abu_1746 [Arcobacter butzleri RM4018]
 gi|157699833|gb|ABV67993.1| conserved hypothetical protein [Arcobacter butzleri RM4018]
          Length = 451

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 123/454 (27%), Positives = 198/454 (43%), Gaps = 60/454 (13%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKV--------LQNYATIAHAKYEDALMCARTLDS 53
             +  +S+V +L   + +   N  ++KV        L+ YA IA   Y +AL  A+ L  
Sbjct: 7   KVLLSVSVVASLALTSYAATNNNEVKKVEVAKQASILEAYANIALDNYTNALKDAKNLKV 66

Query: 54  AIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD-----------TWDKKVN 102
           AI+     P ++N + A+  W+ +R  Y  +E++R  N  +D             + ++N
Sbjct: 67  AIDKFAKAPTQENFDAAKKAWLDSRESYGSTEIFRLSNGPIDAEEGWIADAYGALEGQIN 126

Query: 103 AWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRAN 162
           AWPLDE  IDY   + GK    N + T           + KE+D++ I+ D L  L+   
Sbjct: 127 AWPLDENMIDYTVDAEGKLTSGNIIDTVGKFNPGG--EDSKEVDVTKITVDALTDLNENG 184

Query: 163 GIDTNITTGYHVIEFLLWGQDLK----------TNVREPGNRPYTDFDIGNCTGGHCRRR 212
           G + N++TGYH IEFLLWGQD                  G RP TDF     T  + +RR
Sbjct: 185 G-EANVSTGYHAIEFLLWGQDQDYANFMDDNVTKGPMTAGQRPLTDFT----TDKNSQRR 239

Query: 213 VEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK----------------DINAGLNSII 256
           + YLK  S+ LV DLE +  AW  + +  + L +                D    L  II
Sbjct: 240 LAYLKASSEKLVKDLETVTSAWKKEVKGNQGLYQAALLGKLKGKDKDKNIDQKEALKQII 299

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM     +ELA ER+ + ++    E E  CFSDNT+   + +  G  +  T  Y     
Sbjct: 300 AGMGVFIKSELANERIAVAVLTPSEEDEHSCFSDNTHRDLVKNYEGFKNVLTATYNG--- 356

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K +G S+ D +   ++   + I    S+  +    +   A+    FD  I   + E +K
Sbjct: 357 -KKYGKSLFDAV---DKETKERIEKLMSSIEEKIESVDKIAKTEAHFDYQIRP-DHEQSK 411

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           ++  L N+L    + +  +  A  +      + +
Sbjct: 412 VITKLKNELRKLGDEMVNVASANGISLSTDDVTD 445


>gi|254423159|ref|ZP_05036877.1| hypothetical protein S7335_3313 [Synechococcus sp. PCC 7335]
 gi|196190648|gb|EDX85612.1| hypothetical protein S7335_3313 [Synechococcus sp. PCC 7335]
          Length = 410

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 106/417 (25%), Positives = 172/417 (41%), Gaps = 49/417 (11%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +T        P+    +     L   +++YA + +  Y  +   A  +  AI T +  PN
Sbjct: 31  VTPTVAPTVAPAADPLLAQAGDLTPYIESYAELVYRTYRSSKADAVMMQRAIATFLDNPN 90

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD---------KKVNAWPLDEGFIDYV 114
               + A+  W  AR  Y Q+E +RF    +D  D          ++NAWP++E FIDYV
Sbjct: 91  VDTHQAAKAAWTEARQSYLQTEAFRFYEGPIDFIDLETGEEGPEGRINAWPMNEAFIDYV 150

Query: 115 DSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHV 174
                          + +I +    ++   +             +     + ++TTG+H 
Sbjct: 151 QG----------KADSGVINDPSFEISTANVLE-----------NDQVSDEADVTTGWHA 189

Query: 175 IEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW 234
           IEFLLWGQD   +    G R Y DF  G    G+  RR EYL +V+  L+ DL  +   W
Sbjct: 190 IEFLLWGQDFNADGP--GQRSYEDFVAGK---GNNDRRREYLNLVTDQLIEDLTFLETEW 244

Query: 235 GPD--GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNT 292
            P       + + +D    L  ++T + +LS  E+A ERM + L   D E E  CFSD T
Sbjct: 245 QPGSDNYRAEFVAQDPQETLGKVLTSLATLSAFEMASERMAVSLDSGDQEDEHSCFSDTT 304

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHI 352
           Y  ++ +  GI + Y  +Y         G  + +L++     L Q++      T      
Sbjct: 305 YQDFVFNAAGIRNVYFADYGD-----YQGIGLDELLASVAPELNQQMIAALDQTQTTIAQ 359

Query: 353 LKDRAENIESFDQ-MISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVI 408
           +         FDQ ++S    E   +V + I  L  Q E + ++  AL +       
Sbjct: 360 ISTP------FDQVLVSPPGSEERAVVESAIVALEDQAELIVEVGSALGVEAEILAE 410


>gi|315637720|ref|ZP_07892923.1| imelysin superfamily protein [Arcobacter butzleri JV22]
 gi|315477999|gb|EFU68729.1| imelysin superfamily protein [Arcobacter butzleri JV22]
          Length = 451

 Score =  242 bits (617), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 120/454 (26%), Positives = 197/454 (43%), Gaps = 60/454 (13%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKV--------LQNYATIAHAKYEDALMCARTLDS 53
             +  +S+V +L   + +   N  ++KV        L+ YA IA   Y +AL  A+ L  
Sbjct: 7   KVLLSVSVVASLALTSYAATNNNEVKKVEVAKQASILEAYANIALDNYTNALKDAKNLKV 66

Query: 54  AIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD-----------TWDKKVN 102
           AI+     P ++N + A+  W+ +R  Y  +E++R  N  +D             + ++N
Sbjct: 67  AIDKFAKAPTQENFDAAKKAWLDSRESYGSTEIFRLSNGPIDAEEGWIADAYGALEGQIN 126

Query: 103 AWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRAN 162
           AWPLDE  IDY   + GK    N + T           + KE+D++ I+ D L  L+   
Sbjct: 127 AWPLDENMIDYTVDAEGKLTSGNIIDTVGKFNPGG--EDSKEVDVTKITVDALTDLNENG 184

Query: 163 GIDTNITTGYHVIEFLLWGQDLK----------TNVREPGNRPYTDFDIGNCTGGHCRRR 212
           G + N++TGYH IEFLLWGQD                  G RP TDF     T  + +RR
Sbjct: 185 G-EANVSTGYHAIEFLLWGQDQDYANFMDDNVTKGPMTAGQRPLTDFT----TDKNSQRR 239

Query: 213 VEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK----------------DINAGLNSII 256
           + YLK  S+ LV DLE +  AW  + +  + L +                D    L  II
Sbjct: 240 LAYLKASSEKLVKDLETVTSAWKKEIKGNQGLYQAALLGKLKGKDKDKNIDQKEALKQII 299

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
            GM     +ELA ER+ + ++    E E  CFSDNT+   + +  G  +  T  Y     
Sbjct: 300 AGMGVFIKSELANERIAVAVLTPSEEDEHSCFSDNTHRDLVKNYEGFKNVLTATYNG--- 356

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K +G S+ D +   ++   + I    S+  +    +   A+    FD  I  ++ +   
Sbjct: 357 -KKYGKSLFDAV---DKETKERIEKLMSSIEEKIESVDRIAKTEAHFDYQIRPDHEQSKV 412

Query: 377 IVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           +++   N+L    + +  +  A  +      + +
Sbjct: 413 LIKLK-NELRKLGDEMVNVASANGISLSTDDVTD 445


>gi|218659024|ref|ZP_03514954.1| hypothetical protein RetlI_04866 [Rhizobium etli IE4771]
          Length = 242

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 126/238 (52%), Positives = 166/238 (69%), Gaps = 1/238 (0%)

Query: 135 NSKIIVNEKEIDLSIISPDLLRK-LHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN 193
              I ++ K++D S ++P+ L   L  A GI+ N+ TGYH IEFLLWGQDL       GN
Sbjct: 5   TKTIKIDGKDVDASKLTPEFLSGTLQEAGGIEANVATGYHAIEFLLWGQDLNGTSPGAGN 64

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
           RP TD+D+ NCT G+C RR EYLK  S +LVSDL+EM  +W PDG ATK++  D  AGL 
Sbjct: 65  RPATDYDLKNCTHGNCDRRAEYLKSASTLLVSDLQEMTDSWKPDGAATKNVEADPKAGLV 124

Query: 254 SIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR 313
           +I+TGM SLSY ELAGERM LGL+LHDPE+E DCFSDNTY S+LND IGI ++YTG Y R
Sbjct: 125 AILTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTR 184

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENN 371
           ++G K+ G S+HDL++  ++ L  E+  K + T+   + +  R E +E +DQMI+E N
Sbjct: 185 VDGTKLSGPSLHDLVAAKDKALDAEMEGKLNKTLDAMNAMAKRGETVEKYDQMIAEGN 242


>gi|319778642|ref|YP_004129555.1| Iron-regulated protein A precursor [Taylorella equigenitalis MCE9]
 gi|317108666|gb|ADU91412.1| Iron-regulated protein A precursor [Taylorella equigenitalis MCE9]
          Length = 476

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 110/423 (26%), Positives = 183/423 (43%), Gaps = 51/423 (12%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
                L+NYA IA   Y DAL  A+TL  AI+     P ++ L+ A+  W+ +R  Y  +
Sbjct: 61  DEHAALENYANIAIKYYSDALKDAQTLQKAIKDFTANPTEETLKAAKDAWLMSRETYGLT 120

Query: 85  EVYRFGNKIVD-----------TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
           E  R  N  +D             + ++NAWPLDE  IDY   + G     N + +    
Sbjct: 121 EALRLSNGPIDAEEGWVAETYGNLESQINAWPLDEFMIDYTIDAKGNRTSGNIIDSTGKF 180

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK-------- 185
             +    + KE+D++ I+P++L +L+   G + N+ TGYH IEFLLWGQD          
Sbjct: 181 KPTG--DDSKEVDITTITPEVLTELNENGG-EANVATGYHAIEFLLWGQDQDYNSIVEDK 237

Query: 186 --TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
             +     G RP TD+           RR +YL  V+  LV+DL+ ++ AW  +    K 
Sbjct: 238 IASGPMTAGQRPLTDYTEDKFK----DRRKDYLNAVTDKLVNDLQVLVNAWSTERDGAKG 293

Query: 244 LMKDI----------------NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDC 287
           L +                  +  +  I++G+     +ELA ER+ + ++    E E  C
Sbjct: 294 LYRQALLGELKGEEASKNIETDVAIKQILSGLGVFIKSELANERIAVAVLTPSEEDEHSC 353

Query: 288 FSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTM 347
           FSDNT+     +  G +    G+       K  G S +D +   N+     I+   ++  
Sbjct: 354 FSDNTHRDIDQNFKGWLDFLKGQTNG----KSTGVSFYDSLGKENKA---NIDKLIADVE 406

Query: 348 KDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRV 407
           K    +   A+    FD  I  +N   NK + ++ N +    + +  +  +L +      
Sbjct: 407 KRIADMNAVAQKEMHFDYQILPSNEAYNKNIVSMKNQMRRLGDQMIVVAKSLHIDLTEDD 466

Query: 408 IGN 410
           + +
Sbjct: 467 VTD 469


>gi|150025534|ref|YP_001296360.1| lipoprotein precursor [Flavobacterium psychrophilum JIP02/86]
 gi|149772075|emb|CAL43551.1| Probable lipoprotein precursor [Flavobacterium psychrophilum
           JIP02/86]
          Length = 390

 Score =  232 bits (592), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 127/390 (32%), Positives = 188/390 (48%), Gaps = 36/390 (9%)

Query: 18  LSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA 77
           ++ V NV+ ++V++NYA IA+  Y+ A   A  L SAI T  TTP + N +NA+ +W  A
Sbjct: 28  VAPVKNVTKKEVIENYANIAYENYKKAYDDAVILKSAITTFTTTPTQVNFDNAKNKWKVA 87

Query: 78  RIPYQQSEVYRFGNKIVDT---WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           R  Y  +E +RF N  +D     +  +N+WPLDE FIDYV          N    A I+ 
Sbjct: 88  RESYGTTEAFRFANGPIDNTTGPESFLNSWPLDENFIDYV----------NGAPNAGIVN 137

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK-TNVREPGN 193
           N  +          II+  +L++ +   G + NI+ GYH IEFLLWGQDL   +V +PG 
Sbjct: 138 NEAL--------FPIITKSVLKEQNELGG-EKNISVGYHAIEFLLWGQDLTAPSVNKPGQ 188

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK-DINAGL 252
           RPYTD+ I   T  +  RR  YL   S +L  +L E++  W   G      +    N  L
Sbjct: 189 RPYTDYIIAGGTAANQARRTAYLVACSDLLTDNLLEVVNQWKVGGAYRTTFLGLPENEAL 248

Query: 253 NSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYI 312
            ++  G+T+L   EL  ERM + L   D E E  CFSDNT+   + ++ G+I+ Y G+Y 
Sbjct: 249 KNMYLGITTLISAELPVERMEVALGNADQEDEHSCFSDNTHRDIILNLQGVINVYQGKYG 308

Query: 313 RMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN-N 371
            ++     GAS+ DL+S  N     E N   + ++   + L         FD  IS    
Sbjct: 309 SID-----GASLEDLVSQANVQANTETNASIALSLTKANAL------FNPFDLAISGGAT 357

Query: 372 PEGNKIVRNLINDLITQTESLRKIRIALDL 401
                 V+           +L      + +
Sbjct: 358 SVEGAKVKLAAMQFKDLGSNLLNGATKIGI 387


>gi|148244805|ref|YP_001219499.1| hypothetical protein COSY_0663 [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326632|dbj|BAF61775.1| conserved hypothetical protein [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 436

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 113/440 (25%), Positives = 190/440 (43%), Gaps = 51/440 (11%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            I+ +  V  + S A   +    +  +L  YA IA   Y DAL  A+ L   ++     P
Sbjct: 9   MISFVLTVVIVISAASVFLSGNEINPLLITYANIATINYTDALNDAKKLGIKLKDFTINP 68

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVD----------TWDKKVNAWPLDEGFID 112
             + + NA+  W+ AR  Y Q+E +R  N  +D            + ++NAWPLDE  ID
Sbjct: 69  TIETMGNAKAAWLNARESYSQTEAFRLSNGPIDAEEGWHTSYGAPEGRLNAWPLDENMID 128

Query: 113 YVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGY 172
           Y  ++ G++   N + T +I        N   ID+SII+ D+L  L+   G + N+TTGY
Sbjct: 129 YTTNAKGRKTSGNIIDTPDIFNPGG--ENPLVIDVSIITSDVLVALNENGG-NANVTTGY 185

Query: 173 HVIEFLLWGQDLKTNVRE----------PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKI 222
           HVIEFLLWGQD                  G RP  D+ I      +  RR +YL   + +
Sbjct: 186 HVIEFLLWGQDQDYTNFIKDSVTHGALLAGQRPLADYTI----NVNADRRKQYLNAAASL 241

Query: 223 LVSDLEEMMKAWGPDGQATKDLMK-----------DINAGLNSIITGMTSLSYNELAGER 271
           ++SDLE +  AW                       ++   L  I +G+     +ELA ER
Sbjct: 242 IISDLESITSAWADGDSTNYKAALLGQNSDVTKNINVKVALKQIFSGLGIFIKSELANER 301

Query: 272 MNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN 331
           + + ++    E E  CFSDNT+     +  G  +   G Y   +    +G ++ D +   
Sbjct: 302 IAMAVLTPSEEDEHSCFSDNTHRDITQNFQGFKNLLFGTYNGFD----YGVALIDAMKDK 357

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTES 391
                 ++    ++     + +   A+    FD  I  N+ +  + ++ L N+L    + 
Sbjct: 358 -----TKLMGLIASVNTKINQMNTLAQVSRHFDYQIHPNDSQARQ-IKILKNELRAIGDQ 411

Query: 392 LRKIRIALDLIEPNRVIGNV 411
           +  +  +  +   +  +GN+
Sbjct: 412 MIYVAKSNGI---DLTVGNI 428


>gi|301166521|emb|CBW26097.1| putative exported protein [Bacteriovorax marinus SJ]
          Length = 441

 Score =  232 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 132/439 (30%), Positives = 204/439 (46%), Gaps = 67/439 (15%)

Query: 3   FITIISIVFTLPSHALSI---VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLV 59
            +T   + F+L +HA+            +V+ NY+ +A   Y D+L  AR L S I   V
Sbjct: 29  LLTSAVVAFSLQAHAVKAPYKNNESLNREVISNYSDLALLNYNDSLQGARALKSEIAKFV 88

Query: 60  TTPNKKN------LENARLQW-IRARIPYQQSEVYRFGNKIVD----------------- 95
               K +       +  +  W + AR+PY QSE++RF N  +D                 
Sbjct: 89  KLAKKGSKLASKQYDIVKKTWSLEARMPYGQSEIFRFYNGPIDFEPIDDGVTTYLESINF 148

Query: 96  -TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
              +  +NAWPLDE +IDYV              TA ++ N  I           ++ D+
Sbjct: 149 EGVEGLMNAWPLDEIYIDYVKED----------STAGLVNNRNIK----------LTKDV 188

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
           L  ++   G + NI+TGYH IEFLLWGQD   ++   G RPYTD+  G  T  +  RR E
Sbjct: 189 LVSMNEREG-EKNISTGYHAIEFLLWGQD--RSIDTAGQRPYTDYVDGG-TAKNQDRRRE 244

Query: 215 YLKVVSKILVSDLEEMMKAWG--PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERM 272
           YL ++  +L   L  +   W        T+ L +D N+ L  I T M S++ +EL  ER+
Sbjct: 245 YLSLLIDLLDDHLSTVTNQWQVGEKNYRTEFLKRDSNSVLTDIFTSMISMAGDELKSERI 304

Query: 273 NLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEK-IHGASIHDLISHN 331
               +L D E+E  CFSD T      + +G+ + Y G+Y+  N  K I+G  I+DL++  
Sbjct: 305 ENAFLLEDQEEEHSCFSDQTINDIYTNALGVKNIYFGDYVAHNSSKSINGKGINDLVAFV 364

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAENIE--------SFDQMISENNPEGNKIVRNLIN 383
           N  L Q I  KF +   + +    ++ N +         FD+ ++ N       ++N+I+
Sbjct: 365 NPELDQAITKKFDSLFNNINFFYKKSRNGQVQIGSIETPFDRALTTN----KVEIQNIID 420

Query: 384 DLITQTESLRKIRIALDLI 402
           DL +  E LR+    L L 
Sbjct: 421 DLGSIDELLREAASELGLE 439


>gi|327403671|ref|YP_004344509.1| peptidase M75, Imelysin [Fluviicola taffensis DSM 16823]
 gi|327319179|gb|AEA43671.1| Peptidase M75, Imelysin [Fluviicola taffensis DSM 16823]
          Length = 394

 Score =  227 bits (578), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 106/415 (25%), Positives = 177/415 (42%), Gaps = 42/415 (10%)

Query: 1   MYFITIISIVFTL----PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIE 56
           ++ +   +IV       P    S         +   YA +A A Y+D+      L +A  
Sbjct: 8   IFLVASATIVACKKDKDPVVDTSDQYAQQKSDIKVTYAKMAFAVYKDSYTATVALQTACH 67

Query: 57  TLVTTPNKKNLENARLQWIRARIPYQQSEVYRF--GNK--IVDTWDKKVNAWPLDEGFID 112
            L  +P++ NL+ A+  W+ AR  Y  SE++RF  G      D  +  +NAWP+DE ++D
Sbjct: 68  ALADSPSQANLDAAKDAWLDAREVYGLSEIFRFVDGPIDNTNDGPEGLINAWPMDENYVD 127

Query: 113 YVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGY 172
           YV                         +    ++   I    + + +   G +T I++GY
Sbjct: 128 YVLGD------------------PNSGIINDLVNYPTIDASTIVQANEVGG-ETKISSGY 168

Query: 173 HVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMK 232
           H +EFLLWGQDL       G RPYTD+     T  +  RR  YLK V  +LVS L+++  
Sbjct: 169 HAVEFLLWGQDLSNTS--AGQRPYTDYLTTGGTALNQARRATYLKTVVDLLVSALDQVKD 226

Query: 233 AWGP---DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFS 289
           AW P             D    L  +   M  L+ +ELAGER+ +       E E  CFS
Sbjct: 227 AWDPAITGSYCHTFQGLDNETALRKMFNSMRVLAGDELAGERIYVAYENSSQEDEHSCFS 286

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGE--KIHGASIHDLISHNNRNLAQEINDKFSNTM 347
           DNT+     + + + + Y G Y         ++G ++ DL++  +      + ++F+ TM
Sbjct: 287 DNTHRDIYLNALAVENLYKGTYTSTINSANSVNGYALEDLVNAIDAGKNSLLINRFATTM 346

Query: 348 KDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
               ++       + FDQ I+         V +++  L  +   L  + +   ++
Sbjct: 347 TRISMM------YQPFDQAITL--QAERPKVLDVVTSLQQEQADLDGVALLFSIV 393


>gi|118602702|ref|YP_903917.1| putative iron-regulated protein A [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
 gi|118567641|gb|ABL02446.1| imelysin, Metallo peptidase, MEROPS family M75 [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 435

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 111/432 (25%), Positives = 183/432 (42%), Gaps = 48/432 (11%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            I+    V  + S   + + +  +  +L  YA IA A Y DAL  A+TL   ++     P
Sbjct: 8   IISSALTVVMVISITSTFLSSEEVSPLLITYANIATANYTDALNDAKTLKEKLKYFTNRP 67

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVD----------TWDKKVNAWPLDEGFID 112
               +ENA+  W+ AR  Y Q E +R  N  +D            + ++NAWPLDE  ID
Sbjct: 68  TIVLMENAKAAWLNARESYGQIEAFRLSNGPIDAEEGWHTSYGAPEGQLNAWPLDENMID 127

Query: 113 YVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGY 172
           Y  ++ GK+   N + T  ++       N   ID+S I+P +L  L+   G D N+ TGY
Sbjct: 128 YTTNAKGKKTTGNIIDTKGMLNLGG--ENPLAIDVSTITPSVLAALNENGG-DANVATGY 184

Query: 173 HVIEFLLWGQDLKTNVR----------EPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKI 222
           H IEFLLWGQD                  G R  +D+ I      +  RR +YL   + +
Sbjct: 185 HAIEFLLWGQDQDYTNFMKDGVTNGALVAGQRALSDYTI----NANADRRKQYLNAAASL 240

Query: 223 LVSDLEEMMKAWGPDGQATKDLMK-----------DINAGLNSIITGMTSLSYNELAGER 271
           +VSDLE M+ AW                       D    L  I +G+     +ELA ER
Sbjct: 241 IVSDLESMVLAWADGDSTNYKAALLGKNSDVTKNIDTKVALKQIFSGLGVFIKSELANER 300

Query: 272 MNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN 331
           + + ++    E E  CFSDNT+     +  G  +   G Y  ++        +  + +  
Sbjct: 301 IAVAVLTPSEEDEHSCFSDNTHRDITQNFQGFKNLLFGTYNSVD------YGVAPIDAMK 354

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTES 391
           ++    ++    ++     + +   A+    FD  I  N+ +  + ++ L N+L    + 
Sbjct: 355 DK---TKLMSLIASVNAKINQMNTLAQVSRHFDYQIRLNDTQSRQ-IKKLKNELRAIGDQ 410

Query: 392 LRKIRIALDLIE 403
           +  +  +  +  
Sbjct: 411 MIYVAKSNGVDL 422


>gi|254785012|ref|YP_003072440.1| peptidase, imelysin family [Teredinibacter turnerae T7901]
 gi|237684511|gb|ACR11775.1| peptidase, imelysin family [Teredinibacter turnerae T7901]
          Length = 484

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 118/427 (27%), Positives = 181/427 (42%), Gaps = 50/427 (11%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
           +  KVL   A IA A Y D++  ++ L +AI T    P + NL+ A++ W+ +R PY Q+
Sbjct: 52  NARKVLNTNADIAFAAYSDSVDTSKALQTAIATFKAEPTQANLDAAKIAWLVSREPYGQT 111

Query: 85  EVYRFGNKIVDTWDKK--------VNAWPLDEGFIDY-VDSSYGKENEENNLYTANIIAN 135
           EVYRF    +D+ D +        +NAWPL E  IDY V  S    ++         I  
Sbjct: 112 EVYRFRLSPIDSTDYQNEDGPEGDINAWPLGEALIDYTVSGSDFGADQTEVSSAYPTIGY 171

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP---- 191
            +  +   ++ +     D L       G +  + +GYH IEF+LWGQDL T+        
Sbjct: 172 PQENIINSDVAID----DALFAAVADVGDERGVISGYHAIEFMLWGQDLNTDGSADTEDD 227

Query: 192 -------------GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
                        G+RP +DF     T  +  RR+++++VV+  LV+DLE +   W    
Sbjct: 228 REMSTGGNILNSGGHRPLSDFT----TDANAARRMQFMEVVAAKLVADLEAVRDGWAVGS 283

Query: 239 QATKDL-----MKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTY 293
                             +  I+ GM +LS  ELAGERM +       E E  CFSDNT+
Sbjct: 284 SYRTAFTTVNTETQAVNRMAEILFGMGTLSTAELAGERMQIAFSSGSQEDEHSCFSDNTH 343

Query: 294 ASYLNDVIGIISSYTGEYIRMNG----------EKIHGASIHDLI-SHNNRNLAQEINDK 342
                D  G+ +SY G Y   +             ++G  I D +    N  L  +++  
Sbjct: 344 RDVWLDAEGVSNSYYGVYAGYDSDLDGTDDVTTRAVNGYGIDDYLNESGNSALDDKVSTA 403

Query: 343 FSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
            S T  ++  +   A     FD +I +     +  V   I  L  QT    +I +A+   
Sbjct: 404 LSVTATNYEAIDASARAGTPFDNLIMDEARASDNPVAKTILSLTEQTLRFAEIAVAIGYD 463

Query: 403 EPNRVIG 409
                 G
Sbjct: 464 GSVVDEG 470


>gi|330721293|gb|EGG99378.1| Iron-regulated protein A precursor [gamma proteobacterium IMCC2047]
          Length = 251

 Score =  219 bits (557), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 107/246 (43%), Positives = 149/246 (60%), Gaps = 4/246 (1%)

Query: 9   IVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLE 68
           ++        S       + ++ +YA +AHA ++DAL+ A+ L  A + L+  P++K L 
Sbjct: 5   LLGMALVCFSSATMAADEQAIVSHYADLAHAVFDDALITAQQLQQATDALLANPSEKTLA 64

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
            AR  W ++R+PYQQSEV+RFGN +VD W+ ++NAWPLDEG IDYV S Y  E   N   
Sbjct: 65  AARDAWKQSRVPYQQSEVFRFGNPVVDDWEGQLNAWPLDEGLIDYVASDYHYE-LGNEGA 123

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
           T NII+  ++ V  + ID+S ++PDLL  L+   G + N+ TGYH IEFLLWGQDL  N 
Sbjct: 124 TINIISKEELNVGGEVIDVSNLTPDLLASLNELAGSEANVATGYHAIEFLLWGQDLYGNN 183

Query: 189 REPGNRPYTDFDIGN-CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLM 245
              G RPYTDF +G  CTGG+C RR +YL+  S++LV DL  M+  W  D       +L+
Sbjct: 184 AGAGERPYTDFVVGEGCTGGNCDRRGDYLRAASQLLVDDLAYMVDEWSADKQDNYRAELL 243

Query: 246 KDINAG 251
                G
Sbjct: 244 SGDGEG 249


>gi|289677765|ref|ZP_06498655.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae FF5]
          Length = 234

 Score =  200 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 98/204 (48%), Positives = 127/204 (62%), Gaps = 2/204 (0%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L +A++  +  PN + L+ AR  WI AR+PY QSEV+RFGN I+
Sbjct: 22  NMVSAVFDDAEAGAKKLSTAVDAFLAKPNDETLKAAREAWIAARVPYMQSEVFRFGNTII 81

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 82  DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 140

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGGHCRRRV 213
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G   TGGH  RR 
Sbjct: 141 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLQGAGATGGHNDRRR 200

Query: 214 EYLKVVSKILVSDLEEMMKAWGPD 237
            YLK V+ +LVSDLEEM   W P 
Sbjct: 201 AYLKAVTDLLVSDLEEMSGNWKPG 224


>gi|257486397|ref|ZP_05640438.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 212

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 75/209 (35%), Positives = 109/209 (52%), Gaps = 3/209 (1%)

Query: 205 TGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---GQATKDLMKDINAGLNSIITGMTS 261
           TGGH  RR  YLK V+ +LVSDLEEM   W              +   +GL  ++ GM S
Sbjct: 1   TGGHNDRRRAYLKAVTDLLVSDLEEMSGNWKAGVADNYRATLEAESGESGLRKMLFGMGS 60

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           LS  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G
Sbjct: 61  LSLGELAGERMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSG 120

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
            S+  L++  +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ 
Sbjct: 121 PSLSSLVAKVDPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDA 180

Query: 382 INDLITQTESLRKIRIALDLIEPNRVIGN 410
           I  L+ QT ++ +    L + + N    +
Sbjct: 181 IAALVKQTGAIEQAAGKLGITDLNPDNAD 209


>gi|115380169|ref|ZP_01467199.1| iron-regulated protein A [Stigmatella aurantiaca DW4/3-1]
 gi|310820630|ref|YP_003952988.1| iron-regulated protein a [Stigmatella aurantiaca DW4/3-1]
 gi|115362826|gb|EAU62031.1| iron-regulated protein A [Stigmatella aurantiaca DW4/3-1]
 gi|309393702|gb|ADO71161.1| Iron-regulated protein A [Stigmatella aurantiaca DW4/3-1]
          Length = 366

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 68/414 (16%), Positives = 141/414 (34%), Gaps = 76/414 (18%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLV 59
           +   + + +V            +   ++++ ++A  +    Y+        LD+A   L 
Sbjct: 11  LALTSALVLVSCSDDEGSGPTDSTFDKQIVVHFADDVIVPTYQQLAARLEALDTASNALA 70

Query: 60  TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYG 119
            +P+ + L  AR  W  AR+P++QSE + FG      +D  +++WP++   +D V +   
Sbjct: 71  ASPSAERLTAARDAWFAARVPWEQSEGFLFGPVDSFGYDPAMDSWPVNRSDLDAVLAGNA 130

Query: 120 KENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
                                          +P+ +  L            G+H +E+LL
Sbjct: 131 P-----------------------------FTPEYVGNLEET-------LKGFHTVEYLL 154

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG---- 235
           + +D  T       +   DF           R  EYLK ++  L +    +  AW     
Sbjct: 155 FARDPSTGA----EKTVQDFTP---------REFEYLKAITLQLKNIGAALSNAWTQTVD 201

Query: 236 ----------PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEI 285
                       G +       +      ++ G      +E+A  ++       DPE   
Sbjct: 202 GRPPYRNVFAGAGDSGNTSYPSVQTAGEEMV-GGIVNILDEVANGKIADPYDAKDPELVE 260

Query: 286 DCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSN 345
             F+ N+ + + N++  + ++Y G    + G    G S+ D +   N  L   I  + ++
Sbjct: 261 SQFAYNSLSDFSNNIRSVQNAYLGH---LPGATAKGPSLADFVKDANPELDTRIRQELTD 317

Query: 346 TMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            +     +       E F + I + N      +      +     + +     L
Sbjct: 318 AITALSRIP------EPFRESIRDPNSADE--IEAAQEAIRKAQNTFQSDVAPL 363


>gi|127511610|ref|YP_001092807.1| putative lipoprotein [Shewanella loihica PV-4]
 gi|126636905|gb|ABO22548.1| putative lipoprotein [Shewanella loihica PV-4]
          Length = 382

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 75/425 (17%), Positives = 147/425 (34%), Gaps = 81/425 (19%)

Query: 2   YFITIISIVFTLPSHALSIVPNV-----------SLEKVLQNYAT-IAHAKYEDALMCAR 49
           Y    ++++  L +   S                  + ++ N +  +    Y        
Sbjct: 6   YGAIALTLISGLAACGGSGSDEPEVVVPETGFSFDADALIVNLSDEVIVKGYSTLADRGE 65

Query: 50  TLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEG 109
            L  A +TLV TP + NLE A+  W  AR P++Q E + FG       D  +++WPL+  
Sbjct: 66  ALLQATQTLVATPTQANLEAAQSAWKAARQPWEQGESHIFGPVDSLGIDPHLDSWPLNTT 125

Query: 110 FIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNIT 169
                       + +  L  ++      I     ++                        
Sbjct: 126 ------------DLKTVLINSSGFDAETIKGWNDDV------------------------ 149

Query: 170 TGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEE 229
            G+H +EFLL+G  +  NV++       +    +   G      +Y K ++         
Sbjct: 150 QGFHTMEFLLFGDGMDDNVKQIDELTANE---RDYLMGLAEVFRDYTKQLAD------AW 200

Query: 230 MMKAWGPDGQATKDLMKDIN-----------AGLNSIITGMTSLSYNELAGERMNLGLI- 277
           ++   G  G+A  +L+K                L  +I GM     +E+   ++      
Sbjct: 201 LVSHDGQSGKAYGELLKSPGVDGNTFYSSQVGVLEELIKGMI-GIVDEVGNGKIADPFGG 259

Query: 278 ---LHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRN 334
                D  +    +S N+   + +++IG+ + Y GE+     ++     I D +   +  
Sbjct: 260 SLASADTSKVESQYSWNSLTDFSDNIIGVRNVYQGEFTGEADKQ----GIIDFVRAADSE 315

Query: 335 LAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
           LA  I  +    +   H ++    +   F Q I   +  G   ++  ++ L T   SL  
Sbjct: 316 LASRIAAEIDAAILQIHAIE--GTDKMPFRQAI--KDEAGRARIQKAVDALATLQASLEN 371

Query: 395 IRIAL 399
             + L
Sbjct: 372 QVLPL 376


>gi|212636778|ref|YP_002313303.1| iron-regulated protein A [Shewanella piezotolerans WP3]
 gi|212558262|gb|ACJ30716.1| Iron-regulated protein A precursor [Shewanella piezotolerans WP3]
          Length = 382

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 73/403 (18%), Positives = 139/403 (34%), Gaps = 68/403 (16%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
           + P+       +    +++ N    +  A Y D       +  A +TLV TP + NLE A
Sbjct: 27  STPTTEPDNSFSFDATEMVTNLTEDVIVAGYNDLADEGEAMLLATQTLVATPTQANLEAA 86

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           +  W  AR P++Q E + FG       D  +++WPL+              +    L T 
Sbjct: 87  QDAWKAARQPWEQGESHIFGPVDSMGIDPHLDSWPLNT------------IDLTTVLSTT 134

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
                  I     ++                         G+H +E+LL+G  +  N + 
Sbjct: 135 TGFDAETIKSWNDDV------------------------QGFHTMEYLLFGDGVADNTKA 170

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
                  +    +   G      +Y K +      D   +           + L    + 
Sbjct: 171 IAELTANE---RDYLMGLAEVFRDYTKDL-----DDAWVVSHDASSGKAYGELLKNPGSD 222

Query: 251 G----------LNSIITGMTSLSYNELAGERMNLGLI----LHDPEQEIDCFSDNTYASY 296
           G          +  +I GM     +E+   ++           D  +    +S N+   +
Sbjct: 223 GNTFYSSNVGVVEELINGMI-GIVDEVGNGKIADPFGESVSSADTSKVESQYSWNSLTDF 281

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDR 356
            N++IG+ + Y GE      ++     I D ++  +++LA  +  +  N +     ++  
Sbjct: 282 SNNIIGVRNVYQGELTGAADKQ----GIVDFVAAADKDLATRVGTEIDNAILTIQAIE-- 335

Query: 357 AENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
             N   F Q IS  + EG K ++  ++ L     SL    + L
Sbjct: 336 GSNDMPFRQAIS--DTEGRKRIQTAVDALSKLQTSLESDVLPL 376


>gi|24216168|ref|NP_713649.1| hypothetical protein LA_3469 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|24197416|gb|AAN50667.1| putative lipoprotein [Leptospira interrogans serovar Lai str.
           56601]
          Length = 440

 Score =  186 bits (471), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 84/422 (19%), Positives = 149/422 (35%), Gaps = 57/422 (13%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT--PNKKNLENARLQWIRAR 78
            P  +  +V+  Y  + +  Y+ +   A    +A+        P   +  N +  ++ AR
Sbjct: 42  QPTATRAQVVDRYLQLGYESYDQSYKDAVAFQTAVTAFAANNNPTAADHINLKNLYVVAR 101

Query: 79  IPYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFIDYVDSSYGKE 121
             Y  +E +RF +  +D  D                   +N WPLDE  ID         
Sbjct: 102 ASYLTTEAFRFSSGPIDNVDILGCGSNADGSGDEECEGLINGWPLDESAID--------- 152

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
                    N I N+          L++            +  +T +T G+H IE++LWG
Sbjct: 153 ---------NYINNNNAAQMTYANVLAVNGNAGANGGANDDDDETALTVGWHAIEYILWG 203

Query: 182 QDL--KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           QDL      +  G R   D      T GH  +R  Y+K V+  LV  L+ +   +    +
Sbjct: 204 QDLFNGGVNQISGQRTVADLSGAAGTDGH--KRRTYMKAVTDGLVLQLKLIRDQFEDGAR 261

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
            +  L  + +A +  I  G+      E  GER+         E+E  CFSD T A +  +
Sbjct: 262 YSDGLKSNPDAAVTYIFQGLGKFIAGEWGGERLTGTFGGQ-QEEEHSCFSDTTKADFYYN 320

Query: 300 VIGIISSYTGEYIRMNGEKIH-GASIHDLISHNN------RNLAQEINDKFSNTMKDFH- 351
              +++ + G Y    G     G  + +L    N      +  A       + + +    
Sbjct: 321 AQSVLNIWNGSYELKKGTVTSTGPGLKNLFGTFNVPGIGFQATAARDTFCINLSEQTADP 380

Query: 352 ---ILKDRAENIESFDQMISENNPEGNKI--VRNLINDLITQTESLRKIRIALDLIEPNR 406
                         +DQ+I   + E   +  V+  I D     +++      + +   + 
Sbjct: 381 NYTTSCKPGSLTGRYDQIIRNTDNEYQILFDVQKFIGD--KMKKTITDAAKTIGISITDF 438

Query: 407 VI 408
            I
Sbjct: 439 SI 440


>gi|167625435|ref|YP_001675729.1| putative lipoprotein [Shewanella halifaxensis HAW-EB4]
 gi|167355457|gb|ABZ78070.1| putative lipoprotein [Shewanella halifaxensis HAW-EB4]
          Length = 382

 Score =  186 bits (471), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 68/421 (16%), Positives = 141/421 (33%), Gaps = 79/421 (18%)

Query: 5   TIISIVFTLPSHALSIVPN-----------VSLEKVLQNYAT-IAHAKYEDALMCARTLD 52
             ++++  L +   S   +            S  +++ N    +  A Y +  +    + 
Sbjct: 9   LAVALISALSACGGSGSDDTPVVVPETGFTFSATEMVTNLTDDVIVAGYSNLALRGAAML 68

Query: 53  SAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFID 112
            A +TLV TP + NL  A+  W  AR P++Q E + FG       D  +++WPL+     
Sbjct: 69  QATQTLVATPTQANLLAAQEAWKAARQPWEQGESHIFGPVDSLGIDPHLDSWPLNTT--- 125

Query: 113 YVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGY 172
                    +    L          I     ++                         G+
Sbjct: 126 ---------DLTTVLANNTGFDADTIKGWNDDV------------------------QGF 152

Query: 173 HVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMK 232
           H +E+LL+G  +  N +        +    +   G      +Y K +      D   +  
Sbjct: 153 HTMEYLLFGDGVADNTKTISELTTNE---RDYLMGLAEVFRDYTKTL-----DDAWLISH 204

Query: 233 AWGPDGQATKDLMKDINAG----------LNSIITGMTSLSYNELAGERMNLGLI----L 278
                    + L      G          +  ++ GM     +E+   ++          
Sbjct: 205 DGQSGKAYGELLKNSGADGNTFYSSEVGVVEELVNGMI-GIVDEVGNGKIADPFGESIDK 263

Query: 279 HDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQE 338
            D  +    +S N+   + +++IG+ + Y GE      ++     I D ++  N  LA  
Sbjct: 264 ADTSKVESQYSWNSLTDFSDNIIGVRNVYLGELEGNADKQ----GIIDFVNAANPALATR 319

Query: 339 INDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIA 398
           +  +  + +   + +     N   F Q IS+++  G   +++ ++ L     SL    + 
Sbjct: 320 VKTEIDDAITKINAI--AGANNMPFRQAISDSD--GRVRIQSAVDALTKLQASLESDVLP 375

Query: 399 L 399
           L
Sbjct: 376 L 376


>gi|62184293|gb|AAW65730.1| LruB [Leptospira interrogans serovar Pomona]
          Length = 439

 Score =  185 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 83/422 (19%), Positives = 146/422 (34%), Gaps = 58/422 (13%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT--PNKKNLENARLQWIRAR 78
            P  +  +V+  Y  + +  Y+ +   A    +A+        P   +  N +  ++ AR
Sbjct: 42  QPTATRAQVVDRYLQLGYESYDQSYKDAVAFQTAVTAFAANNNPTAADHINLKNLYVVAR 101

Query: 79  IPYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFIDYVDSSYGKE 121
             Y  +E +RF +  +D  D                   +N WPLDE  ID   ++ G  
Sbjct: 102 ASYLTTEAFRFSSGPIDNVDILGCGSNADGSGDEECEGLINGWPLDESAIDNYIANAGNA 161

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
                +   N  AN                             +T +T G+H IE++LWG
Sbjct: 162 TTYAAILATNGDAN--------------------ANNADDQDDETALTVGWHAIEYILWG 201

Query: 182 QDL--KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ 239
           QDL      +  G R   D       G    RR  Y+K V+  LV  L+ +   +    +
Sbjct: 202 QDLFNGGINQISGQRNIADLTGA-SPGTVGGRRRAYMKAVTDGLVLQLKLIRDQFEDGAR 260

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
            +  L  + +A +  I  G+      E  GER+         E+E  CFSD T A +  +
Sbjct: 261 YSDGLKSNPDAAVTYIFQGLGKFIAGEWGGERLTGTFGGQ-QEEEHSCFSDTTKADFYYN 319

Query: 300 VIGIISSYTGEYIRMNGEKIH-GASIHDLISHNN------RNLAQEINDKFSNTMKDFH- 351
              +++ + G Y    G     G  + +L    N      +  A       + + +    
Sbjct: 320 AQSVLNIWNGSYELKKGTVTSTGPGLKNLFGTFNVPGIGFQATAARDTFCINLSEQTADP 379

Query: 352 ---ILKDRAENIESFDQMISENNPEGNKI--VRNLINDLITQTESLRKIRIALDLIEPNR 406
                         +DQ+I   + E   +  V+  I D     +++      + +   + 
Sbjct: 380 NYTTSCKPGSLTGRYDQIIRNTDNEYQILFDVQKFIGD--KMKKTITDAAKTIGISITDF 437

Query: 407 VI 408
            I
Sbjct: 438 SI 439


>gi|45656611|ref|YP_000697.1| putative lipoprotein [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
 gi|45599846|gb|AAS69334.1| putative lipoprotein [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
          Length = 440

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 84/423 (19%), Positives = 155/423 (36%), Gaps = 59/423 (13%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT--PNKKNLENARLQWIRAR 78
            P  +  +V+  Y  + +  Y+ +   A    +A+        P   +  N +  ++ AR
Sbjct: 42  QPTATRAQVVDRYLQLGYESYDQSYKDAVAFQTAVTAFAANNNPTAADHINLKNLYVVAR 101

Query: 79  IPYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFID-YVDSSYGK 120
             Y  +E +RF +  +D  D                   +N WPLDE  ID Y++++  +
Sbjct: 102 ASYLTTEAFRFSSGPIDNVDILGCGSNADGSGDEECEGLINGWPLDESAIDNYINNNAAQ 161

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
           +     +  AN  A +   V++ +                    +T +T G+H IE++LW
Sbjct: 162 QPTYAAILAANGDAGANNAVDQDD--------------------ETALTVGWHAIEYILW 201

Query: 181 GQDL--KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           GQDL      +  G R   D       G    RR  Y+K V+  LV  L+ +   +    
Sbjct: 202 GQDLFNGGINQISGQRNIADLTGA-SPGTVGGRRRTYMKAVTDGLVLQLKLIRDQFEDGA 260

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLN 298
           + +  L  + +A +  I  G+      E  GER+         E+E  CFSD T A +  
Sbjct: 261 RYSDGLKSNPDAAVTYIFQGLGKFIAGEWGGERLTGTFGGQ-QEEEHSCFSDTTKADFYY 319

Query: 299 DVIGIISSYTGEYIRMNGEKIH-GASIHDLISHNN------RNLAQEINDKFSNTMKDFH 351
           +   +++ + G Y    G     G  + +L    N      +  A       + + +   
Sbjct: 320 NAQSVLNIWNGSYELKKGTVTSTGPGLKNLFGTFNVPGIGFQATAARDTFCINLSEQTAD 379

Query: 352 ----ILKDRAENIESFDQMISENNPEGNKI--VRNLINDLITQTESLRKIRIALDLIEPN 405
                          +DQ+I   + E   +  V+  I D     +++      + +   +
Sbjct: 380 PNYTTSCKPGSLTGRYDQIIRNTDNEYQILFDVQKFIGD--KMKKTITDAAKTIGISITD 437

Query: 406 RVI 408
             I
Sbjct: 438 FSI 440


>gi|42522171|ref|NP_967551.1| Iron-regulated protein A precursor [Bdellovibrio bacteriovorus
           HD100]
 gi|39574702|emb|CAE78544.1| Iron-regulated protein A precursor [Bdellovibrio bacteriovorus
           HD100]
          Length = 361

 Score =  183 bits (464), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 74/400 (18%), Positives = 145/400 (36%), Gaps = 83/400 (20%)

Query: 25  SLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           + ++++ + +  +  A Y D       L +A++ L  + N++NL+ A+  W  ARIP++ 
Sbjct: 22  TNKEIINHVSYNVILATYNDLATKTAELSAAVDALAASTNQENLDKAQAAWRAARIPWES 81

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           SE + FG       D  ++ WPL++  +D V SS                          
Sbjct: 82  SESFLFGPVDSLGIDPLLDTWPLNKLDLDSVMSSN------------------------- 116

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
                 I+ DL+R L            G+H +E+LL+G    +N +   +          
Sbjct: 117 ----RKITVDLVRAL-------GTNLQGFHTLEYLLFGDGKVSNTKPAASLTA------- 158

Query: 204 CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA-----------------TKDLMK 246
                  +++EYLK  +++L     E+  AW  +                      +   
Sbjct: 159 -------KQLEYLKASAQLLAEHTAELAHAWTTNYDPENPAAPGYVKVISTPGLNNEFYS 211

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLI----LHDPEQEIDCFSDNTYASYLNDVIG 302
              A +   + GM     +E+A  +M+  +       +       F+ N+   + +++  
Sbjct: 212 SERAVMEEFVQGMM-GIVDEVANGKMSDPMGADIGSANMALVESPFAWNSLKDFQHNIRS 270

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           + S YTG Y         G  +  L+   + +LA  +     N +     ++        
Sbjct: 271 VYSIYTGHYKNN-----KGPGVKALVEKVDASLAARVEADILNCIALIEAIRPA--GGGD 323

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDL 401
           F Q I   +  G    +  I  L     +L  ++   LD+
Sbjct: 324 FGQAIFTKD--GRARTQAAIEALNALHATLESEVLPTLDM 361


>gi|157376924|ref|YP_001475524.1| putative lipoprotein [Shewanella sediminis HAW-EB3]
 gi|157319298|gb|ABV38396.1| putative lipoprotein [Shewanella sediminis HAW-EB3]
          Length = 384

 Score =  182 bits (460), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 69/423 (16%), Positives = 142/423 (33%), Gaps = 79/423 (18%)

Query: 3   FITIISIVFTLPSHALSIVPNVSL-----------EKVLQNYAT-IAHAKYEDALMCART 50
               ++++ TL +   S   + +             +++ N    +  + Y    M   +
Sbjct: 9   IAIALALISTLAACGGSGSDDTTPPVDESKFEFAATEMITNLTDDVIVSGYATLAMKGES 68

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           L  A +TLV TP + NL  A+  W  AR P++Q E + FG       D  +++WPL+   
Sbjct: 69  LLLATQTLVNTPTQANLLAAQEAWKAARQPWEQGESHIFGPVDSLGIDPHLDSWPLNTT- 127

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
                      +    L   +      I     ++                         
Sbjct: 128 -----------DLTTVLANNSGFDAETIKGWNDDV------------------------Q 152

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEM 230
           G+H +E+LL+G  +  N +   +             G      +Y K     ++ D  ++
Sbjct: 153 GFHTMEYLLFGDGIADNEKAIADLT---TAENEYLMGLAEVFRDYTK-----VLDDAWQV 204

Query: 231 MKAWGPDGQATKDLMKDINAG----------LNSIITGMTSLSYNELAGERMNLGLI--- 277
                      + +    + G          +  ++ GM     +E+   ++        
Sbjct: 205 SHDGQSGKAYGELVKSPGSDGNTFYSSQVGVIQELVNGMI-GIVDEVGNGKIADPFGVSL 263

Query: 278 -LHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLA 336
              D  +    +S N+   + ++++G+ + Y GE    + ++     I D +   +  LA
Sbjct: 264 ETADTSKVESQYSWNSLTDFSDNIVGVRNVYQGELTGASDKQ----GIVDFVKAADATLA 319

Query: 337 QEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
             +  +  + +     +     N   F Q IS  + EG   V+  I+ L     SL    
Sbjct: 320 ARVGSEIDDAIIKIQAI--SGTNNMPFRQAIS--DVEGRARVQTAIDALSKLQTSLESDI 375

Query: 397 IAL 399
           + L
Sbjct: 376 LPL 378


>gi|91792084|ref|YP_561735.1| putative lipoprotein [Shewanella denitrificans OS217]
 gi|91714086|gb|ABE54012.1| imelysin. Metallo peptidase. MEROPS family M75 [Shewanella
           denitrificans OS217]
          Length = 387

 Score =  178 bits (451), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 70/406 (17%), Positives = 142/406 (34%), Gaps = 89/406 (21%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            A +++ N++ E ++  YA +A             L  A + L+ + ++ +L  A+  W 
Sbjct: 42  AATAMITNLTQEVIVTGYADLA--------AKGSELVLATQKLINSTSQADLVAAQDAWK 93

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR P++Q E + FG     + D  +++WPL+              +    L TA     
Sbjct: 94  AARQPWEQGESHIFGPVDSLSIDPHLDSWPLNTT------------DLSTQLTTAAGFDA 141

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
             I     ++                         G+H +E+LL+G  +  N ++     
Sbjct: 142 ETIKSWNDDV------------------------QGFHTMEYLLFGDGVADNTKDISELT 177

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD------------------ 237
                          +  EYL  ++++     + +  AW  +                  
Sbjct: 178 V--------------KEREYLIALAQVFRDHAKTLDDAWQINHKPDDANAKPYAELLSQP 223

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLI----LHDPEQEIDCFSDNTY 293
           G     +     A +  +I GM     +E+   +++          D  +    +S N+ 
Sbjct: 224 GVDGNTVYSSELAVIEELINGMI-GIVDEVGNGKISDPFGDSITSADTSKVESQYSWNSL 282

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
             + N++ G+ + Y GE+     ++     + D +S  + NLA  +  +  + +     +
Sbjct: 283 TDFANNIQGVRNVYQGEFTGNTDKQ----GVKDFVSAADANLAVRVASEIDDAIIKIQAI 338

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
                N   F Q I + N  G   ++  I+ L     SL    I L
Sbjct: 339 --SGSNSMPFRQAIKDAN--GRVRIQTAIDALTKLKTSLESDVIPL 380


>gi|91217748|ref|ZP_01254704.1| putative lipoprotein [Psychroflexus torquis ATCC 700755]
 gi|91184086|gb|EAS70473.1| putative lipoprotein [Psychroflexus torquis ATCC 700755]
          Length = 379

 Score =  178 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 63/416 (15%), Positives = 132/416 (31%), Gaps = 71/416 (17%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEK----------VLQNYAT-IAHAKYEDALMCART 50
           Y I  +  +  L +++ S    V+ ++          +L N+A  I    + D       
Sbjct: 8   YIIVTLLTLGALATYSCSDDDTVTPDEGSNPTFDRGVMLTNWADNIIIPSFTDFGTKTSA 67

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           L+ A +T V  P   NLE+ +  W  A I +Q+  ++  G      +  ++NA+P +   
Sbjct: 68  LEVATQTFVDDPTTVNLESLQSSWFNAYISFQEVSLFEIGKAEEINYRIRLNAYPTNVSK 127

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           ID                  + I N  I                           +    
Sbjct: 128 ID------------------DYIENGNINFALPS---------------------SFDAQ 148

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEM 230
           G+  +++LL+G                +      T  +       L  VS+ + S  EE+
Sbjct: 149 GFPALDYLLYGLGETN----------EETLGFFTTHTNADSYKTLLSSVSQTIHSLTEEV 198

Query: 231 MKAWGPD--GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL----HDPEQE 284
           + +W          ++    N  ++ +           L   ++ +   +      P+  
Sbjct: 199 ITSWTGPFRDSFVANIASSANGSVDKLTNDFIYYYEKSLRAGKVGIPAGIFSNDPLPQNV 258

Query: 285 IDCF-SDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLIS--HNNRNLAQEIND 341
              +  D +    L  +    + + GE+       I      D ++      +L+  IN 
Sbjct: 259 EALYKGDISKELLLASIETTQNFFNGEHFDGTTAGIGFKDYLDFLNTIKEGDDLSVLINQ 318

Query: 342 KFSNTMKDFHILKDRAENIESFD--QMISENNPEGNKIVRNLINDLITQTESLRKI 395
           +F+   +    L D        D  +M+   N     +V   ++ L   +  +  +
Sbjct: 319 QFNIAEEKAKTLNDNFTIQIENDNNKMLETYNELQRNVVFIKVDMLQALSIDVDYV 374


>gi|153823899|ref|ZP_01976566.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae B33]
 gi|126518577|gb|EAZ75800.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae B33]
          Length = 186

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 73/180 (40%), Positives = 109/180 (60%), Gaps = 1/180 (0%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
             ++   +     + + S     +  +V+++YA IA+A Y D+ + A+ L   I+  +  
Sbjct: 5   SILSSTILASLTLTTSASFAAAPTQAQVVEHYADIAYAVYADSRVTAQQLQKTIDRFLQA 64

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P  + LE  +  W+ AR+PYQQSEV+RFGN IVD W+ ++NAWPLDEG IDYV  SY  E
Sbjct: 65  PTAQGLEEVKQAWLAARVPYQQSEVFRFGNAIVDDWEGQLNAWPLDEGLIDYVAGSYQHE 124

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
              N    ANIIAN+ + +   ++D+  I+P+LL  L+   G + N+ +GYH IEFLLWG
Sbjct: 125 -LGNEGANANIIANTALTIGATKVDVKEITPELLASLNEIGGSEANVASGYHAIEFLLWG 183


>gi|170725155|ref|YP_001759181.1| putative lipoprotein [Shewanella woodyi ATCC 51908]
 gi|169810502|gb|ACA85086.1| putative lipoprotein [Shewanella woodyi ATCC 51908]
          Length = 381

 Score =  176 bits (445), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 68/423 (16%), Positives = 135/423 (31%), Gaps = 78/423 (18%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNY------------ATIAHAKYEDALMCAR 49
           Y    I+++ TL +   S   + +   V   +              +  + Y        
Sbjct: 6   YSAIAIALISTLAACGGSGSDDTTPTPVDDKFEFAATEMITNLTDDVIVSGYASLATKGE 65

Query: 50  TLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEG 109
            +  A +TLV+   + NL  A+  W  AR+P++Q E + FG       D  +++WPL+  
Sbjct: 66  EMLLATQTLVSNKTQANLLAAQEAWKAARLPWEQGESHIFGPVDSLGIDPHLDSWPLNTT 125

Query: 110 FIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNIT 169
            +  V +S                    I     ++                        
Sbjct: 126 DLTTVLASNA------------GFDAETIKGWNDDV------------------------ 149

Query: 170 TGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEE 229
            G+H +E+LL+G  +  N +        + +      G      +Y K +      D  +
Sbjct: 150 QGFHTMEYLLFGDGVADNEKAIAELTQAESEY---LMGLAEVFRDYTKTL-----DDAWQ 201

Query: 230 MMKAWGPDGQA---------TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL-- 278
           +                              +  +I GM     +E+   ++        
Sbjct: 202 VSHDGSGKAYGELVKTPGSEGNTFYSSQVGVIEELINGMI-GIVDEVGNGKIADPFGTSA 260

Query: 279 --HDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLA 336
              D  +    +S N+   + +++IG+ + Y GE      ++     I D +   +  LA
Sbjct: 261 ATADTSKVESQYSWNSLTDFSDNIIGVRNVYQGELTGAADKQ----GIIDFVKAADEVLA 316

Query: 337 QEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
             +  +  + +     +     N   F Q IS  + EG   V+  ++ L     SL    
Sbjct: 317 LRVGSEIDDAIIKIKAI--SGSNNMPFRQAIS--DAEGRVRVQTAVDALTKLQTSLESDV 372

Query: 397 IAL 399
           + L
Sbjct: 373 LPL 375


>gi|163749167|ref|ZP_02156417.1| putative lipoprotein [Shewanella benthica KT99]
 gi|161331237|gb|EDQ02126.1| putative lipoprotein [Shewanella benthica KT99]
          Length = 388

 Score =  176 bits (445), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 69/425 (16%), Positives = 146/425 (34%), Gaps = 79/425 (18%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSL-----------EKVLQNYAT-IAHAKYEDALMCAR 49
           Y    I+++ TL +   S   + +             +++ N    +  + Y    +   
Sbjct: 10  YSAVAIALISTLAACGGSGSDDTTTPPTDNQFEFAATEMITNLTDDVIVSGYSALAIKGD 69

Query: 50  TLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEG 109
            L  A +TLV    ++NL   +  W  AR P++Q E + FG     + D  +++WPL+  
Sbjct: 70  ELLQATQTLVNNKTQENLLAVQDAWKAARQPWEQGESHIFGPVDSLSIDPHLDSWPLNTV 129

Query: 110 FIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNIT 169
            +  V ++                    I     +I                        
Sbjct: 130 DLISVLAN-----------NTGGFDADTIKGWNDDI------------------------ 154

Query: 170 TGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEE 229
            G+H +E+LL+G  +  N +   +   T+ +      G     + Y K +      D  +
Sbjct: 155 QGFHTMEYLLFGDGVADNEKIVADLTTTETEY---LMGLAEVFLSYTKTL-----DDAWQ 206

Query: 230 MMKAWGPDGQATKDLMKDINA-----------GLNSIITGMTSLSYNELAGERMNLGLI- 277
           +         A  + +K+               +  ++ GM +   +E+   ++      
Sbjct: 207 ISHDGQTGSYAYGEFVKNPGTEWNNIYASQVGVIEELVNGMIA-IVDEVGNGKIADPFGT 265

Query: 278 ---LHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRN 334
                D       +S N+   + +++IG+ + Y GE    + ++     I D +   +  
Sbjct: 266 SIATADTSLVESQYSWNSLTDFSDNIIGVRNVYQGELTGASDKQ----GIVDFVMAADVT 321

Query: 335 LAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRK 394
           LA  +  +  + +     +K    N   F Q I+  + +G   ++  I+ L     SL  
Sbjct: 322 LAARVGSEIDDAIIKIQAIK--GSNNMPFRQAIA--DADGRVKIQTAIDALSKLQASLTD 377

Query: 395 IRIAL 399
             + L
Sbjct: 378 EVLPL 382


>gi|157960499|ref|YP_001500533.1| putative lipoprotein [Shewanella pealeana ATCC 700345]
 gi|157845499|gb|ABV85998.1| putative lipoprotein [Shewanella pealeana ATCC 700345]
          Length = 383

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 70/423 (16%), Positives = 140/423 (33%), Gaps = 80/423 (18%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLE------------KVLQNYAT-IAHAKYEDALMCART 50
           +  I+++  L     S   + + E             ++ N    +  A Y +  +    
Sbjct: 8   VVAIALISALAGCGGSGSDDSTPEVIPETGFTFSATDMVANLTDDVIVAGYSNLAVRGEA 67

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           +  A +TLV TP + NLE A+  W  AR P++Q E + FG       D  +++WPL+   
Sbjct: 68  MLQATQTLVATPTQANLEAAQAAWKAARQPWEQGESHIFGPVDSLGIDPHLDSWPLNTT- 126

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
                      +    L          I     ++                         
Sbjct: 127 -----------DLTTVLANNAGFDAETIKGWNDDV------------------------Q 151

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEM 230
           G+H +E+LL+G  +  N +        +    +   G      +Y K +      D   +
Sbjct: 152 GFHTMEYLLFGDGVADNTKTISELTVNE---RDYLMGLAEVFRDYTKTL-----DDAWLI 203

Query: 231 MKAWGPDGQATKDLMKDINAG----------LNSIITGMTSLSYNELAGERMNLGLI--- 277
                      + L      G          +  ++ GM     +E+   ++        
Sbjct: 204 SHDGQNGKAYGELLKNSGADGNTFYSSEVGVVEELVNGMI-GIVDEVGNGKIADPFGESL 262

Query: 278 -LHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLA 336
              D  +    +S N+   + ++++G+ + Y GE      ++     I D +   N  LA
Sbjct: 263 AKADTSKVESQYSWNSLTDFSDNIVGVRNVYLGELEGNADKQ----GIIDFVDAANPELA 318

Query: 337 QEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
             + D+  + +     +    +N   F Q IS  + +G   ++  ++ L     SL    
Sbjct: 319 TRVKDEIDDAISKIEAI--AGDNNMPFRQAIS--DADGRVRIQTAVDALTKLQASLESDV 374

Query: 397 IAL 399
           + L
Sbjct: 375 LPL 377


>gi|294139363|ref|YP_003555341.1| hypothetical protein SVI_0592 [Shewanella violacea DSS12]
 gi|293325832|dbj|BAJ00563.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 339

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 64/374 (17%), Positives = 133/374 (35%), Gaps = 57/374 (15%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  + Y    +    +  A +TLV    + NL  A+  W  AR P++Q E + FG    
Sbjct: 8   DVIISGYSTLAIKGEEMFLASQTLVANKTQANLLAAQEAWKAARQPWEQGESHIFGPVDS 67

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
              D  +++WPL+   +  V +              +  +   I     ++         
Sbjct: 68  LGIDPHLDSWPLNTTDLKTVLTDN------------SGFSADTIKGWNDDV--------- 106

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
                           G+H +E+LL+G  +  N ++  +   ++ +      G      +
Sbjct: 107 ---------------QGFHTMEYLLFGDGVADNQKDVADLTMSEAEY---LMGLSEVFRD 148

Query: 215 YLKVVSKI-LVSDLEEMMKA----WGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAG 269
           Y K +    L+S   +  KA        G A           +  ++ GM     +E+  
Sbjct: 149 YTKTLDDSWLISHDGQTGKAYGELVKNPGTADNTFYASQVGVIQELVNGMI-GIVDEVGN 207

Query: 270 ERMNLGLI----LHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
            ++           D  +    +S N+   + +++IG+ + Y GE    + ++     I 
Sbjct: 208 GKIADPFGTSAATADTSKVESQYSWNSLTDFSDNIIGVRNVYQGELTGASDKQ----GII 263

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           D +   +  LA  ++ +  + +     +K    N   F Q I+  + EG   ++  ++ L
Sbjct: 264 DFVKAGDEALALRVSSEIDDAIIKIQAIK--GSNNMPFRQAIA--DAEGRVRIQTAVDAL 319

Query: 386 ITQTESLRKIRIAL 399
                SL    + L
Sbjct: 320 SKLQASLESDVVPL 333


>gi|257486398|ref|ZP_05640439.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 234

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 76/168 (45%), Positives = 104/168 (61%), Gaps = 1/168 (0%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A ++DA   A+ L + ++  +  PN + L+ AR  W+ AR+PY QSEV+RFGN I+
Sbjct: 66  NMVSAVFDDAETGAKKLSTVVDAFLAKPNDETLKAARDAWVAARVPYMQSEVFRFGNTII 125

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D W+ +VNAWPLDEG IDYV   Y      N   TANIIAN++I V E ++D+  I+ + 
Sbjct: 126 DDWEGQVNAWPLDEGLIDYVAKDYQ-HALGNPGATANIIANTEIQVGEDKVDVKEITSEK 184

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG 202
           L  L+   G + N+ TGYH IEFLLWGQDL       G RP +D+  G
Sbjct: 185 LASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGARPASDYLEG 232


>gi|256841757|ref|ZP_05547263.1| iron-regulated protein A [Parabacteroides sp. D13]
 gi|256736651|gb|EEU49979.1| iron-regulated protein A [Parabacteroides sp. D13]
          Length = 403

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 65/393 (16%), Positives = 137/393 (34%), Gaps = 79/393 (20%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           LP+ + +      +  V+  +   +A   Y+D L       +A++  + + +K +L +A 
Sbjct: 41  LPADSGTKPTEDQMSAVVATFVDEVALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADAC 100

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W   R+P++QSE + FG   +   D  +++WPLD+  I+                   
Sbjct: 101 DAWRAVRVPWEQSEAFLFGVADLAQLDPSLDSWPLDKNGIE------------------E 142

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
           IIA  +       +D                        G+H  E +L+      ++   
Sbjct: 143 IIATGEFSKISGAVD-------------EDAEDGPQNLRGFHTAEKMLFLDGEPRDLE-- 187

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD-------GQATKDL 244
                        T    +  +EYLK+VS+ ++SD +++   W              + +
Sbjct: 188 -------------TSPFAKNELEYLKLVSERMLSDTQDLYNGWLKGLGTSDVPSSYAEAM 234

Query: 245 MK---------DINAGLNSIITG--MTSLSYNELAGERMNLGL--------ILHDPEQ-- 283
            K         ++   +  ++ G    +   NE+   ++   +           DP    
Sbjct: 235 KKHDGSAYSIGNVYQAIELMLNGNNGMAGISNEVGSAKITDPVTAWNGSNKDATDPNNPG 294

Query: 284 ---EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEIN 340
                  +S N+   Y N+++ I ++Y G    ++ E    +S+H L    N  L   + 
Sbjct: 295 VLAVESWYSWNSLDDYKNNIVSIKNAYFGG-RDLDEESASESSLHALTKMINPTLDSLMV 353

Query: 341 DKFSNTMKDFHILKDRAENIESFDQMISENNPE 373
            +   T+   + +     N     + I+     
Sbjct: 354 VQIDKTIDAINAIGYPFRNNLGDTEHINTATEA 386


>gi|301310995|ref|ZP_07216924.1| imelysin superfamily [Bacteroides sp. 20_3]
 gi|300831058|gb|EFK61699.1| imelysin superfamily [Bacteroides sp. 20_3]
          Length = 403

 Score =  172 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 64/393 (16%), Positives = 137/393 (34%), Gaps = 79/393 (20%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           LP+ + +      +  V+  +   +A   Y+D L       +A++  + + +K +L +A 
Sbjct: 41  LPADSGAKPTEDQMSAVVATFVDEVALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADAC 100

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W   R+P++QSE + FG   +   D  +++WPLD+  I+                   
Sbjct: 101 DAWRAVRVPWEQSEAFLFGVADLAQLDPSLDSWPLDKNGIE------------------E 142

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
           IIA  +       +D                        G+H  E +L+      ++   
Sbjct: 143 IIATGEFSKISGAVD-------------EDAEDGPQNLRGFHTAEKMLFLDGEPRDLE-- 187

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD-------GQATKDL 244
                        T    +  +EYLK+VS+ ++SD +++   W              + +
Sbjct: 188 -------------TSPFAKNELEYLKLVSERMLSDTQDLYNGWLKGLGTSDVPSSYAEAM 234

Query: 245 MK---------DINAGLNSIITG--MTSLSYNELAGERMNLGL--------ILHDPEQ-- 283
            K         ++   +  ++ G    +   NE+   ++   +           DP    
Sbjct: 235 KKHDGSAYSIGNVYQAIELMLNGNNGMAGISNEVGSAKITDPVTAWNGSNKDATDPNNPG 294

Query: 284 ---EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEIN 340
                  +S N+   Y N+++ I ++Y G    ++ +    +S+H L    N  L   + 
Sbjct: 295 VLAVESWYSWNSLDDYKNNIVSIKNAYFGG-RDLDEKSASESSLHALTKMINPTLDSLMV 353

Query: 341 DKFSNTMKDFHILKDRAENIESFDQMISENNPE 373
            +   T+   + +     N     + I+     
Sbjct: 354 VQIDKTIDAINAIGYPFRNNLGDTEHINTATEA 386


>gi|150009201|ref|YP_001303944.1| putative iron-regulated protein A [Parabacteroides distasonis ATCC
           8503]
 gi|298377011|ref|ZP_06986965.1| imelysin superfamily protein [Bacteroides sp. 3_1_19]
 gi|149937625|gb|ABR44322.1| putative iron-regulated protein A precursor [Parabacteroides
           distasonis ATCC 8503]
 gi|298265995|gb|EFI07654.1| imelysin superfamily protein [Bacteroides sp. 3_1_19]
          Length = 403

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 65/393 (16%), Positives = 137/393 (34%), Gaps = 79/393 (20%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           LP+ + +      +  V+  +   +A   Y+D L       +A++  + + +K +L +A 
Sbjct: 41  LPADSGAKPTEDQMSAVVATFVDEVALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADAC 100

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W   R+P++QSE + FG   +   D  +++WPLD+  I+                   
Sbjct: 101 DAWRAVRVPWEQSEAFLFGVADLAQLDPSLDSWPLDKNGIE------------------E 142

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
           IIA  +       +D                        G+H  E +L+      ++   
Sbjct: 143 IIATGEFSKISGAVD-------------EDAEDGPQNLRGFHTAEKMLFLDGEPRDLE-- 187

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD-------GQATKDL 244
                        T    +  +EYLK+VS+ ++SD +++   W              + +
Sbjct: 188 -------------TSPFAKNELEYLKLVSERMLSDTQDLYNGWLKGLGTSDVPSSYAEAM 234

Query: 245 MK---------DINAGLNSIITG--MTSLSYNELAGERMNLGL--------ILHDPEQ-- 283
            K         ++   +  ++ G    +   NE+   ++   +           DP    
Sbjct: 235 KKHDGSAYSIGNVYQAIELMLNGNNGMAGISNEVGSAKITDPVTAWNGSNKDATDPNNPG 294

Query: 284 ---EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEIN 340
                  +S N+   Y N+++ I ++Y G    ++ E    +S+H L    N  L   + 
Sbjct: 295 VLAVESWYSWNSLDDYKNNIVSIKNAYFGG-RDLDEESASESSLHALTKMINPTLDSLMV 353

Query: 341 DKFSNTMKDFHILKDRAENIESFDQMISENNPE 373
            +   T+   + +     N     + I+     
Sbjct: 354 VQIDKTIDAINAIGYPFRNNLGDTEHINTATEA 386


>gi|255015808|ref|ZP_05287934.1| putative iron-regulated protein A precursor [Bacteroides sp. 2_1_7]
          Length = 395

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 65/393 (16%), Positives = 137/393 (34%), Gaps = 79/393 (20%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           LP+ + +      +  V+  +   +A   Y+D L       +A++  + + +K +L +A 
Sbjct: 33  LPADSGTKPTEDQMSAVVATFVDEVALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADAC 92

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W   R+P++QSE + FG   +   D  +++WPLD+  I+                   
Sbjct: 93  DAWRAVRVPWEQSEAFLFGVADLAQLDPSLDSWPLDKNGIE------------------E 134

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
           IIA  +       +D                        G+H  E +L+      ++   
Sbjct: 135 IIATGEFSKISGAVD-------------EDAEDGPQNLRGFHTAEKMLFLDGEPRDLE-- 179

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD-------GQATKDL 244
                        T    +  +EYLK+VS+ ++SD +++   W              + +
Sbjct: 180 -------------TSPFAKNELEYLKLVSERMLSDTQDLYNGWLKGLGTSDVPSSYAEAM 226

Query: 245 MK---------DINAGLNSIITG--MTSLSYNELAGERMNLGL--------ILHDPEQ-- 283
            K         ++   +  ++ G    +   NE+   ++   +           DP    
Sbjct: 227 KKHDGSAYSIGNVYQAIELMLNGNNGMAGISNEVGSAKITDPVTAWNGSNKDATDPNNPG 286

Query: 284 ---EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEIN 340
                  +S N+   Y N+++ I ++Y G    ++ E    +S+H L    N  L   + 
Sbjct: 287 VLAVESWYSWNSLDDYKNNIVSIKNAYFGG-RDLDEESASESSLHALTKMINPTLDSLMV 345

Query: 341 DKFSNTMKDFHILKDRAENIESFDQMISENNPE 373
            +   T+   + +     N     + I+     
Sbjct: 346 VQIDKTIDAINAIGYPFRNNLGDTEHINTATEA 378


>gi|56750104|ref|YP_170805.1| Iron-regulated protein A [Synechococcus elongatus PCC 6301]
 gi|81300271|ref|YP_400479.1| imelysin [Synechococcus elongatus PCC 7942]
 gi|124907|sp|P12608|IRPA_SYNE7 RecName: Full=Iron-regulated protein A; Flags: Precursor
 gi|280209|pir||A43648 iron-regulated protein A - Synechococcus sp
 gi|154525|gb|AAA27316.1| iron-regulated protein [Synechococcus sp.]
 gi|56685063|dbj|BAD78285.1| Iron-regulated protein A precursor [Synechococcus elongatus PCC
           6301]
 gi|81169152|gb|ABB57492.1| imelysin. Metallo peptidase. MEROPS family M75 [Synechococcus
           elongatus PCC 7942]
          Length = 356

 Score =  169 bits (427), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 62/405 (15%), Positives = 137/405 (33%), Gaps = 94/405 (23%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           ++ +F+      +++ N +++  +     +    Y      A  L+ A++T    P   N
Sbjct: 32  VATLFSACGQTQALITNQTIQGFVD---QVVVPSYVSVAAGATQLEQALQTYQQAPTAAN 88

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           LE AR  W  AR  ++Q+E + FG    + +D  ++ WP+D   +    +   ++ E   
Sbjct: 89  LEAARQAWRVARDRWEQTECFAFGPADSEGFDGAMDTWPIDRQGLKTAAAQPVEQRE--- 145

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
                                                   +   G+H IE LL+      
Sbjct: 146 ----------------------------------------DSRKGFHAIEELLF----AA 161

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT----- 241
                 +R                   ++L +++  L    + ++  W            
Sbjct: 162 TEPTLSDR-------------------QHLVILATDLTKQAQGLVTRWQQASDQPAYRSV 202

Query: 242 -------KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYA 294
                        +NA    I+ G+   S +E+A E++   L   +P++     S NT +
Sbjct: 203 LLSAGSTDSAYPTLNAAGTEIVQGLVD-SLSEVASEKIGGPLETQEPDRFESFVSRNTLS 261

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
              N+  G  + Y G+        +   S+   +   +  +AQ+++ +F+   +    + 
Sbjct: 262 DLRNNWTGAWNVYRGQRSD----GVAAGSLQQRLQQQHPVIAQQLDQQFATARQALWAIP 317

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
           +  E   +        +P G   V      +   +++L +  + L
Sbjct: 318 EPIETNLA--------SPRGKVAVLTAQTAIAAVSDTLERQVLPL 354


>gi|153824178|ref|ZP_01976845.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae B33]
 gi|126518300|gb|EAZ75525.1| insulin-cleaving metalloproteinase outer membrane protein [Vibrio
           cholerae B33]
          Length = 193

 Score =  169 bits (427), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 66/190 (34%), Positives = 99/190 (52%), Gaps = 4/190 (2%)

Query: 225 SDLEEMMKAW---GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDP 281
           +DLE M K W     D    + L +    GL  ++ GM SLS  ELAGERM + L  +  
Sbjct: 1   TDLEWMEKQWASGEKDNYRQQLLSESAENGLRKMLFGMGSLSLGELAGERMKVALEANST 60

Query: 282 EQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEIND 341
           E E DCFSDNT+ S+  +  GI + YTG Y R +G ++ G S++ L++  + N A+EI  
Sbjct: 61  EDEHDCFSDNTHNSHYYNEQGIYNIYTGSYTRADGSELKGPSLYQLVAEKDANAAKEILQ 120

Query: 342 KFSNTMKDFHILKDRAE-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
           +F         L   AE N + FDQ+I+ +N  G+ I+   I  L+ QT S+ +    + 
Sbjct: 121 QFEAARTQVGELVTAAEKNNQHFDQLIAADNAAGHAIINQAIMALVAQTGSIERAAGIIG 180

Query: 401 LIEPNRVIGN 410
           +   N    +
Sbjct: 181 IDNLNPDTAD 190


>gi|282878042|ref|ZP_06286850.1| imelysin [Prevotella buccalis ATCC 35310]
 gi|281299877|gb|EFA92238.1| imelysin [Prevotella buccalis ATCC 35310]
          Length = 397

 Score =  169 bits (427), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 68/437 (15%), Positives = 141/437 (32%), Gaps = 88/437 (20%)

Query: 3   FITIISIVFTLPSHALSIVPNVS--------LEKVLQNYATIA--------HAKYEDALM 46
           F  I+ ++F++   A S               E+  + YA I            YE   +
Sbjct: 9   FAAILGLIFSMSFTACSDDNGDDTKKDELKKQEERDKAYAEIVDAFIHKTVVPTYEKMAL 68

Query: 47  CARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPL 106
            +  L   +      P + NL+ A   ++ +R+ +++SE + FG       D  +++WPL
Sbjct: 69  KSSELVKDLREYRKNPTQANLDKACEDFLASRMWWERSEAFLFGAASDFGIDPHIDSWPL 128

Query: 107 DEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDT 166
           D                E  L TA  I      ++  + D++  +               
Sbjct: 129 D------------LPALEKYLATATNIE----ELDGDDYDIAARTK------------LG 160

Query: 167 NITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYL---------- 216
               GYH +E++L+         + G+             G  R     L          
Sbjct: 161 QELLGYHGVEYILFKDGKPR---KAGSIEDEYLVYAIAVAGDLRNSCWQLLTSWAGEKYA 217

Query: 217 -KVVSKILVSDLEEMMKAWGPDG------------QATKDLMKDINAGLNSIITGMTSLS 263
            K+ +  +    E++       G                 L +   A L  I++G  S  
Sbjct: 218 SKLDAAQVKHITEDVELGITVGGGEHSYGENILLAGQPGSLYRSWVAALQEIVSGCNS-I 276

Query: 264 YNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
            +E+   ++       D       +S  +   + N++I + + Y G       E   GAS
Sbjct: 277 CDEVGTSKIGSAHTGEDVSYIESPYSQMSIHDFHNNIISVENVYYGG-----IEGNRGAS 331

Query: 324 IHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLIN 383
           IH+ ++ +N+ +  ++    +        +K       +            +   +  ++
Sbjct: 332 IHNYMAKHNKEMDMKVTAAITKAQTAIKNMKAPFVLNYT------------DASCKAAMD 379

Query: 384 DLITQTESLRKIRIALD 400
                 E+L +++  L 
Sbjct: 380 ACKELDETLSELKTELK 396


>gi|262384087|ref|ZP_06077223.1| iron-regulated protein A [Bacteroides sp. 2_1_33B]
 gi|262294985|gb|EEY82917.1| iron-regulated protein A [Bacteroides sp. 2_1_33B]
          Length = 392

 Score =  169 bits (427), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 65/393 (16%), Positives = 137/393 (34%), Gaps = 79/393 (20%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           LP+ + +      +  V+  +   +A   Y+D L       +A++  + + +K +L +A 
Sbjct: 30  LPADSGAKPTEDQMSAVVATFVDEVALPTYKDMLTKMTAYKNAVDKFIASGSKNDLADAC 89

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             W   R+P++QSE + FG   +   D  +++WPLD+  I+                   
Sbjct: 90  DAWRAVRVPWEQSEAFLFGVADLAQLDPSLDSWPLDKNGIE------------------E 131

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
           IIA  +       +D                        G+H  E +L+      ++   
Sbjct: 132 IIATGEFSKISGAVD-------------EDAEDGPQNLRGFHTAEKMLFLDGEPRDLE-- 176

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD-------GQATKDL 244
                        T    +  +EYLK+VS+ ++SD +++   W              + +
Sbjct: 177 -------------TSPFAKNELEYLKLVSERMLSDTQDLYNGWLKGLGTSDVPSSYAEAM 223

Query: 245 MK---------DINAGLNSIITG--MTSLSYNELAGERMNLGL--------ILHDPEQ-- 283
            K         ++   +  ++ G    +   NE+   ++   +           DP    
Sbjct: 224 KKHDGSAYSIGNVYQAIELMLNGNNGMAGISNEVGSAKITDPVTAWNGSNKDATDPNNPG 283

Query: 284 ---EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEIN 340
                  +S N+   Y N+++ I ++Y G    ++ E    +S+H L    N  L   + 
Sbjct: 284 VLAVESWYSWNSLDDYKNNIVSIKNAYFGG-RDLDEESASESSLHALTKMINPTLDSLMV 342

Query: 341 DKFSNTMKDFHILKDRAENIESFDQMISENNPE 373
            +   T+   + +     N     + I+     
Sbjct: 343 VQIDKTIDAINAIGYPFRNNLGDTEHINTATEA 375


>gi|116331852|ref|YP_801570.1| Iron-regulated lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116125541|gb|ABJ76812.1| Iron-regulated lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 438

 Score =  167 bits (421), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 86/434 (19%), Positives = 157/434 (36%), Gaps = 63/434 (14%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT--PNKKNLE 68
             L   A+ + P  +  +V+  Y  + +  Y+ +   A  L +A+        P+  +  
Sbjct: 32  SLLSLLAVGLQPTATKAQVVDRYLRLGYESYDQSYKDAVNLQTAVTAFAANANPSAADHA 91

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFI 111
           N +  +I AR  Y  +E +RF +  +D  D                   +N+WPLDE  I
Sbjct: 92  NLKNLYIIARASYLVTEAFRFSSGPIDNVDVLGCGSNADGSGEEECEGLINSWPLDESAI 151

Query: 112 D-YVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           D YV ++  +      L        +   ++                       +T IT 
Sbjct: 152 DNYVAAAGAQTTYAAILAANGNAEANNGAID--------------------GDDETAITV 191

Query: 171 GYHVIEFLLWGQDLKTNV--REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLE 228
           G+H IE++LWGQDL         G R   +    N  G     R  Y+K V+  LV  L 
Sbjct: 192 GWHAIEYILWGQDLSNGGVNEIAGQRTANELANANANGAR---RRAYMKAVTDGLVLQLG 248

Query: 229 EMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCF 288
            +   +    + +  L  + NA + +I  G+      E  GER+         E+E  CF
Sbjct: 249 LIRDQFADGSRYSDALKSNPNAAITAIFQGLGKFIAGEWGGERLTGTFDGQ-QEEEHSCF 307

Query: 289 SDNTYASYLNDVIGIISSYTGEYIRMNGEKIH-GASIHDLISHNNRNLAQEINDKFSNTM 347
           SD T A +  +   +++ ++G Y    G     G  +  L    +   A  I  + + + 
Sbjct: 308 SDTTKADFYYNAQSVLNIWSGSYELKKGTVTSTGPGLRSLFGTLS---APPITAQATASR 364

Query: 348 K--DFHILKDRAENIES-----------FDQMISENNPEGNKIVRNLINDLITQTESLRK 394
                ++ +  A+   +           +DQ+I   + E   +         T  +++  
Sbjct: 365 DVFCINLPEQTADPNYTTTCPPKSLTGRYDQIIRNTDSEYKILFDTQKLIGDTMKKTITD 424

Query: 395 IRIALDLIEPNRVI 408
               + +   +  I
Sbjct: 425 AAKGVGVSITDFSI 438


>gi|116327535|ref|YP_797255.1| Iron-regulated lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116120279|gb|ABJ78322.1| Iron-regulated lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 438

 Score =  167 bits (421), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 87/434 (20%), Positives = 158/434 (36%), Gaps = 63/434 (14%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT--PNKKNLE 68
             L   A+ + P  +  +V+  Y  + +  Y+ +   A  L +A+        P+  +  
Sbjct: 32  SLLSLLAVGLQPTATKAQVVDRYLRLGYESYDQSYKDAVNLQTAVTAFAANANPSAADHA 91

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWD-----------------KKVNAWPLDEGFI 111
           N +  +I AR  Y  +E +RF +  +D  D                   +N+WPLDE  I
Sbjct: 92  NLKNLYIIARASYLVTEAFRFSSGPIDNVDVLGCGSNADGSGEEECEGLINSWPLDESAI 151

Query: 112 D-YVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           D YV ++  +      L        +   ++                       +T IT 
Sbjct: 152 DNYVAAAGAQTTYAAILAANGNAEANNGAID--------------------GDDETAITV 191

Query: 171 GYHVIEFLLWGQDLKTNV--REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLE 228
           G+H IE++LWGQDL         G R   +F   N  G     R  Y+K V+  LV  L 
Sbjct: 192 GWHAIEYILWGQDLSNGGVNEIAGQRTANEFANANANGAR---RRAYMKAVTDGLVLQLG 248

Query: 229 EMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCF 288
            +   +    + +  L  + NA + +I  G+      E  GER+         E+E  CF
Sbjct: 249 LIRDQFADGSRYSDALKSNPNAAITAIFQGLGKFIAGEWGGERLTGTFDGQ-QEEEHSCF 307

Query: 289 SDNTYASYLNDVIGIISSYTGEYIRMNGEKIH-GASIHDLISHNNRNLAQEINDKFSNTM 347
           SD T A +  +   +++ ++G Y    G     G  +  L    +   A  I  + + + 
Sbjct: 308 SDTTKADFYYNAQSVLNIWSGSYELKKGTVTSTGPGLRSLFGTLS---APPITAQATASR 364

Query: 348 K--DFHILKDRAENIES-----------FDQMISENNPEGNKIVRNLINDLITQTESLRK 394
                ++ +  A+   +           +DQ+I   + E   +         T  +++  
Sbjct: 365 DVFCINLPEQTADPNYTTTCPPKSLTGRYDQIIRNTDSEYKILFDTQKLIGDTMKKTITD 424

Query: 395 IRIALDLIEPNRVI 408
               + +   +  I
Sbjct: 425 AAKGVGVSITDFSI 438


>gi|228471216|ref|ZP_04056029.1| putative iron-regulated protein A [Porphyromonas uenonis 60-3]
 gi|228307031|gb|EEK16113.1| putative iron-regulated protein A [Porphyromonas uenonis 60-3]
          Length = 372

 Score =  165 bits (418), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 51/412 (12%), Positives = 129/412 (31%), Gaps = 60/412 (14%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLV 59
           +  + I+ +         +   +     +L+ +   +    Y+        L    + L+
Sbjct: 4   LSVVGILLVSCQESDEPKAKQVDPEQTAILEQFVHGVVVPTYKSLADNTIELSGICQELM 63

Query: 60  TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSS-Y 118
            +P+++ ++ A  +W+ AR  ++ SE   FG       D  +++WPL +  +D +  +  
Sbjct: 64  KSPSQELVDKACKKWVEARAYWELSEAILFGAAGDYNIDPHIDSWPLQKNQLDNILQNKD 123

Query: 119 GKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFL 178
             +  +     A   A+    +                              G+H +E++
Sbjct: 124 LLDELKEEGADAKGFASLGYGL-----------------------------LGFHAVEYM 154

Query: 179 LWGQDLKTN-VREPGNRPYTDFDIGNCTGGHCRRR------VEYLKVVSKILVSDLEEMM 231
           ++                  +  +         R       V+ +    K  + D E + 
Sbjct: 155 IFRDGKARKVAEITEPERIYNAAVAEDLARQATRLEASWAGVDKITAAKKKTLEDAELLP 214

Query: 232 KAWGPD-----GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEID 286
                +     G+      K        I+ G  S   +E+   ++   +   +      
Sbjct: 215 TMDYGEIMIAAGEQGNTTYKSQKDAFVQILQG-ASDITDEVGNTKITDPVNSGNVLDVES 273

Query: 287 CFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNT 346
            +S N+   + +++  + ++Y G    ++G      S+   ++ ++  L +EI     N 
Sbjct: 274 WYSWNSIEDFTDNLRSVRNAYYGS---LDGTAHK-HSMASYMAQHHPELDKEIRSAIDNA 329

Query: 347 MKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIA 398
           +K    +     N  + D              +  I+      E +     A
Sbjct: 330 IKTVAAMPAPFRNNLTKD------------ATKPAIDACNALLEKIDAAIEA 369


>gi|120436851|ref|YP_862537.1| hypothetical protein GFO_2514 [Gramella forsetii KT0803]
 gi|117579001|emb|CAL67470.1| conserved hypothetical protein, secreted [Gramella forsetii KT0803]
          Length = 370

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/412 (13%), Positives = 122/412 (29%), Gaps = 69/412 (16%)

Query: 1   MYFITIISIVFTLPSHALSIV------PNVSLEKVLQNYAT-IAHAKYEDALMCARTLDS 53
           +  +  + +                        ++L N+A  I    YED     + L++
Sbjct: 6   IVLLACLVLAACSTEDEGGDTGGDNTNDTFDRGEMLANWADNIILPSYEDFYTKTQKLET 65

Query: 54  AIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDY 113
             +  V  P    L   R Q+  +   +Q   ++  G      +   +N +PL+   +D 
Sbjct: 66  LAQAFVEDPGNTELTALRAQFELSYRSFQSVSMFDIGKAEELNYRSFLNTYPLNASELDS 125

Query: 114 VDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYH 173
             +S     +  + Y                                          G+ 
Sbjct: 126 KLASGTYNLKLPSSYDE---------------------------------------QGFP 146

Query: 174 VIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKA 233
            +++LL+G                +  +   +      +  YL  V K + +   E+  +
Sbjct: 147 ALDYLLFGLASTK----------EETLLKYTSDEDAENKKVYLLEVVKRINALTAEVTAS 196

Query: 234 WGPD--GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLG----LILHDPEQEIDC 287
           W  D       +        ++ +           L   ++            P      
Sbjct: 197 WQGDYRDAFVNNTSSSSTGSVDRLTNKYVMYFEKFLRSGKIGFPSGAITGTPSPINVEAY 256

Query: 288 FSDN-TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR-NLAQEINDKFSN 345
           +SD+ +   YL  +      Y G+Y    G    G S H  +   +R +LA +I  +F+ 
Sbjct: 257 YSDDFSRELYLEALKSSKDFYIGKYF---GSSQSGESFHTYLEALDRGDLASDILSQFNA 313

Query: 346 TMKDFHILKDRAENIESFDQ--MISENNPEGNKIVRNLINDLITQTESLRKI 395
              +   L     N    D   M+  ++    ++V   ++ L   + S+  +
Sbjct: 314 ISSESGDLDSSLRNQVETDNVLMLEVHDELQKEVVLLKLDMLQALSISVDYV 365


>gi|302346436|ref|YP_003814734.1| imelysin [Prevotella melaninogenica ATCC 25845]
 gi|302150941|gb|ADK97202.1| imelysin [Prevotella melaninogenica ATCC 25845]
          Length = 453

 Score =  163 bits (411), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 71/440 (16%), Positives = 138/440 (31%), Gaps = 84/440 (19%)

Query: 10  VFTLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNL- 67
           +  + S + +      + KV+ NY   +    Y D    +  L  A + L        L 
Sbjct: 44  LSKIASESSANANKTEMGKVVANYINEVVKPTYLDLAEKSDILYKACQNLYQKRKAGTLT 103

Query: 68  ----ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
               + A   +  AR  ++QSE + +G    +  D  +++WPLD             +  
Sbjct: 104 QNDIDAACEAFKAARKDWEQSESFLYGAASDNEIDPHIDSWPLD------------HDQL 151

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
              L  A++IA               I+ +   K    N  + +   G+H +EF+L+   
Sbjct: 152 TRALNNADVIAG--------------INGENPAKYVYDNNGNFDSVLGFHGLEFVLFRNG 197

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCR----------RRVEYLKVV----SKILVSDLEE 229
               V        T+  + + +  +            R + YL       + I  S L +
Sbjct: 198 KNRTVAAFNAEKETEAGLTSVSTVNEAAFAAAVAGDLRNMTYLLEYGWLGTTIPTSHLNQ 257

Query: 230 MMKAWGPDGQAT---------------------KDLMKDINAGLNSIITGMTSLSYNELA 268
           +  A                               +    +  LN+I  G  S    E+A
Sbjct: 258 LANAMWVVNGTRHRGLSAKLIPYRDYSQFATKENGMFASWHETLNNIFIGGCSGICEEVA 317

Query: 269 GERMNLGLILHD--------PEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
            +++                       +S  ++  Y +++  I +S  G     N     
Sbjct: 318 SQKLGQAYRKATGTGTADDAANYIESPYSKRSFQDYQDNIYSIKNSLYGVRGTENISTPT 377

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
             SI + + +NN     E+N   +  +      K            I+  +  GN  V+ 
Sbjct: 378 QYSIMNFLKNNNYPKYNELNSALNEAIAALETAKKSG---------IAFIDQPGNPQVKT 428

Query: 381 LINDLITQTESLRKIRIALD 400
            I+ +    E+L      ++
Sbjct: 429 CIDKVDALNEALNAAGTWIN 448


>gi|313886593|ref|ZP_07820306.1| Imelysin [Porphyromonas asaccharolytica PR426713P-I]
 gi|332300889|ref|YP_004442810.1| Peptidase M75, Imelysin [Porphyromonas asaccharolytica DSM 20707]
 gi|312923949|gb|EFR34745.1| Imelysin [Porphyromonas asaccharolytica PR426713P-I]
 gi|332177952|gb|AEE13642.1| Peptidase M75, Imelysin [Porphyromonas asaccharolytica DSM 20707]
          Length = 381

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 49/389 (12%), Positives = 126/389 (32%), Gaps = 52/389 (13%)

Query: 16  HALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
              +   + +   +++ +   +    Y+     A  L    E L+  P+++ +  A  +W
Sbjct: 28  EPKAKQLDPAQTALIKQFVEGVVVPTYKSLADNAIELSGLCEELMKNPSQELVNKACKKW 87

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSS-YGKENEENNLYTANII 133
           + AR  ++ SE + +G       D  +++WPL +  +D +  +    +  +     A   
Sbjct: 88  VSARAYWELSEAFLYGAAGDYNIDPHIDSWPLQKNQLDNILKNKDLLDELKEEGPDAKGF 147

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN-VREPG 192
           A+    +                              G+H +E++++             
Sbjct: 148 ASLGYGL-----------------------------LGFHAVEYMIFRDGQPRKVGEITE 178

Query: 193 NRPYTDFDIGNCTGGHCRRR------VEYLKVVSKILVSDLEEMMKAWGP-----DGQAT 241
                +  +         R       ++ +    K  + D E +            G+  
Sbjct: 179 PERIYNAAVAEDLARQAIRLEASWAGIDKVTADKKKTLEDAELLPTMDYGQLMIAAGEQG 238

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVI 301
               K     L  I+ G + +S +E+   ++   +   +       +S N+   + +++ 
Sbjct: 239 NSSYKSQKDALVQILQGASDIS-DEVGNTKITDPVNSGNVLDVESWYSWNSIEDFTDNLR 297

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI- 360
            + ++Y G         +H  S+   ++  + +L +EI     + +K    +     N  
Sbjct: 298 SVRNAYYGSLDG----TVHNHSLATYMAQQHPDLDKEIRTALDHAIKTVAAMPAPFRNNL 353

Query: 361 --ESFDQMISENNPEGNKIVRNLINDLIT 387
             E+    I   N    + +   I  +  
Sbjct: 354 TKEATKPAIEACNALLEQ-IDAAIEAVQK 381


>gi|71281563|ref|YP_267444.1| putative lipoprotein [Colwellia psychrerythraea 34H]
 gi|71147303|gb|AAZ27776.1| putative lipoprotein [Colwellia psychrerythraea 34H]
          Length = 381

 Score =  161 bits (407), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 61/396 (15%), Positives = 137/396 (34%), Gaps = 79/396 (19%)

Query: 23  NVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPY 81
                +++ N    +  A Y++    A     A + L  T  ++NL  A+  W   R+ +
Sbjct: 37  TFDATEMITNLTNDVIVAGYKNLNDEAAVYLLATQNLANTATEENLAAAQQAWKDVRVHW 96

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
           +Q E + FG     + D  ++ WPL+              + +  L T +    +++   
Sbjct: 97  EQGESHIFGPVDALSIDPHLDTWPLNTS------------DLQALLNTQSGFNATQLKAF 144

Query: 142 EKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
             ++                         G+H +EFLL+G  +  N +  G     +   
Sbjct: 145 NDDV------------------------QGFHTMEFLLFGDGVADNEKAIGEMTALE--- 177

Query: 202 GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT---------------KDLMK 246
                       EYL   +++  S  + +  AW                       ++  
Sbjct: 178 -----------REYLSAAAEVFKSHTQTLFDAWTVANDPNDANSPAYKDLLLTPDNEVYS 226

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILH----DPEQEIDCFSDNTYASYLNDVIG 302
                +  +I GM     +E+   +++          D  +    +S N+ A + +++ G
Sbjct: 227 SSLGVVQELINGMI-GIVDEVGNGKISEPFGSSIDNIDTTKVESQYSWNSLADFTDNIQG 285

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           + + Y GE++    +      I D ++  +  +A  ++ +  + +     +    +N   
Sbjct: 286 VQNVYRGEFLGQADKT----GIIDFVTAADAAIATRVDTEIVDAIAAIKAV--AGDNDLP 339

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIA 398
           F Q I++ +      ++  I+ L T   SL    + 
Sbjct: 340 FRQAINDADA--RVRIQTAIDKLTTLQTSLENDVLT 373


>gi|86609711|ref|YP_478473.1| iron-regulated protein A [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558253|gb|ABD03210.1| putative iron-regulated protein A [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 410

 Score =  160 bits (404), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 67/390 (17%), Positives = 126/390 (32%), Gaps = 74/390 (18%)

Query: 14  PSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           P+  LS        ++L ++A  +    YE  +   + L  AI+  V  PN + L+ AR 
Sbjct: 76  PAVVLSPEQRFQDRQILLDFADQVVIPAYEQLVADTQALSQAIQAFVQDPNAQTLQAARQ 135

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W  ARI +++SE + FG       D  ++ WPL+E  +  V +S               
Sbjct: 136 AWSVARITWEESEAFAFGPAAYLGLDADLDEWPLNEVEVLEVLNSGDP------------ 183

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
                            ++P+ + +L        +   G+H + FLL+G D         
Sbjct: 184 -----------------LTPETVAEL-------ESGQKGFHAVAFLLFGVD--------N 211

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-------------GPDGQ 239
           N+   DF           R  EYL  +  +L     +++K+W                  
Sbjct: 212 NKSLQDFT---------ERDREYLAALGPVLADTAAKLLKSWTEGVQGLPAFREEWVKAG 262

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
                   + A    I  G+     +EL   ++       +P      F+ ++   +  +
Sbjct: 263 EGSKSYLTLQAAAEEIAQGIL-GMLDELGKVKIGEAFAQQNPFLLESRFAHHSLPEFQAN 321

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
           V  +  +Y G +         G  +   +   N NL  +I  +          +    E 
Sbjct: 322 VRSVQYAYLGGFRD-----RKGRGLSQFVRDINPNLDSQIQSELQAAAAALQGIPAPIEK 376

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQT 389
                           K + +  +    + 
Sbjct: 377 SLCDANARGSITAAMEK-IEDAFDSFAQEV 405


>gi|163754889|ref|ZP_02162010.1| hypothetical protein KAOT1_02707 [Kordia algicida OT-1]
 gi|161324956|gb|EDP96284.1| hypothetical protein KAOT1_02707 [Kordia algicida OT-1]
          Length = 371

 Score =  160 bits (404), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 53/406 (13%), Positives = 121/406 (29%), Gaps = 63/406 (15%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLV 59
           ++     S    + +             +L+N A  I    Y++      TL +A +   
Sbjct: 13  LFIAACSSSDDAVNTDGGGSGTAFDRAGMLRNLADNIIIPSYQNLNSDLGTLVTAKDNFN 72

Query: 60  TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYG 119
           TTPN+ NL+  R  W  A   +Q  E +  G      +  ++N +P++   ++       
Sbjct: 73  TTPNQANLDALRSAWFTAYKAWQHVESFNIGQAEQTLYAFQMNTYPVNTTDVE------- 125

Query: 120 KENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
                      N +A+    +                        + N   G+  ++++L
Sbjct: 126 -----------NNVASGSYDLTHP---------------------NNNDAVGFPALDYML 153

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD-- 237
            G                +      T     +   YL  +   + +  + +   W  +  
Sbjct: 154 HGIGATD----------AEILEKYTTNAEAGKYQAYLSDLVNQMQTLTQAISSDWTVNYR 203

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLI----LHDPEQEIDCFS-DNT 292
                       +  N  I          L   ++ +          P++    ++ + +
Sbjct: 204 DTFISSTANTATSATNKFINDFIFYYEKGLRANKIGIPAGNFSSTPLPDRVEAFYNQEVS 263

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNN-RNLAQEINDKFSNTMKDFH 351
               L  +  + + + G      G   +G S    +   +  +LA  IN++F+       
Sbjct: 264 KELALEALNAVQNIFNGT---EFGGSANGESFKTYLISLDRTDLANMINNQFNTARGKIQ 320

Query: 352 ILKDRAENIESFD--QMISENNPEGNKIVRNLINDLITQTESLRKI 395
            L        + D  +M    +     +V   ++ L     S+  +
Sbjct: 321 ELNANFATQINTDNTKMTEAYDALQAAVVLLKVDMLQAFNISVDYV 366


>gi|86607223|ref|YP_475986.1| iron-regulated protein A [Synechococcus sp. JA-3-3Ab]
 gi|86555765|gb|ABD00723.1| putative iron-regulated protein A [Synechococcus sp. JA-3-3Ab]
          Length = 410

 Score =  160 bits (403), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 67/390 (17%), Positives = 126/390 (32%), Gaps = 74/390 (18%)

Query: 14  PSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           P+  LS        ++L ++A  +    YE  +   + L  AI+  V  PN + L+ AR 
Sbjct: 76  PAVVLSPEQRFQDRQILLDFADQVVIPAYEQLVADTQALSQAIQAFVQDPNAQTLQAARQ 135

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W  ARI +++SE + FG       D  ++ WPL+E  +  V +S               
Sbjct: 136 AWSVARITWEESEAFAFGPAAYLGLDADLDEWPLNEVEVLEVLNSGDP------------ 183

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
                            ++P+ + +L        +   G+H + FLL+G D         
Sbjct: 184 -----------------LTPETVAEL-------ESGQKGFHAVAFLLFGVD--------N 211

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW-------------GPDGQ 239
           N+   DF           R  EYL  +  +L     +++K+W                  
Sbjct: 212 NKSLQDFT---------ERDREYLAALGPVLADTAAKLLKSWTEGVQGLPAFREEWVKAG 262

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLND 299
                   + A    I  G+     +EL   ++       +P      F+ ++   +  +
Sbjct: 263 EGSKSYLTLQAAAEEIAQGIL-GMLDELGKVKIGEAFAQQNPFLLESRFAHHSLPEFQAN 321

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
           V  +  +Y G +         G  +   +   N NL  +I  +          +    E 
Sbjct: 322 VRSVQYAYLGGFRD-----RKGRGLSQFVRDINPNLDSQIQSELQAAAAALQGIPAPIEK 376

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQT 389
                           K + +  +    + 
Sbjct: 377 SLCDANARGSITAAMEK-IEDAFDSFAQEV 405


>gi|325285035|ref|YP_004260825.1| peptidase M75, Imelysin [Cellulophaga lytica DSM 7489]
 gi|324320489|gb|ADY27954.1| Peptidase M75, Imelysin [Cellulophaga lytica DSM 7489]
          Length = 373

 Score =  160 bits (403), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 59/404 (14%), Positives = 112/404 (27%), Gaps = 66/404 (16%)

Query: 1   MYFITIISIVFTLPSHALSIV-----PNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSA 54
             FI  +++     S   S        + +   +L N A  I    YED       L   
Sbjct: 6   FVFIAALTVYACSSSDDSSDTVNNGKDDFNRGGLLTNVADKIIIPSYEDLSTKLNDLQEE 65

Query: 55  IETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYV 114
            +  + +P++ NL   R +W+ A   +Q  E+Y  G      +  ++N +P         
Sbjct: 66  KDNFIASPSEINLIALRDKWLSAYKVWQSVEMYNIGKAEEINYAFQMNVYPTS------- 118

Query: 115 DSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHV 174
                             I + +  V     DL+                + N   G+  
Sbjct: 119 ------------------IDDIESNVGSGTYDLTH--------------PNNNDAVGFPA 146

Query: 175 IEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW 234
           +++LL+G                D                YL  +   +    E ++  W
Sbjct: 147 LDYLLFGLAETN----------ADIVEKYTNTTSGAGYKTYLSDLVNQMNILTETVLTDW 196

Query: 235 GPD--GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLI----LHDPEQEIDCF 288
                            +  N +           L   ++ +          P +    +
Sbjct: 197 KSGYRETFIASTENTATSAFNKLANDFVFYFEKGLRANKVGIPAGVFSTTPLPSKVEAFY 256

Query: 289 SD-NTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH--NNRNLAQEINDKFSN 345
           SD N+    +  V  I   + G+           A   D ++      +L   IN K ++
Sbjct: 257 SDKNSKDLLVAAVQNIQDFFNGKAYNSTTTGTGFADYLDYLNDITQGEDLNAIINGKIND 316

Query: 346 TMKDFHILKDRAENIESFD--QMISENNPEGNKIVRNLINDLIT 387
                  L     N    D  +M    +     +V   ++ L  
Sbjct: 317 ASAKVLELDASLSNQVDVDNVKMTEAYDALQKVVVLIKVDMLQA 360


>gi|150025543|ref|YP_001296369.1| Iron-regulated protein A precursor [Flavobacterium psychrophilum
           JIP02/86]
 gi|149772084|emb|CAL43560.1| Iron-regulated protein A precursor [Flavobacterium psychrophilum
           JIP02/86]
          Length = 371

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 59/412 (14%), Positives = 133/412 (32%), Gaps = 67/412 (16%)

Query: 1   MYFITIISIVFTLP---SHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIE 56
           +  +++ + +F+        +          +L N+A  I    Y +     + L + I 
Sbjct: 5   VLILSLATFLFSCSKNEEETVKTENAYDRTALLTNWANNIIVPSYVNYQEKVQLLVTNIN 64

Query: 57  TLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS 116
              TTP   NLE  R  W+ +   YQ   +Y FG        +  N +P +   I+    
Sbjct: 65  NFNTTPTVSNLETVRASWLESYKAYQYISIYNFGKAEEIYIKESSNTYPTNRIGIE---- 120

Query: 117 SYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIE 176
                        ANI + S  + +  + D                        G+  ++
Sbjct: 121 -------------ANITSGSYNLEHLSQFDK----------------------QGFPALD 145

Query: 177 FLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP 236
           +LL G                       T  +      YL  V+  L ++ + ++ +   
Sbjct: 146 YLLNGLHTNDATI----------VGFYTTNTNATNYKSYLLAVANRLKTNADAIVTS-WN 194

Query: 237 DGQATKDLMKDINAGLNSIITGMTSLS---YNELAGERMNLGLILHD-----PEQEIDCF 288
            G  T  +  +  +  +SI     +       ++   ++ +   +       PE+    +
Sbjct: 195 SGFKTSYIANNGTSVSSSINKTANNFVKNLEKDIRTGKLGIPAGVFSSGVKYPEKTEAYY 254

Query: 289 SDN-TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLIS--HNNRNLAQEINDKFSN 345
            +N +       V      + G++           S  D ++   N + L+  IN++F+ 
Sbjct: 255 KNNISKILLNEAVKASQDFFNGKHFNSTTTGEGFRSYLDFLNVVRNGQKLSTIINNQFTP 314

Query: 346 TMKDFHILKDRAENIESFD--QMISENNPEGNKIVRNLINDLITQTESLRKI 395
                + L D      + D  +M++  +     +V   ++ +     ++  +
Sbjct: 315 IYAANNTLNDSFSQQVTNDNTKMLAAYDALQQNVVYTKLDMMQALNIAIDYV 366


>gi|294643044|ref|ZP_06720884.1| imelysin [Bacteroides ovatus SD CC 2a]
 gi|294810068|ref|ZP_06768739.1| imelysin [Bacteroides xylanisolvens SD CC 1b]
 gi|298482803|ref|ZP_07000986.1| iron-regulated protein A [Bacteroides sp. D22]
 gi|292641601|gb|EFF59779.1| imelysin [Bacteroides ovatus SD CC 2a]
 gi|294442672|gb|EFG11468.1| imelysin [Bacteroides xylanisolvens SD CC 1b]
 gi|298271003|gb|EFI12581.1| iron-regulated protein A [Bacteroides sp. D22]
          Length = 391

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 62/367 (16%), Positives = 123/367 (33%), Gaps = 70/367 (19%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            + +   +     V      +    Y+D       L++A++ L T+ +  ++ NA   W+
Sbjct: 42  DSGTATDDELKAAVATYVDDVVIPTYQDMYNKVTALNTAVQKLSTSSSDNDVANAADAWV 101

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR P+++SE + +G   ++  D  +++WPLD+G ID +  S   E+           A 
Sbjct: 102 AARKPWEKSEAFLYGPADLNKLDPSLDSWPLDKGGIDAILQSGNWEDAVGGDVDDGDDAP 161

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
           +    N                             G+H  E+LL+             + 
Sbjct: 162 ADAPQNL---------------------------RGFHTAEYLLFEDG--------EAKK 186

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDI------- 248
            TD D           ++ YLK V   +  D E ++K W           KD        
Sbjct: 187 ITDLD---------ANKIGYLKAVVGRMSKDTELLLKGWTEGKNLENGAYKDAMKAPNGT 237

Query: 249 ------NAGLNSIITG--MTSLSYNELAGERMNLGLILHDPEQ-------EIDCFSDNTY 293
                    +  I+          NE+   ++   +   +              +S N+ 
Sbjct: 238 YSISNIKQSVAMILNSDNGAEGIANEVGATKIGDPVDKWNSGDKEGGVLAVESWYSWNSL 297

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
             Y +++  I ++Y G    ++G     AS+  ++   N  L   +  +   T+   + +
Sbjct: 298 DDYTDNIYSIRNAYYGS---LDGTVAS-ASLCSIMKKVNPTLNDMVVKQIQETITAINDI 353

Query: 354 KDRAENI 360
                N 
Sbjct: 354 PHPFRNN 360


>gi|212694845|ref|ZP_03302973.1| hypothetical protein BACDOR_04379 [Bacteroides dorei DSM 17855]
 gi|212662598|gb|EEB23172.1| hypothetical protein BACDOR_04379 [Bacteroides dorei DSM 17855]
          Length = 393

 Score =  158 bits (399), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 51/390 (13%), Positives = 130/390 (33%), Gaps = 65/390 (16%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLE-----------KVLQNYATI-AHAKYEDALMCART 50
            +  ++ + +    A S   + + +            + + Y     +  Y++       
Sbjct: 9   LLVAVATMMSCSFSACSDNDDPTPDTGTSETDAKFEAIAKQYLDHTVYVTYKNLADETEQ 68

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           L   ++ L ++    N++     ++ AR  +++SE + +G       D  +++WPLD   
Sbjct: 69  LVKDLQALKSSKTDANVKATCETFLEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD--- 125

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           +D + ++     +                +  ++ D+             A     N   
Sbjct: 126 LDGLQTALKNTEQVEA-------------MGGEDGDI------------YAGEKLGNSLL 160

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVV----------- 219
           G+H IE++L+      +V +  +             G  R R   L++            
Sbjct: 161 GFHGIEYILFEDGSPKSVSKISDL---HLTYAVAVAGDLRNRCWQLELSWRGESAVNADR 217

Query: 220 SKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN--------SIITGMTSLSYNELAGER 271
              + ++LE        +    ++++    AG            I        +E+   +
Sbjct: 218 VAKVANELELPYTVNSGEYSYGENMLNAGKAGSTYASWTLAMQAIIDGCKTIADEVGTSK 277

Query: 272 MNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN 331
           +       DP      +S  +   + +++I I ++Y G       E     S+H+ I+  
Sbjct: 278 IGKPYSGEDPAYIESPYSHKSILDFYDNIISIQNAYMGGIENERDETN---SLHNYIAGV 334

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           ++ L  ++ +  +N +   + +     N  
Sbjct: 335 DKELDTKVVNAINNALTKINAMAAPFVNNI 364


>gi|237727195|ref|ZP_04557676.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|229434051|gb|EEO44128.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
          Length = 390

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/390 (13%), Positives = 129/390 (33%), Gaps = 65/390 (16%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLE-----------KVLQNYATI-AHAKYEDALMCART 50
            +  ++ + T    A S   + + +            + + Y     +  Y++       
Sbjct: 6   LLVAVATMMTCSFSACSDNDDPTPDTGTSETDAKFEAIAKQYLDHTVYVTYKNLADETEQ 65

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           L   ++ L ++    N++     ++ AR  +++SE + +G       D  +++WPLD   
Sbjct: 66  LVKDLQALKSSKTDANVKATCETFLEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD--- 122

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           +D + ++     +                +  ++ D+             A     N   
Sbjct: 123 LDGLQTALKNTEQVEA-------------MGGEDGDI------------YAGEKLGNSLL 157

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVV----------- 219
           G+H IE++L+      +V +  +             G  R R   L++            
Sbjct: 158 GFHGIEYILFEDGSPKSVSKISDL---HLTYAVAVAGDLRNRCWQLELSWRGESAVNADR 214

Query: 220 SKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN--------SIITGMTSLSYNELAGER 271
              + ++LE             ++++    AG            I        +E+   +
Sbjct: 215 VAKVANELELPYTVNSGGYSYGENMLNAGKAGSTYASWTLAMQAIIDGCKTIADEVGTSK 274

Query: 272 MNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN 331
           +       DP      +S  +   + +++I I ++Y G       E     S+H+ I+  
Sbjct: 275 IGKPYSGEDPAYIESPYSHKSILDFYDNIISIQNAYMGGIENERDETN---SLHNYIAGV 331

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           ++ L  ++ +  +N +   + +     N  
Sbjct: 332 DKELDTKVVNAINNALTKINAMAAPFVNNI 361


>gi|288802515|ref|ZP_06407954.1| iron-regulated protein A [Prevotella melaninogenica D18]
 gi|288335043|gb|EFC73479.1| iron-regulated protein A [Prevotella melaninogenica D18]
          Length = 394

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 71/422 (16%), Positives = 134/422 (31%), Gaps = 84/422 (19%)

Query: 28  KVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNL-----ENARLQWIRARIPY 81
           KV+ NY   +    Y D    +  L  A + L        L     + A   +  AR  +
Sbjct: 3   KVVANYIDEVVKPTYLDLAKKSDILYKACQNLYQKRKAGTLTQNDIDAACEAFKGARRDW 62

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
           +QSE + +G    +  D  +++WPLD             +     L  AN+IA       
Sbjct: 63  EQSESFLYGAASDNEIDPHIDSWPLD------------HDQLTRALNDANVIAG------ 104

Query: 142 EKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
                   I+ +   K    N  + +   G+H +EF+L+       V +      T+  +
Sbjct: 105 --------INGENPTKYVYDNNGNFDSVLGFHGLEFVLFRNGKNRTVADFNAEKETEAGL 156

Query: 202 GNCTGGHCR----------RRVEYLKVV----SKILVSDLEEMMKAWGPDGQAT------ 241
            + +  +            R + YL       + I  S L ++  A              
Sbjct: 157 TSVSTVNEAAFAAAVASDLRNMTYLLEYGWLGTTIPTSHLNQLANAMWVVNGTRHRGLSA 216

Query: 242 ---------------KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHD------ 280
                            +    +  LN+I  G  S    E+A +++              
Sbjct: 217 KNIPYRDYSQFATKENGMFASWHETLNNIFIGGCSGICEEVASQKLGQAYRKATGTGTEK 276

Query: 281 --PEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQE 338
                    +S  ++  Y +++  I +S  G     N       SI + + +NN     E
Sbjct: 277 DAANYIESPYSKRSFQDYQDNIYSIKNSLYGVRGTENISTPAQYSIMNFLKNNNYPNYNE 336

Query: 339 INDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIA 398
           +N+  +  +      K            I+  +  GN  V+  I+ +    E+L      
Sbjct: 337 LNNALNEAIAALETAKKSG---------IAFIDQPGNPQVKTCIDKVDALNEALNAAGTW 387

Query: 399 LD 400
           ++
Sbjct: 388 IN 389


>gi|150005299|ref|YP_001300043.1| putative iron-regulated protein A precursor [Bacteroides vulgatus
           ATCC 8482]
 gi|149933723|gb|ABR40421.1| putative iron-regulated protein A precursor [Bacteroides vulgatus
           ATCC 8482]
          Length = 393

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/390 (13%), Positives = 130/390 (33%), Gaps = 65/390 (16%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLE-----------KVLQNYATI-AHAKYEDALMCART 50
            +  ++ + T    A S   + + +            + + Y     +  Y++       
Sbjct: 9   LLVAVATMMTCSFSACSDNDDPTPDTGTSETDAKFKAIAKQYLDHTVYVTYKNLADETEQ 68

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           L   ++ L ++    N++     ++ AR  +++SE + +G       D  +++WPLD   
Sbjct: 69  LVKDLQALKSSKTDANVKATCETFLEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD--- 125

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           +D + ++     +                +  ++ D+             A     N   
Sbjct: 126 LDGLQTALKNTEQVEA-------------MGGEDGDI------------YAGEKLGNSLL 160

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVV----------- 219
           G+H IE++L+      +V +  +             G  R R   L++            
Sbjct: 161 GFHGIEYILFEDGSPKSVSKISDL---HLTYAVAVAGDLRNRCWQLELSWRGESAVNADR 217

Query: 220 SKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN--------SIITGMTSLSYNELAGER 271
              + ++LE        +    ++++    AG            I        +E+   +
Sbjct: 218 VAKVANELELPYTVNSGEYSYGENMLNAGKAGSTYASWTLAMQAIIDGCKTIADEVGTSK 277

Query: 272 MNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN 331
           +       DP      +S  +   + +++I I ++Y G       E     S+H+ I+  
Sbjct: 278 IGKPYSGEDPAYIESPYSHKSILDFYDNIISIQNAYMGGIENERDETN---SLHNYIAGV 334

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           ++ L  ++ +  +N +   + +     N  
Sbjct: 335 DKELDTKVVNAINNALTKINAMAAPFVNNI 364


>gi|319643493|ref|ZP_07998116.1| iron-regulated protein A [Bacteroides sp. 3_1_40A]
 gi|317384898|gb|EFV65854.1| iron-regulated protein A [Bacteroides sp. 3_1_40A]
          Length = 393

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/390 (13%), Positives = 130/390 (33%), Gaps = 65/390 (16%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLE-----------KVLQNYATI-AHAKYEDALMCART 50
            +  ++ + T    A S   + + +            + + Y     +  Y++       
Sbjct: 9   LLVAVATMMTCSFSACSDNDDPTPDTGTSETDAKFEAIAKQYLDHTVYVTYKNLADETEQ 68

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           L   ++ L ++    N++     ++ AR  +++SE + +G       D  +++WPLD   
Sbjct: 69  LVKDLQALKSSKTDANVKATCETFLEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD--- 125

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           +D + ++     +                +  ++ D+             A     N   
Sbjct: 126 LDGLQTALKNTEQVEA-------------MGGEDGDI------------YAGEKLGNSLL 160

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVV----------- 219
           G+H IE++L+      +V +  +             G  R R   L++            
Sbjct: 161 GFHGIEYILFEDGSPKSVSKISDL---HLTYAVAVAGDLRNRCWQLELSWRGESAVNADR 217

Query: 220 SKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN--------SIITGMTSLSYNELAGER 271
              + ++LE        +    ++++    AG            I        +E+   +
Sbjct: 218 VAKVANELELPYTVNSGEYSYGENMLNAGKAGSTYASWTLAMQAIIDGCKTIADEVGTSK 277

Query: 272 MNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN 331
           +       DP      +S  +   + +++I I ++Y G       E     S+H+ I+  
Sbjct: 278 IGKPYSGEDPAYIESPYSHKSILDFYDNIISIQNAYMGGIENERDETN---SLHNYIAGV 334

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           ++ L  ++ +  +N +   + +     N  
Sbjct: 335 DKELDTKVVNAINNALTKINAMAAPFVNNI 364


>gi|294777137|ref|ZP_06742594.1| imelysin [Bacteroides vulgatus PC510]
 gi|294449006|gb|EFG17549.1| imelysin [Bacteroides vulgatus PC510]
          Length = 393

 Score =  157 bits (397), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 52/390 (13%), Positives = 130/390 (33%), Gaps = 65/390 (16%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLE-----------KVLQNYATI-AHAKYEDALMCART 50
            +  ++ + T    A S   + + +            + + Y     +  Y++       
Sbjct: 9   LLVAVATMMTCSFSACSDNDDPTPDTGTSETDAKFEAIAKQYLDHTVYVTYKNLADETEQ 68

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           L   ++ L ++    N++     ++ AR  +++SE + +G       D  +++WPLD   
Sbjct: 69  LVKDLQALKSSKTDANVKATCETFLEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD--- 125

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           +D + ++     +                +  ++ D+             A     N   
Sbjct: 126 LDGLQTALKNTEQVEA-------------MGGEDGDI------------YAGEKLGNSLL 160

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVV----------- 219
           G+H IE++L+      +V +  +             G  R R   L++            
Sbjct: 161 GFHGIEYILFEDGSPKSVSKISDL---HLTYAVAVAGDLRNRCWQLELSWRGESAVNADR 217

Query: 220 SKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN--------SIITGMTSLSYNELAGER 271
              + ++LE        +    ++++    AG            I        +E+   +
Sbjct: 218 VAKVANELELPYTVNSGEYSYGENMLNAGKAGSTYASWTLAMQAIIDGCKTIADEVGTSK 277

Query: 272 MNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN 331
           +       DP      +S  +   + +++I I ++Y G       E     S+H+ I+  
Sbjct: 278 IGKPYSGEDPAYIESPYSHKSILDFYDNIISIQNAYMGGIENERDETN---SLHNYIAGV 334

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           ++ L  ++ +  +N +   + +     N  
Sbjct: 335 DKELDTKVVNAINNALTKINAMAAPFVNNI 364


>gi|265750476|ref|ZP_06086539.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|263237372|gb|EEZ22822.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 393

 Score =  157 bits (397), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 51/390 (13%), Positives = 130/390 (33%), Gaps = 65/390 (16%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLE-----------KVLQNYATI-AHAKYEDALMCART 50
            +  ++ + +    A S   + + +            + + Y     +  Y++       
Sbjct: 9   LLVAVATMMSCSFSACSDNDDPTPDTGTSETDAKFEAIAKQYLDHTVYVTYKNLADETEQ 68

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           L   ++ L ++    N++     ++ AR  +++SE + +G       D  +++WPLD   
Sbjct: 69  LVKDLQALKSSKTDANVKATCETFLEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD--- 125

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           +D + ++     +                +  ++ D+             A     N   
Sbjct: 126 LDGLQTALKNTEQVEA-------------MGGEDGDI------------YAGEKLGNSLL 160

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVV----------- 219
           G+H IE++L+      +V +  +             G  R R   L++            
Sbjct: 161 GFHGIEYILFEDGSPKSVSKISDL---HLTYAVAVAGDLRNRCWQLELSWRGESAVNADR 217

Query: 220 SKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN--------SIITGMTSLSYNELAGER 271
              + ++LE        +    ++++    AG            I        +E+   +
Sbjct: 218 VAKVANELELPYTVNSGEYSYGENMLNAGKAGSTYASWTLAMQAIIDGCKTIADEVGTSK 277

Query: 272 MNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN 331
           +       DP      +S  +   + +++I I ++Y G       E     S+H+ I+  
Sbjct: 278 IGKPYSGEDPAYIESPYSHKSILDFYDNIISIQNAYMGGIENERDETN---SLHNYIAGV 334

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           ++ L  ++ +  +N +   + +     N  
Sbjct: 335 DKELDTKVVNAINNALTKINAMAAPFVNNI 364


>gi|164454447|dbj|BAF96780.1| iron regulated protein [Shewanella livingstonensis]
          Length = 387

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 64/387 (16%), Positives = 134/387 (34%), Gaps = 81/387 (20%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A Y D       L  A +TL+T+  + +L  A+  W  AR P++Q E + FG    
Sbjct: 54  DVIVAGYADLAAKGDALLLATQTLLTSTVQADLVAAQNAWKSARQPWEQGESHIFGPVDS 113

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
            + D  +++WPL+              + +  L  +N      I     ++         
Sbjct: 114 LSIDPHLDSWPLNTT------------DLQTQLANSNGFDADTIKGWNDDV--------- 152

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
                           G+H +E+LL+G  + +N +   +                 +  E
Sbjct: 153 ---------------QGFHTMEYLLFGDGVNSNTKLIADLS--------------SKERE 183

Query: 215 YLKVVSKILVSDLEEMMKAW------------------GPDGQATKDLMKDINAGLNSII 256
           YL  ++++      ++  AW                     G AT  +     A +  +I
Sbjct: 184 YLIALAEVFRDYTTQLDDAWQVSHNPQDANAKPYAELLKTPGDATNTIYSSQLAVIEELI 243

Query: 257 TGMTSLSYNELAGERMNLGLI----LHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYI 312
            GM     +E+   ++           D  +    +S N+   + N++IG+ + Y GE+ 
Sbjct: 244 NGMI-GIVDEVGNGKIADPFGESLTTADTSKVESQYSWNSLTDFSNNIIGVRNVYQGEFT 302

Query: 313 RMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNP 372
               ++     + D ++  +  LA  +  +  + +     +         F Q I   + 
Sbjct: 303 GGADKQ----GLIDFVTAADATLATRVASEIDDAILKIQAI--SGSTSMPFRQAI--LDA 354

Query: 373 EGNKIVRNLINDLITQTESLRKIRIAL 399
           +G    +  ++ L     +L+   + L
Sbjct: 355 DGRARTQVAVDALTKLQTTLQSDVLPL 381


>gi|114561991|ref|YP_749504.1| putative lipoprotein [Shewanella frigidimarina NCIMB 400]
 gi|114333284|gb|ABI70666.1| putative lipoprotein [Shewanella frigidimarina NCIMB 400]
          Length = 387

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 64/387 (16%), Positives = 134/387 (34%), Gaps = 81/387 (20%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +  A Y D       L  A +TL+T+  + +L  A+  W  AR P++Q E + FG    
Sbjct: 54  DVIVAGYADLAAKGDALLLATQTLLTSTVQADLVAAQNAWKSARQPWEQGESHIFGPVDS 113

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
            + D  +++WPL+              + +  L  +N      I     ++         
Sbjct: 114 LSIDPHLDSWPLNTT------------DLQTQLANSNGFDADTIKGWNDDV--------- 152

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
                           G+H +E+LL+G  + +N +   +                 +  E
Sbjct: 153 ---------------QGFHTMEYLLFGDGVNSNTKLIADLS--------------TKERE 183

Query: 215 YLKVVSKILVSDLEEMMKAW------------------GPDGQATKDLMKDINAGLNSII 256
           YL  ++++      ++  AW                     G AT  +     A +  +I
Sbjct: 184 YLIALAEVFRDYTTQLDDAWQVSHNPQDANAKPYAELLKTPGDATNTIYSSQLAVIEELI 243

Query: 257 TGMTSLSYNELAGERMNLGLI----LHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYI 312
            GM     +E+   ++           D  +    +S N+   + N++IG+ + Y GE+ 
Sbjct: 244 NGMI-GIVDEVGNGKIADPFGESLTTADTSKVESQYSWNSLTDFSNNIIGVRNVYQGEFT 302

Query: 313 RMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNP 372
               ++     + D ++  +  LA  +  +  + +     +         F Q I   + 
Sbjct: 303 GGADKQ----GLIDFVTAADATLATRVASEIDDAILKIQAI--SGSTSMPFRQAI--LDA 354

Query: 373 EGNKIVRNLINDLITQTESLRKIRIAL 399
           +G    +  ++ L     +L+   + L
Sbjct: 355 DGRARTQVAVDALTKLQTTLQSDVLPL 381


>gi|237710885|ref|ZP_04541366.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|229454729|gb|EEO60450.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
          Length = 390

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 51/390 (13%), Positives = 130/390 (33%), Gaps = 65/390 (16%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLE-----------KVLQNYATI-AHAKYEDALMCART 50
            +  ++ + +    A S   + + +            + + Y     +  Y++       
Sbjct: 6   LLVAVATMMSCSFSACSDNDDPTPDTGTSETDAKFEAIAKQYLDHTVYVTYKNLADETEQ 65

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           L   ++ L ++    N++     ++ AR  +++SE + +G       D  +++WPLD   
Sbjct: 66  LVKDLQALKSSKTDANVKATCETFLEARAWWEKSEAFLYGAATDFGIDPHIDSWPLD--- 122

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
           +D + ++     +                +  ++ D+             A     N   
Sbjct: 123 LDGLQTALKNTEQVEA-------------MGGEDGDI------------YAGEKLGNSLL 157

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVV----------- 219
           G+H IE++L+      +V +  +             G  R R   L++            
Sbjct: 158 GFHGIEYILFEDGSPKSVSKISDL---HLTYAVAVAGDLRNRCWQLELSWRGESAVNADR 214

Query: 220 SKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN--------SIITGMTSLSYNELAGER 271
              + ++LE        +    ++++    AG            I        +E+   +
Sbjct: 215 VAKVANELELPYTVNSGEYSYGENMLNAGKAGSTYASWTLAMQAIIDGCKTIADEVGTSK 274

Query: 272 MNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN 331
           +       DP      +S  +   + +++I I ++Y G       E     S+H+ I+  
Sbjct: 275 IGKPYSGEDPAYIESPYSHKSILDFYDNIISIQNAYMGGIENERDETN---SLHNYIAGV 331

Query: 332 NRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           ++ L  ++ +  +N +   + +     N  
Sbjct: 332 DKELDTKVVNAINNALTKINAMAAPFVNNI 361


>gi|237713613|ref|ZP_04544094.1| iron-regulated protein A [Bacteroides sp. D1]
 gi|262406288|ref|ZP_06082837.1| iron-regulated protein A [Bacteroides sp. 2_1_22]
 gi|229446335|gb|EEO52126.1| iron-regulated protein A [Bacteroides sp. D1]
 gi|262354991|gb|EEZ04082.1| iron-regulated protein A [Bacteroides sp. 2_1_22]
          Length = 382

 Score =  156 bits (394), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 62/367 (16%), Positives = 123/367 (33%), Gaps = 70/367 (19%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
            + +   +     V      +    Y+D       L++A++ L T+ +  ++ NA   W+
Sbjct: 33  DSGTATDDELKAAVATYVDDVVIPTYQDMYNKVTALNTAVQKLSTSSSDNDVANAADAWV 92

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR P+++SE + +G   ++  D  +++WPLD+G ID +  S   E+           A 
Sbjct: 93  AARKPWEKSEAFLYGPADLNKLDPSLDSWPLDKGGIDAILQSGNWEDAVGGDVDDGDDAP 152

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
           +    N                             G+H  E+LL+             + 
Sbjct: 153 ADAPQNL---------------------------RGFHTAEYLLFEDG--------EAKK 177

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDI------- 248
            TD D           ++ YLK V   +  D E ++K W           KD        
Sbjct: 178 ITDLD---------ANKIGYLKAVVGRMSKDTELLLKGWTEGKNLENGAYKDAMKAPNGT 228

Query: 249 ------NAGLNSIITG--MTSLSYNELAGERMNLGLILHDPEQ-------EIDCFSDNTY 293
                    +  I+          NE+   ++   +   +              +S N+ 
Sbjct: 229 YSISNIKQSVAMILNSDNGAEGIANEVGATKIGDPVDKWNSGDKEGGVLAVESWYSWNSL 288

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
             Y +++  I ++Y G    ++G     AS+  ++   N  L   +  +   T+   + +
Sbjct: 289 DDYTDNIYSIRNAYYGS---LDGTVAS-ASLCSIMKKVNPTLNDMVVKQIQETITAINDI 344

Query: 354 KDRAENI 360
                N 
Sbjct: 345 PHPFRNN 351


>gi|89890446|ref|ZP_01201956.1| conserved hypothetical protein [Flavobacteria bacterium BBFL7]
 gi|89517361|gb|EAS20018.1| conserved hypothetical protein [Flavobacteria bacterium BBFL7]
          Length = 373

 Score =  156 bits (394), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 56/407 (13%), Positives = 127/407 (31%), Gaps = 61/407 (14%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLV 59
             F  +IS   +          +   + +L+N A  I     +D       L ++ +  +
Sbjct: 11  FSFSILISCTESNDDSDNGSSDSFDRKALLENAADNIIIPALQDLNSDLINLKASKDLFI 70

Query: 60  TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYG 119
           TTPN+ NL+N R  W+ A   +Q  E++  G      ++ ++N +P +   I        
Sbjct: 71  TTPNQANLDNLRSDWLIAYKTWQYVEMFNIGKAEEILYNFQMNIYPTNTTDI-------- 122

Query: 120 KENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL 179
                      N IA+    +                        + N   G+  +++LL
Sbjct: 123 ----------QNNIASGNYDLTSP---------------------NNNDAVGFPALDYLL 151

Query: 180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD-- 237
           +G     +                 T  +      YL  V   + +    ++  W     
Sbjct: 152 YGLSSDDSTIID----------FYSTNTNAVGYANYLSDVINQMEALTNLVLTDWTSSYR 201

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLI----LHDPEQEIDCFSD-NT 292
                      ++ +N ++          L   ++ +           ++    +S+  +
Sbjct: 202 DIFVNSTANTASSSVNMLVNDFIFYYEKGLRANKIGIPAGVFSTTPLADKVEGFYSEIYS 261

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN--NRNLAQEINDKFSNTMKDF 350
               L  +      + G+  +     +  AS    +  N  + +L   IN++      + 
Sbjct: 262 KDLALIALKAAQDFFNGKAYQSTITGVSYASYVTTLRTNSGSSDLTASINNQIEAARTEL 321

Query: 351 HILKDRAENIESFDQ--MISENNPEGNKIVRNLINDLITQTESLRKI 395
           + L +   N  + +   M+   +      V   ++ L T   S+  +
Sbjct: 322 NQLDNNLFNQVNSNNTAMLMTYDELQRVTVLLKVDMLQTLNISVDYV 368


>gi|88803064|ref|ZP_01118591.1| putative lipoprotein [Polaribacter irgensii 23-P]
 gi|88781922|gb|EAR13100.1| putative lipoprotein [Polaribacter irgensii 23-P]
          Length = 366

 Score =  155 bits (390), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 59/399 (14%), Positives = 122/399 (30%), Gaps = 64/399 (16%)

Query: 1   MYFITIISIVFTLPSHALSI--VPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIET 57
           + F+  I+I     S  +S     +     +L+N A  I    YED  +    L S  E 
Sbjct: 7   LLFVAAIAINACSSSEEMSPIITDSFDRSALLENIADNIMIPAYEDFSVEMSALKSQGEV 66

Query: 58  LVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSS 117
             TTPN+ NLE  R+ W  A   +Q  E++  G      +   +N +P+    I+     
Sbjct: 67  FTTTPNQMNLEALRVSWFAAYKSWQYIEMFDIGKAEDLQFKFYMNIYPVTVSDIE----- 121

Query: 118 YGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEF 177
                          IA+    +N                      ++     G+  +++
Sbjct: 122 -------------GNIASESYDLNS---------------------VNNQDAQGFPALDY 147

Query: 178 LLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG-P 236
           LL+G                       T  +      Y+  V + + +    ++  +   
Sbjct: 148 LLYGLADTDAAILDKY----------VTAENKESYKNYIGAVLEQMNTLTTTVVSDFKAQ 197

Query: 237 DGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLI----LHDPEQEIDCF-SDN 291
                  +     + +N +I          L   +  +          PE+    + S  
Sbjct: 198 RNSFVISIENTATSNINKLINDYIYYYEKGLRANKFGIPSGVFSDTPLPEKVEGRYNSTV 257

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNN-RNLAQEINDKFSNTMKDF 350
           +    L  V+ + + + G++ + +     G S+   +   +  ++A     +F+      
Sbjct: 258 SKELALTAVMAVQNLFEGKHYKASTT---GVSLKSYLIKLDRTDIATSTTSQFNIATAQI 314

Query: 351 HILKDRAENIESFDQ--MISENNPEGNKIVRNLINDLIT 387
             L D        D   M    +     +    ++ L  
Sbjct: 315 ETLADSFATQIDTDNIAMTKAYDELQIAVRLLKLDMLQA 353


>gi|313106900|ref|ZP_07793103.1| Insulin-cleaving metalloproteinase outer membrane [Pseudomonas
           aeruginosa 39016]
 gi|310879605|gb|EFQ38199.1| Insulin-cleaving metalloproteinase outer membrane [Pseudomonas
           aeruginosa 39016]
          Length = 188

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 55/180 (30%), Positives = 91/180 (50%), Gaps = 1/180 (0%)

Query: 232 KAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDN 291
           KA   D    K   + ++ GL  +  GM SLS  ELAGERM + L  +  E E DCFSD+
Sbjct: 6   KAGVADNYRAKLEAEPVDTGLRKMFFGMGSLSLGELAGERMKVALEANSTEDEHDCFSDD 65

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH 351
           T+ +   +   I + Y GEY R++G  + G S+ DL++  +      +    ++T     
Sbjct: 66  THHTLFFNGKSIRNIYLGEYKRIDGSVVKGPSLADLVAKADAAANDTLKADLADTEAKLQ 125

Query: 352 ILKDRAE-NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
            + D AE +   FDQMI+ +N +G + +R+ I  L+ QT ++ +    L + +      +
Sbjct: 126 AIVDSAEKDGVHFDQMIAPDNKDGQQKIRDAIAALVKQTGAIEQAAGKLGIQDLKPDNAD 185


>gi|115374002|ref|ZP_01461292.1| hypothetical protein STIAU_3372 [Stigmatella aurantiaca DW4/3-1]
 gi|310825263|ref|YP_003957621.1| hypothetical protein STAUR_8039 [Stigmatella aurantiaca DW4/3-1]
 gi|115369009|gb|EAU67954.1| hypothetical protein STIAU_3372 [Stigmatella aurantiaca DW4/3-1]
 gi|309398335|gb|ADO75794.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 409

 Score =  154 bits (388), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 68/409 (16%), Positives = 123/409 (30%), Gaps = 73/409 (17%)

Query: 25  SLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
           +   +L    +      +D    A  L+SA+   V +P     + AR  +  A   +Q S
Sbjct: 49  TRGALLTAAGSCVLTSAQDFQRAAAGLESALAAFVASPEAGTRQAAREAFHAAMDSWQVS 108

Query: 85  EVYRFGNKIVD------TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
           EV++ G                + +WPL       V     +E   +  Y  +   +S  
Sbjct: 109 EVFQLGPAAPRSVAGGAELRDNIYSWPL-------VSRCAVEEQIVSKSYETSGFPSSL- 160

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
                                           G + +E+LL+ +   T            
Sbjct: 161 ----------------------------VSRRGLYAVEYLLFYEGADTVCPSTSPIVSGG 192

Query: 199 FDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITG 258
                 T     R+  Y  V +  +    + +++AW  D       ++    G     T 
Sbjct: 193 TWAALSTQERESRKRAYALVAAADVRRRADLLVEAWAADKGNFLRTLETAGTGNAVYPTS 252

Query: 259 MTSL---------SYNELAGERMNLGLILHD------PEQEIDCFSDNTYASYLNDVIGI 303
             +L            E+   ++   L L D      PE     F+  + A+   +++G 
Sbjct: 253 QGALNALSDALFYVEREVKDMKLARPLALRDCDSNTCPELLESQFAGRSKANVRANLVGF 312

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRN-LAQEINDKFSNTMKDFHILKDRAENIES 362
                G      G    G    DL+       LA  +  +          L++       
Sbjct: 313 RRLAEGC-----GPDFSGTGFDDLLISVGSEPLAVSLRQRIPEAQAALEALEEPD----- 362

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIEPNRVIGN 410
               + E   +    VR L + +   T+ L+  I   LDL  P+ V G+
Sbjct: 363 ----LREALAQDKASVRALYDAVKGVTDLLKVDIVTVLDLELPSSVEGD 407


>gi|255531235|ref|YP_003091607.1| periplasmic lipoprotein [Pedobacter heparinus DSM 2366]
 gi|255344219|gb|ACU03545.1| periplasmic lipoprotein [Pedobacter heparinus DSM 2366]
          Length = 372

 Score =  152 bits (384), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 54/412 (13%), Positives = 136/412 (33%), Gaps = 71/412 (17%)

Query: 1   MYFITIISIVFTLPSHALSIVPN------VSLEKVLQNYAT-IAHAKYEDALMCARTLDS 53
           +  ++++ I+F +     S   +           +L NYA  +    YE A      L +
Sbjct: 10  IAVLSMLLILFYISCSKKSNPADDKTTNGFDKTAMLTNYADKLIIPAYEQAQQKLTGLQT 69

Query: 54  AIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDY 113
           ++   + TPN  N    ++ +    +  ++  V  FG    ++    +N  P +      
Sbjct: 70  SVNAFLATPNLTNQAALKIVFKDTYLQIERISVLEFGPSRDNSLVGFINTLPANT----- 124

Query: 114 VDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYH 173
                                   +    ++ DL+I+  ++                G+ 
Sbjct: 125 ------------------------MKKIGEKTDLAIMEENIASGNWNLVQNSAVHQQGFP 160

Query: 174 VIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKA 233
            +++L +  D                 +   T  +   R +Y++ V   + S L++ +  
Sbjct: 161 ALDYLFFAND----------------ALAKFTDANSTNRKKYVQDVLNRIKSLLDQTLS- 203

Query: 234 WGPDGQATKDLMKDINAGLNSIITGMTSLSY--NELAGERMNLGLILHD-----PEQEID 286
              +    + +    +   + I   +   +Y  + L G R+             PE    
Sbjct: 204 TWKNTYRGQFIANTQSNSGSPISYLLNQFAYEMDMLKGPRIGWPFGTQSGGIQFPELCEA 263

Query: 287 CFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH-NNRNLAQEINDKFSN 345
            +S  +    + ++  + + +TG           G  I DL++   N +L  EI ++F+ 
Sbjct: 264 YYSGLSLDLAIENMNSLKNMFTG--------GNSGKGIADLLAALGNTSLKDEILNQFNV 315

Query: 346 TMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI--NDLITQTESLRKI 395
                  +     +  + ++   E+  +  +++  LI  + +      +  +
Sbjct: 316 VDSKLKAIPAPLSSALANNKPAIEDANKEIQLLLRLIKTDAVSKLGVQISYV 367


>gi|281423362|ref|ZP_06254275.1| imelysin family protein [Prevotella oris F0302]
 gi|281402698|gb|EFB33529.1| imelysin family protein [Prevotella oris F0302]
          Length = 368

 Score =  152 bits (384), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 51/410 (12%), Positives = 124/410 (30%), Gaps = 79/410 (19%)

Query: 2   YFITIISIVFTL--PSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETL 58
           +F+   ++                ++L++V++N    I   +Y+           A+  L
Sbjct: 13  FFLLCTTLFSCSDKNGDDGGKTQRLTLQQVVENDIDGIIRERYKVLATSTDAFYKALSAL 72

Query: 59  VTTP--NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS 116
             TP   ++ L      +++AR  Y++SE + FG     + D  +N+WPLD         
Sbjct: 73  -ETPAMTQEQLNQVCRLFLKARGTYEKSEAFFFGANAHFSVDSDINSWPLDRLR------ 125

Query: 117 SYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIE 176
                               +++ +   +D +   P  +               G+H IE
Sbjct: 126 ------------------YQQLMESNDPLDRTEGWPSGIV--------------GWHGIE 153

Query: 177 FLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLK----VVSK---ILVSDLEE 229
           ++++         +   R   +         + R R   L       +        D   
Sbjct: 154 YVIFRDGKPRPTDDIKPR---ELKYAKTLASNLRLRCFQLHCGWNADADPRYKTELDAAS 210

Query: 230 MMKAWGPDGQATKDLMK--DINAGLNSIITGMTSLS--YNELAGERMNLGLILHDPEQEI 285
           +             ++           I+TG   +    +E+A  +        D +   
Sbjct: 211 LPYQSPEGTDYRSYMLTVYTPQRAAQVILTGDKGMMGLADEMARTKFGEPFEHQDADYIE 270

Query: 286 DCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSN 345
             +S  +     +++  I + + G                      N  +A+ + + F+ 
Sbjct: 271 SPYSHTSLEDLRDNLQSISNLWYGSRNDA---------FDAWFKTRNPAIAKAVGEAFNK 321

Query: 346 TMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKI 395
            ++  + + +    ++ ++             V+  I  L    + L + 
Sbjct: 322 ALQAINSVPEPF--VKHYND----------AAVKQAIEALENLGKQLEQA 359


>gi|299142532|ref|ZP_07035663.1| lipoprotein [Prevotella oris C735]
 gi|298575967|gb|EFI47842.1| lipoprotein [Prevotella oris C735]
          Length = 368

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 51/410 (12%), Positives = 124/410 (30%), Gaps = 79/410 (19%)

Query: 2   YFITIISIVFTL--PSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETL 58
           +F+   ++                ++L++V++N    I   +Y+           A+  L
Sbjct: 13  FFLLCTTLFSCSDKNGDDGDKTQRLTLQQVVENDIDGIIRERYKVLATSTDAFYKALSAL 72

Query: 59  VTTP--NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS 116
             TP   ++ L      +++AR  Y++SE + FG     + D  +N+WPLD         
Sbjct: 73  -ETPAMTQEQLNQVCRLFLKARGTYEKSEAFFFGANAHFSVDSDINSWPLDRLR------ 125

Query: 117 SYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIE 176
                               +++ +   +D +   P  +               G+H IE
Sbjct: 126 ------------------YQQLMESSDPLDRTEGWPSGIV--------------GWHGIE 153

Query: 177 FLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLK----VVSK---ILVSDLEE 229
           ++++         +   R   +         + R R   L       +        D   
Sbjct: 154 YVIFRDGKPRPTDDIKPR---ELKYAKTLASNLRLRCFQLHCGWNADADPRYKTELDAAS 210

Query: 230 MMKAWGPDGQATKDLMK--DINAGLNSIITGMTSLS--YNELAGERMNLGLILHDPEQEI 285
           +             ++           I+TG   +    +E+A  +        D +   
Sbjct: 211 LPYQSPEGTDYRSYMLTVYTPQRAAQVILTGDKGMMGLADEMARTKFGEPFEHQDADYIE 270

Query: 286 DCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSN 345
             +S  +     +++  I + + G                      N  +A+ + + F+ 
Sbjct: 271 SPYSHTSLEDLRDNLQSISNLWYGSRNDA---------FDAWFKTRNPAIAKAVGEAFNK 321

Query: 346 TMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKI 395
            ++  + + +    ++ ++             V+  I  L    + L + 
Sbjct: 322 ALQAINSVPEPF--VKHYND----------AAVKQAIEALENLGKQLEQA 359


>gi|260591668|ref|ZP_05857126.1| imelysin family protein [Prevotella veroralis F0319]
 gi|260536468|gb|EEX19085.1| imelysin family protein [Prevotella veroralis F0319]
          Length = 453

 Score =  150 bits (378), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 67/437 (15%), Positives = 136/437 (31%), Gaps = 84/437 (19%)

Query: 13  LPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNL---- 67
             S + +      + KV+ NY   +    Y D    +  L +A + L        L    
Sbjct: 47  AASESSANANKTEMGKVVANYLEAVVKPTYLDLAQKSNALYNACQNLYKKRKAGKLTQSD 106

Query: 68  -ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
            + A   +  AR  ++QSE + +G    +  D  +++WPLD             +     
Sbjct: 107 IDAACEAFKGARKDWEQSEAFLYGAASDNEIDPHIDSWPLD------------HDQLTKA 154

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
           L  A++IA               I+ +   K    N    +   G+H +EF+L+      
Sbjct: 155 LNNADVIAG--------------INGESPTKYVYDNNGKFDSVLGFHGLEFVLFRNGKNR 200

Query: 187 NVREPGNRPYTDFDIGNCTGGHCR----------RRVEYLKVV----SKILVSDLEEMMK 232
            V +      T+  + + +  +            R + YL       + I  S L ++  
Sbjct: 201 TVADFNAEKETEQGLTSVSTVNEAAFAAAVAGDLRNMTYLLEYSWLGTSIPTSHLNQLAN 260

Query: 233 AWGPDGQAT---------------------KDLMKDINAGLNSIITGMTSLSYNELAGER 271
           A                             K      +  LN+I  G       E+A ++
Sbjct: 261 AMWVVNGTRHQGLSPKLIPYRDYSNFATTDKGYFTTWHETLNNIFIGGCVNICEEVASQK 320

Query: 272 MNLGLILHD--------PEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
           +                       +S  ++  Y +++  I ++  G             S
Sbjct: 321 LGQAYRKATGTGTADDAANYIESPYSKRSFQDYQDNIYSIKNTLYGVRGTETISTPAPNS 380

Query: 324 IHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLIN 383
           I + + +NN    +++ND     +      K            I+  +  G+  V+  I 
Sbjct: 381 IMNFLKNNNYPKYKDLNDALKEAISALETAKKSG---------IAFIDNPGHAQVKTCIE 431

Query: 384 DLITQTESLRKIRIALD 400
            +    ++L +    ++
Sbjct: 432 KVDALNQALNEAGTWIN 448


>gi|152999473|ref|YP_001365154.1| putative lipoprotein [Shewanella baltica OS185]
 gi|151364091|gb|ABS07091.1| putative lipoprotein [Shewanella baltica OS185]
          Length = 386

 Score =  149 bits (376), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 69/398 (17%), Positives = 142/398 (35%), Gaps = 81/398 (20%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
           V+ E ++     +  A Y D    A  L  A + L  +  + +L+ A+  W  AR+P++Q
Sbjct: 42  VATEMIINLTDDVIVAGYADLAAKAEALLLATQKLTNSTAQADLDAAQAAWKAARLPWEQ 101

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
            E + FG     + D  +++WPL+              + +  L T +      I     
Sbjct: 102 GESHIFGPVDSLSIDPHLDSWPLNTT------------DLQTQLNTNSGFDAETIKGWND 149

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           ++                         G+H IEFLL+G  +  N +              
Sbjct: 150 DV------------------------QGFHTIEFLLFGDGVNGNTKPISQLTA------- 178

Query: 204 CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD------------------GQATKDLM 245
                  +  EYL  ++++     +++  AW  +                  G A   + 
Sbjct: 179 -------KEREYLIALAEVFRDYTKQLDDAWQINHNPQDTAAKPYAELLKNPGVAGNTIY 231

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLI----LHDPEQEIDCFSDNTYASYLNDVI 301
               A +  +I GM +   +E+   ++           D  +    +S N+   + N++I
Sbjct: 232 SSQLAVVEELINGMIA-IVDEVGNGKIADPFGDSLATADTSKVESQYSWNSLDDFANNII 290

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           G+ + Y GE+   +  +     I + ++  + NLA  ++ +  + +     +     N +
Sbjct: 291 GVRNVYQGEFTGNSDRQ----GIINFVAAADANLATRVSSEIDDAIIKIRAI--AGSNQQ 344

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            F Q I   +  G   ++  ++ L     +L    I L
Sbjct: 345 PFRQAI--KDDAGRARIQVAVDALTKLKTTLESDVIPL 380


>gi|319951915|ref|YP_004163182.1| peptidase m75, imelysin [Cellulophaga algicola DSM 14237]
 gi|319420575|gb|ADV47684.1| Peptidase M75, Imelysin [Cellulophaga algicola DSM 14237]
          Length = 376

 Score =  149 bits (375), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 49/410 (11%), Positives = 116/410 (28%), Gaps = 66/410 (16%)

Query: 1   MYFITIISIVFTLPSHALSIV-----PNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSA 54
              +  + +     S            N +   +L N+A  I    Y         +  A
Sbjct: 9   FIILLSLIVFACSTSDNGGSSSEENNDNFNRSAMLINWADNIIIPAYTAFNADVAVMVQA 68

Query: 55  IETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYV 114
                 TP ++NL+N R  W  A + +Q   ++  G      +  ++N +P D   I+  
Sbjct: 69  SSVFTETPTEENLQNLRSAWKDAYVSFQTVSMFEIGKAEELNFRNRLNVYPTDVTSIE-- 126

Query: 115 DSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHV 174
                             I N+    +                             G+  
Sbjct: 127 ----------------QNIGNNTYNFSLPS---------------------NIAIQGFPA 149

Query: 175 IEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW 234
           I++L+ G                +      +         YL  ++  ++     ++  W
Sbjct: 150 IDYLINGLASTD----------AEIVAFYNSESTATGYNGYLNELTNTVLELSNTVLNDW 199

Query: 235 GPDG--QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL----HDPEQEIDCF 288
                              ++ ++          L   ++ +   +      PE+    +
Sbjct: 200 EGSYRSAFVTGTSSSATGSVDKLVNDFLFYYEKSLRAGKIGIPAGVFSVDPLPEKVEALY 259

Query: 289 S-DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLIS--HNNRNLAQEINDKFSN 345
           S +      L  +    + + G+      E     S  D ++   N  +L+  IN++F +
Sbjct: 260 SKEIGKELLLAAITASQNFFNGKSFTSASEGESLKSYLDFLNTIKNGDDLSSLINNQFES 319

Query: 346 TMKDFHILKDRAENIESFD--QMISENNPEGNKIVRNLINDLITQTESLR 393
           +      L +      + D  +M    +     ++   ++ L   + ++ 
Sbjct: 320 SKTKAAELGNDLALQVTTDNSKMTETYDELQRNVILLKVDMLQALSINVD 369


>gi|113953796|ref|YP_730707.1| Iron-regulated protein A precursor [Synechococcus sp. CC9311]
 gi|113881147|gb|ABI46105.1| Iron-regulated protein A precursor, putative [Synechococcus sp.
           CC9311]
          Length = 335

 Score =  149 bits (375), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 63/391 (16%), Positives = 146/391 (37%), Gaps = 75/391 (19%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           ++     S + +   +  +   L N   +    Y+  +   + L+ A++ LV  PN  NL
Sbjct: 19  TVTSACTSQSQAGPTDQDVSSALVN--DVVIPSYKKLVSGTKKLNQALQVLVKDPNPANL 76

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           + AR +W ++R  ++ +E + +G    + +D K++ WP+ +  +                
Sbjct: 77  KLARDEWKKSRNTWEVTETWAYGPAETEDFDPKLDDWPVSDKEL---------------- 120

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
                          + +     + +    L            G+H IE++++G      
Sbjct: 121 --------------AEALSEKDFTKEKFNALDTTG-------RGFHGIEYVIFGNGDTPV 159

Query: 188 VREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG-PDGQATKDLMK 246
                    +D            +++ YL++  + L S+ ++++ AW  P+G    D+  
Sbjct: 160 -------EASDLTT---------QQLAYLRIAGENLKSNAKQLLAAWSGPEGFGKADVEA 203

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
           D    +N I+ GM +   +E++  ++   L     E     FS NT A  L+++ G+  +
Sbjct: 204 DPAKTVNDILEGM-AGCLDEVSNTKLGEALASGKGE-LESTFSGNTGADVLSNLQGVQLA 261

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
           +                I +     +  L+ ++  +    +     L  R       D++
Sbjct: 262 WEKSK------------IQEYAKTKDAELSNQLTVELQTALAQAKELPTRLN-----DKL 304

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRI 397
            + +  +  K++   I+     TE+L+    
Sbjct: 305 DNGDTQKQVKMLMEAISKAFDTTEALKSKIG 335


>gi|330721294|gb|EGG99379.1| Iron-regulated protein A precursor [gamma proteobacterium IMCC2047]
          Length = 161

 Score =  148 bits (373), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 56/153 (36%), Positives = 91/153 (59%), Gaps = 2/153 (1%)

Query: 255 IITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRM 314
           ++ GM SL+  ELAGERM + L  +  E E DCFSDNT+ S+  +  GI + Y G Y R+
Sbjct: 1   MLFGMGSLALGELAGERMKVALEANSAEDEHDCFSDNTHFSHFYNAQGIRNVYFGSYSRV 60

Query: 315 NGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE--NIESFDQMISENNP 372
           +G ++ G S+ +L++  +++ A +    F  T     ++ DRAE  N   FDQMI+E N 
Sbjct: 61  DGSELTGPSLAELVAAKSKDAAAQAQAAFDKTSTSLQVMVDRAEAKNGMKFDQMIAEGNA 120

Query: 373 EGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           EG +I+RN I  L+ +T+++ ++   +D+    
Sbjct: 121 EGEEIIRNAIVALVEETQAIERVAQVIDVSNLQ 153


>gi|160874091|ref|YP_001553407.1| putative lipoprotein [Shewanella baltica OS195]
 gi|160859613|gb|ABX48147.1| putative lipoprotein [Shewanella baltica OS195]
 gi|315266324|gb|ADT93177.1| Peptidase M75, Imelysin [Shewanella baltica OS678]
          Length = 386

 Score =  148 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 68/398 (17%), Positives = 141/398 (35%), Gaps = 81/398 (20%)

Query: 24  VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQ 83
            + E ++     +  A Y D    A  L  A + L  +  + +L+ A+  W  AR+P++Q
Sbjct: 42  AATEMIINLTDDVIVAGYADLAAKAEALLLATQKLTNSTAQADLDAAQAAWKAARLPWEQ 101

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
            E + FG     + D  +++WPL+              + +  L T +      I     
Sbjct: 102 GESHIFGPVDSLSIDPHLDSWPLNTT------------DLQTQLNTNSGFDAETIKGWND 149

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
           ++                         G+H IEFLL+G  +  N +              
Sbjct: 150 DV------------------------QGFHTIEFLLFGDGVNGNTKPISQLTA------- 178

Query: 204 CTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD------------------GQATKDLM 245
                  +  EYL  ++++     +++  AW  +                  G A   + 
Sbjct: 179 -------KEREYLIALAEVFRDYTKQLDDAWQINHNPQDAAAKPYAELLKNPGVAGNTIY 231

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLI----LHDPEQEIDCFSDNTYASYLNDVI 301
               A +  +I GM +   +E+   ++           D  +    +S N+   + N++I
Sbjct: 232 SSQLAVVEELINGMIA-IVDEVGNGKIADPFGDSLATADTSKVESQYSWNSLDDFANNII 290

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           G+ + Y GE+   +  +     I + ++  + NLA  ++ +  + +     +     N +
Sbjct: 291 GVRNVYQGEFTGNSDRQ----GIINFVAAADANLATRVSSEIDDAIIKIRAI--AGSNQQ 344

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            F Q I   +  G   ++  ++ L     +L    I L
Sbjct: 345 PFRQAI--KDDAGRARIQVAVDALTKLKTTLESDVIPL 380


>gi|332828530|gb|EGK01230.1| hypothetical protein HMPREF9455_02422 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 386

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 69/426 (16%), Positives = 128/426 (30%), Gaps = 84/426 (19%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLE-------KVLQNYAT-IAHAKYEDALMCARTLDS 53
           + +   ++ F       S     + +       +VL+ Y   +    Y D    A TL  
Sbjct: 8   FLLLFSALYFFSSCGEDSPEGEFTDDGYGYDFTQVLKVYTDDVILPTYADMKNKAWTLYD 67

Query: 54  AIETLVTTP--NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFI 111
           A++T  T+    + NL      W   RIP++QSE   +G       D  +++WPL +G I
Sbjct: 68  AVQTFSTSTGRTQANLNAVCAAWRATRIPWEQSESCLYGPADRLGLDPSLDSWPLKKGDI 127

Query: 112 DYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTG 171
           D                   II +  I +                     + I      G
Sbjct: 128 D------------------KIINSGSITI---------------------DKIMDPGVHG 148

Query: 172 YHVIEFLLWGQDLKTNVREPGNRP--------YTDFDIGNCTGGHCRRRVEYLKVVSKIL 223
           +H IE+L++       +                T++   +C                   
Sbjct: 149 FHTIEYLIFSDGNPKVLSTTPLSEAEIQYLVIATEYLRNDCIMLWAAWNGTQNISAKDQA 208

Query: 224 VSDLEE-------MMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGL 276
           V +  +           +     ++   +  ++  +++II G  +   +E+A +++    
Sbjct: 209 VINTFDEDPTQYNFAYNFKNAITSSGVDLATMDDAIDNIIEG-CAGIADEVAAQKIGAPR 267

Query: 277 ILHD-------PEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLIS 329
            L           +    +S N+   Y N++I I +SY G   +         S+   + 
Sbjct: 268 DLALDGRTDEAVLEVESWYSWNSIDDYANNIISIRNSYFGGLNKTT-SNRSQHSMSVFVE 326

Query: 330 HNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQT 389
             N  L  EI        K  +                   N      V   I+      
Sbjct: 327 SKNAVLDAEITAAIDKAYKAINE-----------GMQRPFRNNLTGAKVDAAIDACTDLQ 375

Query: 390 ESLRKI 395
            S  KI
Sbjct: 376 LSFEKI 381


>gi|289677764|ref|ZP_06498654.1| iron-regulated protein A, putative [Pseudomonas syringae pv.
           syringae FF5]
          Length = 148

 Score =  147 bits (370), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 48/145 (33%), Positives = 76/145 (52%)

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E AGERM + L  +  E E DCFSDNT+ S+  +  GI + Y GEY R +G K+ G S+ 
Sbjct: 1   ERAGERMKVALEANSSEDEHDCFSDNTHNSHFYNGKGIRNVYLGEYTRTDGSKVSGPSLS 60

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
            L++  +      +     +T     ++ D A   E FDQ+I+  N  GN++VR+ I  L
Sbjct: 61  SLVAKADPATDATLRADLDDTQAKLQVIVDHANKGEHFDQLIAAGNTAGNQVVRDAIAAL 120

Query: 386 ITQTESLRKIRIALDLIEPNRVIGN 410
           + QT ++ +    L + + N    +
Sbjct: 121 VKQTGAIEQAAGKLGITDLNPDNAD 145


>gi|298208271|ref|YP_003716450.1| hypothetical protein CA2559_08516 [Croceibacter atlanticus
           HTCC2559]
 gi|83848192|gb|EAP86062.1| hypothetical protein CA2559_08516 [Croceibacter atlanticus
           HTCC2559]
          Length = 379

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 62/409 (15%), Positives = 133/409 (32%), Gaps = 71/409 (17%)

Query: 1   MYFITIISIVFTLPSHALSI--------VPNVSLEKVLQNYAT-IAHAKYEDALMCARTL 51
           +  +TI  IV                    N + E +L N+A  I    Y      A  +
Sbjct: 9   LSLLTIAVIVSCSSDSGSDDGTTTGGNNQDNFNRETMLINWADNIIIPSYISFKADADAM 68

Query: 52  DSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFI 111
            +A  T  TTPN+ NLEN R  W  A + +Q   ++  G    + +  ++N +P +   I
Sbjct: 69  VTATTTFTTTPNQANLENLRAAWETAYLSFQNVSMFEIGKAEEERYRNRLNVYPTNTTEI 128

Query: 112 DYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTG 171
           +                  + IA+    ++                        T    G
Sbjct: 129 E------------------DFIASGSYDLSLPS---------------------TIDAQG 149

Query: 172 YHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMM 231
           +  +++L++G               TD      T  +     +YL  +S+ + + L +++
Sbjct: 150 FPALDYLIYGAANTD----------TDIIALYSTNANADNYKQYLNELSQTIAT-LTDIV 198

Query: 232 KAWGPDGQATKDLMKDINAG---LNSIITGMTSLSYNELAGERMNLGLILHD----PEQE 284
            A          +    ++    ++ +           L   ++ +          PE  
Sbjct: 199 LADWQTNFRDTFVANTSSSSTGSVDKLANDYILYYEKGLRAGKIGIPAGNFSNETLPENV 258

Query: 285 IDCF-SDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLIS--HNNRNLAQEIND 341
              +  D + A +   +    + + G++   N E     S  + ++   N  +L+  I +
Sbjct: 259 EGFYRKDLSKALFNASLTATQNFFEGKHFNSNTEGESFKSYLNFLNTIKNGDDLSTLIVN 318

Query: 342 KFSNTMKDFHILKDRAENIESFDQ--MISENNPEGNKIVRNLINDLITQ 388
           +F  +    ++L D        D   M+   +     ++   ++ L   
Sbjct: 319 QFEASRTQGNLLNDDFTQQIESDNSVMLLTFDELQRNVILLKVDMLQAL 367


>gi|332521084|ref|ZP_08397542.1| Peptidase M75, Imelysin [Lacinutrix algicola 5H-3-7-4]
 gi|332043177|gb|EGI79374.1| Peptidase M75, Imelysin [Lacinutrix algicola 5H-3-7-4]
          Length = 365

 Score =  143 bits (361), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 54/377 (14%), Positives = 114/377 (30%), Gaps = 67/377 (17%)

Query: 22  PNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
              +   +L N A  I    Y++       L  A    V   ++ NLE  R  W  A   
Sbjct: 32  DTYNRTAMLTNIADNIIIPGYQNLGTELSALVDAKNAFVANVDQTNLETLRANWFSAYQS 91

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           +Q  ++++ G      +++++N +P +   I+                  N IAN    +
Sbjct: 92  FQAVQMFQIGKAEEILFEEQMNIYPTNTTDIE------------------NNIANGNYDL 133

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
           +                      ++ N   G+  ++++L+G                D D
Sbjct: 134 SS---------------------VNNNDAVGFPAVDYMLYG--------------VADND 158

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKDINAGLNSIITG 258
               T         YL  +   + +    ++  W          +     +  +N  +  
Sbjct: 159 AAILTTLSNTNYSNYLSDLIDRMQTLTNTVLTDWTSGYRDNYITNTANVESGAVNQTLNA 218

Query: 259 MTSLSYNELAGERMNLGLI----LHDPEQEIDCF-SDNTYASYLNDVIGIISSYTGEYIR 313
                   L  +++ +          P +    +  DN+    L  +  +   + G+ I 
Sbjct: 219 YVFYYEKRLRADKVGIPAGVFSSTPLPSKVEVLYKEDNSRTLLLEALNAVQDVFNGKAIN 278

Query: 314 MNGEKIHGASIHDLISHNN-RNLAQEINDKFSNTMKDFHILKDRAENIESFD--QMISEN 370
            N   I G S  + +   +  +L + IN +F         L    +     D  +M    
Sbjct: 279 SN---IEGESYKNYLIALDRNDLVEVINQRFDAARTKIEALNTNLKTQVETDNTKMTEAY 335

Query: 371 NPEGNKIVRNLINDLIT 387
           +     +V    + L  
Sbjct: 336 DALQLAVVSLKSDMLSA 352


>gi|317504857|ref|ZP_07962813.1| imelysin superfamily protein [Prevotella salivae DSM 15606]
 gi|315664041|gb|EFV03752.1| imelysin superfamily protein [Prevotella salivae DSM 15606]
          Length = 399

 Score =  143 bits (360), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 62/436 (14%), Positives = 135/436 (30%), Gaps = 96/436 (22%)

Query: 3   FITIISIVFTLPSHALSIVPNV-----------SLEKVLQNYAT-IAHAKYEDALMCART 50
            +  ++   T    + S   +V            L++VL +Y     +  Y+     +  
Sbjct: 9   MLFAMACSLTTSMTSCSSDDDVKPSGELSAGDKYLQQVLSSYVDNTVNPTYKALADESEK 68

Query: 51  LDSAIETLV-TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEG 109
           L   +E L   +  ++ + +    ++ AR  Y++SE +  G       D  +++WPLD  
Sbjct: 69  LYKELEALQPGSITQQQVNDVCKTFLEARGNYERSEAFLLGAASHFLIDPHIDSWPLDLQ 128

Query: 110 FIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNIT 169
            +                    I A+ K  ++++ I                        
Sbjct: 129 SL-----------------YNYIKADKKYKIDDQSI------------------------ 147

Query: 170 TGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEE 229
            G+H IEF+L+         E       +    N T     + +EY K V++ L + +  
Sbjct: 148 LGFHGIEFILFRDGQPRKAAELNGHDTYNAGTNNFTIFTGAQELEYAKAVAEDLRNSVYR 207

Query: 230 MMKAWGPD-------------------------------GQATKDLMKDINAGLNSIITG 258
           +  +W  D                               G         +   ++S+++G
Sbjct: 208 LECSWNEDATKAHKDVLDELETSYTTDKGNSYGYEMKHAGDPVNSQYATVKIAVSSVLSG 267

Query: 259 --MTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
               +   +E+   ++N      D       +S N+   + N++  I + + G       
Sbjct: 268 DHSAAGIADEVGNTKINNPFSGKDESYIESPYSYNSLTDFQNNIHSIENVWYGGVQG--- 324

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
            K    S  +     +    + + D  +N +K    +K                     K
Sbjct: 325 -KRSEYSFSNYFKKYDAATGKRVEDAITNALKQIAAIKAPFVKNIK-----DPQCANAIK 378

Query: 377 IVRNLINDLITQTESL 392
             + L + L   ++ +
Sbjct: 379 ACQELNDALTAASDFI 394


>gi|281423365|ref|ZP_06254278.1| imelysin family protein [Prevotella oris F0302]
 gi|281402701|gb|EFB33532.1| imelysin family protein [Prevotella oris F0302]
          Length = 392

 Score =  143 bits (360), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 58/402 (14%), Positives = 126/402 (31%), Gaps = 92/402 (22%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEK-------------VLQNYATIAHAKYEDALMCAR 49
            +  +    T    + S   + + +              +  N     +  Y+       
Sbjct: 1   MLFAMVCSLTTAMTSCSSNDDDTPQTGQLSEGDKYLQKVLAANVDNTINPTYKALADGCE 60

Query: 50  TLDSAIETLV-TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDE 108
            L++ +E L   +  ++ ++N    ++ AR  Y+ SE +  G       D  +++WPL  
Sbjct: 61  KLNNELEALTPGSITQQQVDNVCKTFLEARANYEGSEAFLLGAASHFLIDPHIDSWPL-- 118

Query: 109 GFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNI 168
                            N     + A+ K  + ++ I                       
Sbjct: 119 ---------------GLNELYNYLKADHKYKITDQSI----------------------- 140

Query: 169 TTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLE 228
             G+H IEF+L+         E  +    +    + T     + ++Y K V++ L + + 
Sbjct: 141 -LGFHGIEFILFRDGKPRKAAELNSHDSYNQAGIDFTIFSGTQELDYAKAVAEDLRNSVY 199

Query: 229 EMMKAWGPD-------------------------------GQATKDLMKDINAGLNSIIT 257
            +  +W  +                               G  TK     +   ++S++T
Sbjct: 200 RLECSWDENANKEHVKVLDELETVYKTDKGFSYGYEMKNAGDPTKSTYNTVKLAVSSVLT 259

Query: 258 GMTS--LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
           G  S     +E+   ++N      D       +S N+   + N++  I + + G      
Sbjct: 260 GDNSAGGIADEVGNTKINNPFSGKDESYIESPYSYNSLTDFQNNIHSIENVWFGGVEGKR 319

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRA 357
           GE     S H+     +  + Q +    S+ +K    +K   
Sbjct: 320 GE----YSFHNYFKKYDAKVGQRVETAISDALKQIAAIKYPF 357


>gi|297567103|ref|YP_003686075.1| peptidase M75, Imelysin [Meiothermus silvanus DSM 9946]
 gi|296851552|gb|ADH64567.1| Peptidase M75, Imelysin [Meiothermus silvanus DSM 9946]
          Length = 425

 Score =  143 bits (360), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 77/387 (19%), Positives = 132/387 (34%), Gaps = 74/387 (19%)

Query: 18  LSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           L+     +   + ++ A  +    Y + L   + L+ A  +L   P   NLE AR  W  
Sbjct: 11  LASASAQADYPLAKSLADGVILPTYTELLARLKGLEGAARSLKAKPTPANLEAARTAWRA 70

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           ARIPY+++E + FG   +  +D  ++ WP+D   ++ +                      
Sbjct: 71  ARIPYERAEGFAFGP--IGDYDPLLDTWPIDREGLEALLKGSQP---------------- 112

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
                    D + +  +                 G+H +E+LLWG  LK   +    RP 
Sbjct: 113 -----LSAADFAKLPSE---------------VRGFHAVEYLLWG--LKGQKKAAQLRP- 149

Query: 197 TDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA----TKDLMKDINAGL 252
                         R ++Y+++ S  +V   +  + AW     A      DL K   A L
Sbjct: 150 --------------RELQYIELASADMVRQAKANLTAWQQGFYARFTRPSDLYKSEAAAL 195

Query: 253 NSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYI 312
           + II G+  +   E+A E++   L  +DP      FS N+   Y  D+ G    Y G   
Sbjct: 196 DEIIGGLVGIIA-EIADEKLGNPLQANDPLVAESPFSGNSLEDYRQDLEGARRYYLGGQP 254

Query: 313 RMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNP 372
                 I G      I+  +      I   F    +    +              +   P
Sbjct: 255 ASQKAGIGG-----WIAAQDPGSHAAILRAFDIAKEALAAIPSPLSE--------ALQTP 301

Query: 373 EGNKIVRNLINDLITQTESLRKIRIAL 399
           +G   ++     L      L    + L
Sbjct: 302 KGQARIKTAQAALQNLRGLLESRAVGL 328


>gi|83643089|ref|YP_431524.1| periplasmic lipoprotein [Hahella chejuensis KCTC 2396]
 gi|83631132|gb|ABC27099.1| predicted periplasmic lipoprotein [Hahella chejuensis KCTC 2396]
          Length = 370

 Score =  143 bits (359), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 48/382 (12%), Positives = 111/382 (29%), Gaps = 79/382 (20%)

Query: 34  ATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKI 93
           + I    +       + L +    L    N ++LE+A+  W  A   +    + +FG   
Sbjct: 46  SDIIVPAHAQLSAKVQALKAKTTALCEETNAQSLEHAQQAWREAMQTWMSVSLIQFGPLQ 105

Query: 94  VDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPD 153
                 ++ +WP+ E  ++    +    ++       N                      
Sbjct: 106 EQDRRLRMQSWPIREKLLERAVEALASGSDPLQAAINNG--------------------- 144

Query: 154 LLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRV 213
                       +    G   IE+LL+G++                     +     RR 
Sbjct: 145 ------------SIAIQGLPAIEYLLFGKN---------------ALDKLQSADQGARRC 177

Query: 214 EYLKVVSKILVSDLEEMMKAWGPD--GQATKDLMKD-----INAGLNSIITGMTSLSYNE 266
           + L  ++   V    E+ K W              D         ++  + G+ +    +
Sbjct: 178 QALTAIASHSVDLATELEKEWKGGFGDNFENPFEADGNLSVPQESVDEYLNGLMTGI-QQ 236

Query: 267 LAGERMNLGLI----LHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           +   ++   +         +      S N+ A+  N++  +   Y G           G 
Sbjct: 237 ITANKVATPMGLEGRSAKLKALESFHSRNSIANIRNNLSALRRFYMGG---------DGY 287

Query: 323 SIHD-LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
            + D L+S  +  + ++I             +    E+        + N+ E N  V+ L
Sbjct: 288 GLDDFLLSRESAAMHKKITGLLDGVDAQLAQIDFALED--------AVNDAEKNAKVKKL 339

Query: 382 INDLITQTESLR-KIRIALDLI 402
              L     ++  ++   + + 
Sbjct: 340 YEALRQLQAAVEKELFPVIGVT 361


>gi|262197053|ref|YP_003268262.1| peptidase M75, Imelysin [Haliangium ochraceum DSM 14365]
 gi|262080400|gb|ACY16369.1| Peptidase M75, Imelysin [Haliangium ochraceum DSM 14365]
          Length = 391

 Score =  142 bits (358), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 59/366 (16%), Positives = 115/366 (31%), Gaps = 59/366 (16%)

Query: 14  PSHALSIVPNVSLEKVLQNYATIAH-AKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           PS          ++ VL++ A +     Y+D    A  L++A  +L   P+   L   R 
Sbjct: 32  PSKGPDANRGPDVQDVLRDLANVVIVPAYDDFRASAEQLEAATRSLCAAPDAAQLTALRG 91

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
           QW   R  ++++E + FG       D  V+ WP+    +D   +                
Sbjct: 92  QWRDTRALWKRAEAHEFGPAADLRIDTAVDFWPVRASSVDIELA---------------- 135

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
                   +    D +    D L               G  V+E++L+      +  +  
Sbjct: 136 ------KTDPVPEDYATTLGDTL--------------KGLPVMEYILYDGASAADDADTE 175

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGL 252
           +       + +   G   R   YL  +S  + +    + +AW P+G+     +     G 
Sbjct: 176 SVLAR---LVDAETGEPTRTCAYLVALSVDVHAKATTLYQAWAPEGENFAAELATAGQGS 232

Query: 253 NSIITGMTS---------LSYNELAGERMNLGLI-----LHDPEQEIDCFSDNTYASYLN 298
            +      +             E+   ++   L      +  P+      SD++ A    
Sbjct: 233 TAYPDRAKAVSAVVNDFVYLIQEVESVKLAEPLGKRAGDVPQPDAVESARSDSSRADIAA 292

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
           ++ G+ + YT            GAS    ++  N  L   I  +  +       +    E
Sbjct: 293 NLAGVRAVYTCTRGDA-----TGASFQAAVAALNPELDAAIMAQLDDADAKVAAIALPLE 347

Query: 359 NIESFD 364
                D
Sbjct: 348 QAVVDD 353


>gi|315608936|ref|ZP_07883908.1| conserved hypothetical protein [Prevotella buccae ATCC 33574]
 gi|315249316|gb|EFU29333.1| conserved hypothetical protein [Prevotella buccae ATCC 33574]
          Length = 441

 Score =  142 bits (357), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 59/424 (13%), Positives = 121/424 (28%), Gaps = 98/424 (23%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKN------LENARLQWIRARIPYQQSEVYR 88
            + +  Y +    A  L + I  L              ++     +  AR  +++SE + 
Sbjct: 54  NVVYPTYGNLASEAEGLYAKINALKAKLKAGTRVEQSEIDAICTSYKAARQYWEESEAFL 113

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           +G       D  +++WPLD                  +L +   I        + E+   
Sbjct: 114 YGAASDFEIDPHIDSWPLDV------------PTLAKDLASDAKIKTLDKEAEDIEVTRK 161

Query: 149 IISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGG 207
            ++ + L               G+H IEF+ +            N     ++   +    
Sbjct: 162 NLTAENL---------------GFHGIEFIFFRDGKNRPASFFNNDEVEKYENIFDGKNV 206

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT-------------------------- 241
             +  V +   V+  L     +++ AW P   A                           
Sbjct: 207 TAKEEVIFATAVAGDLRDKCYQLVVAWNPAASAAYKARIAECAKHFDDFKTLTKKGLTYG 266

Query: 242 ---------KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILH------------- 279
                    K     +   + +I+    S    E+A ++M                    
Sbjct: 267 EDLLQAGTAKSTQSSVKKVVETILVSGCSNICAEVADQKMGQAYRASKDPNSQHQGEDGK 326

Query: 280 ----DPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNL 335
               DP      +S N++  + ++++ I +S  G Y   NG      S+   ++  N   
Sbjct: 327 MEPDDPNYIESPYSYNSFTDFYDNIMSIQNSLYGNY---NGNTYAAKSLMSYLNTYNVVE 383

Query: 336 AQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKI 395
           A  IN K +  +K     +                   G  +V+  ++ +      L K 
Sbjct: 384 AALINAKLTAALKALKACQTSGTPFVLN---------PGAPLVKAAMDAVGELDSELNKA 434

Query: 396 RIAL 399
              +
Sbjct: 435 SQWI 438


>gi|288926765|ref|ZP_06420675.1| imelysin superfamily [Prevotella buccae D17]
 gi|288336446|gb|EFC74822.1| imelysin superfamily [Prevotella buccae D17]
          Length = 441

 Score =  142 bits (357), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 59/424 (13%), Positives = 121/424 (28%), Gaps = 98/424 (23%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKN------LENARLQWIRARIPYQQSEVYR 88
            + +  Y +    A  L + I  L              ++     +  AR  +++SE + 
Sbjct: 54  NVVYPTYGNLASEAEGLYAKINALKAKLKAGTRVEQSEIDAICTSYKAARQYWEESEAFL 113

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
           +G       D  +++WPLD                  +L +   I        + E+   
Sbjct: 114 YGAASDFEIDPHIDSWPLDV------------PTLAKDLASDAKIKTLDKEAEDIEVTRK 161

Query: 149 IISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG-NCTGG 207
            ++ + L               G+H IEF+ +            N     ++   +    
Sbjct: 162 NLTAENL---------------GFHGIEFIFFRDGKNRPASFFNNDEVEKYENIFDGKNV 206

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT-------------------------- 241
             +  V +   V+  L     +++ AW P   A                           
Sbjct: 207 TAKEEVIFATAVAGDLRDKCYQLVVAWNPAASAAYKARIAECAKHFDDFKTLTKKGLTYG 266

Query: 242 ---------KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILH------------- 279
                    K     +   + +I+    S    E+A ++M                    
Sbjct: 267 EDLLQAGTAKSTQSSVKKVVETILVSGCSNICAEVADQKMGQAYRASKDPNSQHEGEDGK 326

Query: 280 ----DPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNL 335
               DP      +S N++  + ++++ I +S  G Y   NG      S+   ++  N   
Sbjct: 327 MEPDDPNYIESPYSYNSFTDFYDNIMSIQNSLYGNY---NGNTYAAKSLMSYLNTYNVVE 383

Query: 336 AQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKI 395
           A  IN K +  +K     +                   G  +V+  ++ +      L K 
Sbjct: 384 AALINAKLTAALKALKACQTSGTPFVLN---------PGAPLVKAAMDAVGELDSELNKA 434

Query: 396 RIAL 399
              +
Sbjct: 435 SQWI 438


>gi|189463604|ref|ZP_03012389.1| hypothetical protein BACCOP_04328 [Bacteroides coprocola DSM 17136]
 gi|189429707|gb|EDU98691.1| hypothetical protein BACCOP_04328 [Bacteroides coprocola DSM 17136]
          Length = 411

 Score =  140 bits (353), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 59/423 (13%), Positives = 124/423 (29%), Gaps = 83/423 (19%)

Query: 14  PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN------- 66
            S+ LS       E ++          Y      A  +  A           +       
Sbjct: 33  TSNGLSNEEQALKEAIVPYVDNTVIPTYTAMADEAILMSDACTKAKEAYLSGDKAKATEY 92

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           +  A   W  +R  ++ SE + FG       D  +++WPLD+  +D              
Sbjct: 93  VAEACEHWTESRKAWELSEAFLFGAAADYNIDPHIDSWPLDQVALD-------------- 138

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
               N++ N K++    E D   I+ +L                GYH +E++L+ Q    
Sbjct: 139 ----NLLNNQKMMDAIGEGDFDYITTNL-----------GYGLLGYHALEYILF-QLTDD 182

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG-------- 238
           + REP N   T +             + Y+  V++ L +    +  +W            
Sbjct: 183 SHREPRNFEKT-YSYSGQVVNITNNHLIYMAGVAEDLRNQCIRLEASWAGMNNISTQKQE 241

Query: 239 -----------QATKDLMKDINAG--------LNSIITGMTSLSYNELAGERMNLGLILH 279
                           +      G            +        +E+  +++       
Sbjct: 242 ILTETEQEPTFNYGTSMKTAGQGGSKYTSYTVAAQELIQGCIDIVDEVCTQKIGRPNSGQ 301

Query: 280 DPEQ---EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLA 336
             +        ++ N+   +++++  + ++Y G        K +  S+   +S  ++   
Sbjct: 302 SADDKNYIESPYALNSVVDFVDNIKSVKNAYEGISYDG---KNNATSVSAYVSTVDQATD 358

Query: 337 QEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
            E+      ++     + +               N  G       I  L   + +L K  
Sbjct: 359 TEVKALIDESITKIQAIPEPF-----------AKNATG-AEADAAIASLSKLSTALNKAN 406

Query: 397 IAL 399
            AL
Sbjct: 407 KAL 409


>gi|317504859|ref|ZP_07962815.1| conserved hypothetical protein [Prevotella salivae DSM 15606]
 gi|315664043|gb|EFV03754.1| conserved hypothetical protein [Prevotella salivae DSM 15606]
          Length = 368

 Score =  140 bits (353), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 56/408 (13%), Positives = 127/408 (31%), Gaps = 75/408 (18%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETL- 58
           ++   I+S               +SLE+V+ N    +  A+Y+       T   A+  L 
Sbjct: 14  LFLSIILSSCSEKGGDDGQQSNKLSLEQVITNDIDGVIRAQYKVLATNTSTFYEALSALE 73

Query: 59  VTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSY 118
            +T  ++ LE     +++AR  Y++SE + FG     T D  +N+WPLD           
Sbjct: 74  TSTMTQEQLEKVCQLFLKARGDYEKSEAFFFGANAHFTVDADINSWPLDR---------- 123

Query: 119 GKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFL 178
                         +   +++ +   +D S      +               G+H IE++
Sbjct: 124 --------------VRFQQLMQSNDPLDDSERWASGIV--------------GWHGIEYV 155

Query: 179 LWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYL-----KVVSKILVS--DLEEMM 231
           ++       V    +    +         + R R   L             +  D   + 
Sbjct: 156 IFRDGKPRPVA---DITARELKYAKTLSANLRLRCYQLYCGWNASAGTEFTAILDAANLS 212

Query: 232 KAWGPDGQATKDLMK--DINAGLNSIITGMTSLS--YNELAGERMNLGLILHDPEQEIDC 287
                        +           I+TG   +    +E+A  +        D +     
Sbjct: 213 YRAPKGADYRDYFLAVYTPQRAAQVILTGDNGMMGLSDEMARTKFGDPFEHQDADYIESP 272

Query: 288 FSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTM 347
           +S  +     +++  I S + G                   +  N  +++ + + F  T+
Sbjct: 273 YSHTSLEDLRDNLQSIRSLWFGNDNNA---------FDAWFNVRNPAISKAVREAFDKTL 323

Query: 348 KDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKI 395
           +  + + +    ++ ++             ++  I  L   ++ L + 
Sbjct: 324 QAINAVPEPF--VKHYND----------PTIKQAIAALDNLSKQLEQA 359


>gi|86132797|ref|ZP_01051389.1| imelysin peptidase [Dokdonia donghaensis MED134]
 gi|85816751|gb|EAQ37937.1| imelysin peptidase [Dokdonia donghaensis MED134]
          Length = 373

 Score =  140 bits (353), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 44/383 (11%), Positives = 112/383 (29%), Gaps = 66/383 (17%)

Query: 24  VSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQ 82
                +L N+A  I    Y+D +    TL++ + +   TP+  +L   R  W+ A   +Q
Sbjct: 37  FDRSAMLTNWADNIIIPGYQDFVAKVNTLEAQVASFTDTPS--DLTAVRAAWLDAYTTWQ 94

Query: 83  QSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNE 142
           +  ++  G          VN +P +                                   
Sbjct: 95  RVSMFEVGPAETVNLRLNVNIYPAN----------------------------------- 119

Query: 143 KEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIG 202
               ++ I  ++    +  +        G+  I++LL+G                   + 
Sbjct: 120 ----VATIEDNITAGSYNLDLSSNRAAKGFPAIDYLLYGLGEDDA-----------AILA 164

Query: 203 NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNS---IITGM 259
              G       +YL  +   + +    ++            +  D  +   S    +   
Sbjct: 165 IYNGTDGDAYKQYLLDIIADMKTLSTTVLNE-WEGDYRDTFIANDGASATASTDRFVNDY 223

Query: 260 TSLSYNELAGERMNLGLILHD----PEQEIDCFS-DNTYASYLNDVIGIISSYTGEYIRM 314
                  L   +M +   +      P      ++   +   ++  +      + G+    
Sbjct: 224 IFYFEKHLRAGKMGIPGGVFSGSVEPNNIEALYAGGISKDLFIVGLNATQDFFNGKAYNS 283

Query: 315 NGEKIHGASIHDLISHN--NRNLAQEINDKFSNTMKDFHILK--DRAENIESFDQMISEN 370
           + +    AS  D ++      +L++ IN +F  +      L   ++   I      ++  
Sbjct: 284 SAQGESLASYLDELNAIKDGADLSEIINSQFDVSRTVVSALGNFEQELAINPPTNFLNAY 343

Query: 371 NPEGNKIVRNLINDLITQTESLR 393
           +     +    ++ +   + S+ 
Sbjct: 344 DEVQRLVPLLKVDMVSAMSISID 366


>gi|284039379|ref|YP_003389309.1| peptidase M75, Imelysin [Spirosoma linguale DSM 74]
 gi|283818672|gb|ADB40510.1| Peptidase M75, Imelysin [Spirosoma linguale DSM 74]
          Length = 384

 Score =  140 bits (353), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 43/391 (10%), Positives = 107/391 (27%), Gaps = 71/391 (18%)

Query: 21  VPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
                 + +L N A  I    Y +       + +  +     P+  +L   R  W+ A  
Sbjct: 38  QAGSDRKAMLTNLADNIIVPSYTNFKTKFDAMLAKSDAFAAKPDNASLTALRQAWVDAYT 97

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKII 139
            +Q+ E++  G    +T     N +P +   I+                         I 
Sbjct: 98  EWQKVELFDVGPAEQNTLRNFFNIYPANVTGIE-----------------------EYIS 134

Query: 140 VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
                 D+ +  P                  G+  +++L+ G     +            
Sbjct: 135 AGSGTFDVPLSYPK----------------QGFPALDYLINGLGTTDDAIVARY------ 172

Query: 200 DIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD---LMKDINAGLNSII 256
                T     +R+ YLK ++  + +    +  AW   G           +     + ++
Sbjct: 173 ----TTAADAAKRIAYLKRLTGQMNTQFTTVYTAWTTGGYRDTFINCTALNAGCSTSKLV 228

Query: 257 TGMTSLSYNELAGERMNLGL-----ILHDPEQEIDCF-SDNTYASYLNDVIGIISSYTGE 310
            G        +   ++ +           P++    +  D +           +  + G+
Sbjct: 229 NGYVLNYERYIRSGKLGIPSGAMTNGTVAPDKVEAYYKKDLSLTLAKTAHQASVDFFNGK 288

Query: 311 YIRMNGEKIHGASIHDLISHNNRN-------LAQEINDKFSNTMKDFHILKDR--AENIE 361
            ++       G  +   ++            L   IN +F    +  + LK     E   
Sbjct: 289 SVK---TGQEGPGLKTYLNSLGAKDSSTGTSLVDIINKQFDAVNQQLNTLKPNLGDEVKT 345

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESL 392
           +   ++         +    ++     + ++
Sbjct: 346 NSTAVVLAYTQMQKAVRMLKVDMTTAMSITI 376


>gi|110636734|ref|YP_676941.1| hypothetical protein CHU_0310 [Cytophaga hutchinsonii ATCC 33406]
 gi|110279415|gb|ABG57601.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 377

 Score =  139 bits (349), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 54/412 (13%), Positives = 125/412 (30%), Gaps = 72/412 (17%)

Query: 1   MYFITIISIVFTLPSHALSIVPNV---SLEKVLQNYAT-IAHAKYEDALMCARTLDSAIE 56
           ++F  I+ +         + VP       E +L+N A  I         +    + +  +
Sbjct: 10  VFFSIILVLGSCGNKDKGTTVPEGNPSDREAMLKNVADNIVIPANAKFEIKLDNMIAKSD 69

Query: 57  TLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDS 116
                P    L   R+ W  A I +Q+  ++ FG       +  +N +P +         
Sbjct: 70  VFRNNPTVTTLSEYRIAWAEAYIEWQKIGIFDFGPAADVALNSYMNVYPAN--------- 120

Query: 117 SYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIE 176
                                         +S I+ ++L         ++    G+  I+
Sbjct: 121 ------------------------------VSNINANILSGNANLEVFESYSAQGFPAID 150

Query: 177 FLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP 236
           +L+ G     +          D      TG    +R  YL  ++  + +  E +  AW  
Sbjct: 151 YLINGSADTDD----------DIVALYVTGEDADKRKAYLLRLTNQMHAKFEAVNAAWKG 200

Query: 237 D--GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLG----LILHDPEQEIDCF-S 289
           D            +NA  + ++ G+       +   +  +                 +  
Sbjct: 201 DYRNTFVSSTGTGLNASTSVMVNGIVFYYERFIRSGKFGIPSGAMTGTPLNASVEAYYKK 260

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRN-------LAQEINDK 342
           D             +  + G+ +      I G S+   ++  +         L++ IN++
Sbjct: 261 DIGKILAQTAQQAFVDYFNGKGVT---TGIEGPSLKTYLNALDAKDATTKQPLSEIINNQ 317

Query: 343 FSNTMKDFHILKDRAENIESFDQ--MISENNPEGNKIVRNLINDLITQTESL 392
           F+      ++L D   N    ++  M++  N     +    ++     + ++
Sbjct: 318 FTVVDSKLNVLSDNLSNEVLTNKAAMVAVYNEMQKAVRMLKVDMTSALSVTI 369


>gi|332293593|ref|YP_004432202.1| Peptidase M75, Imelysin [Krokinobacter diaphorus 4H-3-7-5]
 gi|332171679|gb|AEE20934.1| Peptidase M75, Imelysin [Krokinobacter diaphorus 4H-3-7-5]
          Length = 373

 Score =  138 bits (347), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 50/391 (12%), Positives = 102/391 (26%), Gaps = 66/391 (16%)

Query: 16  HALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
                  N     +L N+A  I    Y D      TL+SA        +  +L   R  W
Sbjct: 29  SGTGNTGNFDRSAMLTNWADNIIVPGYVDFNAKVNTLESATAAFTA--DASDLTAVRAAW 86

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           + A   +Q+  ++  G          VN +P +   I+                  + I 
Sbjct: 87  LDAYTTWQRVSIFEIGPAETVNLRLNVNIYPANVTTIE------------------SNID 128

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNR 194
           N                                   G+  I++LL+G             
Sbjct: 129 NGSYD---------------------FGLSSNRSAKGFPAIDYLLYGLGADET------- 160

Query: 195 PYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNS 254
                 +    G       +YL  V   +      ++            +  D  +   S
Sbjct: 161 ----AILAVYNGAEGAAYKQYLNDVVADMKQLTVSVLSE-WQGSYRAAFIENDGASATAS 215

Query: 255 ---IITGMTSLSYNELAGERMNLGLILHDPEQE----IDCFSDN-TYASYLNDVIGIISS 306
               +          L   +M +   +     E       ++ N +   +L  +      
Sbjct: 216 TDRFVNDYIFYYEKFLRAGKMGIPGGVFSGNVEVGNLEALYAGNLSKELFLVGLDATQDF 275

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNR--NLAQEINDKFSNTMKDFHILK--DRAENIES 362
           + G+    N +    +S  D ++      +L + IN +F         L   +   +   
Sbjct: 276 FNGKAYNTNAQGESLSSYLDELNAIKDGVDLNEIINSQFDVARASVSALGSFESELSQNP 335

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLR 393
               +   N     +    ++ +   + S+ 
Sbjct: 336 PSTFLESYNEVQRLVPLLKVDMVSAMSISID 366


>gi|110637088|ref|YP_677295.1| hypothetical protein CHU_0668 [Cytophaga hutchinsonii ATCC 33406]
 gi|110279769|gb|ABG57955.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 378

 Score =  137 bits (344), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 55/413 (13%), Positives = 118/413 (28%), Gaps = 77/413 (18%)

Query: 8   SIVFTLPS-HALSIVPNVSLEKVLQNY-ATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           S+    PS    S +     + ++ N    +   +Y          DS ++     P  +
Sbjct: 14  SVCACKPSKDETSSLKTADRKPLVTNLGNNVILPRYVALNTSVNAFDSEVQIFTAAPTIE 73

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
           NL + R+++ +A I ++    + FG                                   
Sbjct: 74  NLTSLRIKFYQAYIDWEYVACFEFGPAA-------------------------------- 101

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
               A+ +      VN    D ++I   +++ +      ++ + +G+  I++LL+     
Sbjct: 102 ----ASTVNLGTKTVNAFPADTAVIKNKIVQGVTAIPPTNSAMYSGFPAIDYLLF----- 152

Query: 186 TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM 245
                  +                 +R  YLK VS  L + +      W   G     L 
Sbjct: 153 -----AKSLTAQQIVDSFTVSSTAVKRCNYLKTVSSDLKARINTTYTNWTASGANFISLY 207

Query: 246 KDIN----AGLNSIITGMTSLSYNELAGERMNLGL-----------ILHDPEQEIDCFSD 290
            +          S    M       +   ++ + L              +P +     SD
Sbjct: 208 TNSTGIDLGSATSQTVNMLVADVENIKNFKLGIPLNIIQNVVVGDGSTVNPFKCEGYHSD 267

Query: 291 NTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNN-RNLAQEINDKFSNTMKD 349
           ++       +  +   Y G  I  +G    G    + +   +   L  +I ++ +     
Sbjct: 268 SSLVLAKASIESLRKLYLG--IGADGTD--GEGFDNYLEAIDRSGLNVQIKNQIALLQAK 323

Query: 350 FHILKDRAENIESFDQMISENNPEGNKIVRNLI-NDLITQTESLRKIRIALDL 401
              +             I+  NP G + V       L         +  A+ +
Sbjct: 324 LDAIPAPIS--------IAIKNPAGKQAVNEAYTETLHLLVLLKVDMASAIGV 368


>gi|325269079|ref|ZP_08135700.1| imelysin superfamily protein [Prevotella multiformis DSM 16608]
 gi|324988700|gb|EGC20662.1| imelysin superfamily protein [Prevotella multiformis DSM 16608]
          Length = 417

 Score =  136 bits (343), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 62/387 (16%), Positives = 127/387 (32%), Gaps = 85/387 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQ-NYATIAHAKYEDALMCARTLDSAIETLVTT-PNKKNLEN 69
            + S  LS      L+ +L  N   + +  Y++       L +A+ TL     ++KN+++
Sbjct: 63  AIVSSQLSAEQKKELQNILNANVDNVIYPTYKELGDDVEALHAALGTLSEKEISQKNVDD 122

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           A   +++AR  +++SE +  G     + D  +++WPL+   +                  
Sbjct: 123 ACAAFLKAREQWERSEAFLMGPASDFSIDPHIDSWPLNRTALHA---------------- 166

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
                N    + ++ I                         G+H +EF+L+       V 
Sbjct: 167 --YFGNPTAEIKDESI------------------------LGFHALEFILFRNGKPRKVA 200

Query: 190 E-PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP------------ 236
           E  GN  Y +F     +       ++Y + V K L++ + E+  AW P            
Sbjct: 201 EFQGNDTYPNFTDIKGSDE-----LKYAEAVIKDLLNHVYELEVAWNPTNATRLAAVKAA 255

Query: 237 ------------------DGQATKDLMKDINAGLNSII---TGMTSLSYNELAGERMNLG 275
                              G A K     I+  +  ++    G      NE+   +++  
Sbjct: 256 NLKYQTEKGLSYGENMRSAGDAAKSTFASIDVAVTQVLSETEGSCLGIANEVGTAKISNP 315

Query: 276 LILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNL 335
               D       +S N+   + N++  I + + G     N       S H     N   +
Sbjct: 316 FQAGDISYVESPYSYNSITDFQNNIRSIENIWYGGRNGKNSN--AAYSFHKFFQSNKTAV 373

Query: 336 AQEINDKFSNTMKDFHILKDRAENIES 362
            +++       ++    +        S
Sbjct: 374 GRKVEAAIETAIQKIGRMPKPFVKYVS 400


>gi|260911711|ref|ZP_05918287.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260634136|gb|EEX52250.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 443

 Score =  136 bits (342), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 55/464 (11%), Positives = 125/464 (26%), Gaps = 107/464 (23%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQ----NYAT-IAHAKYEDALMCARTLDSAIETLV 59
           +I++  FT  S       NVS ++ L+     Y   +    Y +       L + I  L 
Sbjct: 15  SIMATGFTACSEEEPEPVNVSKDEALEALTKTYVNEVVTKTYTNLANETEVLFNQISALK 74

Query: 60  ------TTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDY 113
                     +K ++N    + RAR  +++SE + +G       D  ++ WPLD   +  
Sbjct: 75  KKSVAGEDITQKEVDNVCSTYKRARAHWEESEAWLYGPAGNFEIDPSIDTWPLDLNVL-- 132

Query: 114 VDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYH 173
                   N+   L   + +  +  I                     A     +   G+H
Sbjct: 133 ----AEDLNDAKKLAALSNVEGTAFI--------------------EAVNKLGDANKGFH 168

Query: 174 VIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKA 233
            IEF+ +                   +          + + +    +  L     ++  +
Sbjct: 169 GIEFVFFRDGQPRIATHFKKGAVETAEEFKANPVTGDKELVFATAAAAYLRDRCFQLEVS 228

Query: 234 WGPDGQATKDL----------------------------------------MKDINAGLN 253
           W  +  +   +                                               + 
Sbjct: 229 WLGNKASAAHVARVAECAKAYPEIFKTTVAATGLSFGENMLSAGKGEAKSNYATWRKVIE 288

Query: 254 SIITGMTSLSYNELAGERMNLGLILH------------------DPEQEIDCFSDNTYAS 295
            I+        +E+  ++M                         D       +S N++  
Sbjct: 289 DILVSGCINICDEVNDQKMGQAYRATTGQAKFHIDEKGNKVYDDDENYIESPYSYNSFID 348

Query: 296 YLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKD 355
           +  +++ I ++  G    +N      ASI   +   N  LA  +  K    +      + 
Sbjct: 349 FNGNIMSIQNALYG---NLNQTSYSSASIMAYLVKYNPELATNLQTKLKAALDQLQYCQQ 405

Query: 356 RAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
                              ++ V+  ++ +   ++ L +    +
Sbjct: 406 NIHPFVKNR---------SHQQVKIAMDKIEELSKVLNEANSWI 440


>gi|327313692|ref|YP_004329129.1| imelysin [Prevotella denticola F0289]
 gi|326945703|gb|AEA21588.1| imelysin [Prevotella denticola F0289]
          Length = 415

 Score =  135 bits (340), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 62/387 (16%), Positives = 127/387 (32%), Gaps = 85/387 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQ-NYATIAHAKYEDALMCARTLDSAIETLVT-TPNKKNLEN 69
            + S  LS      L+ +L  N   + +  Y++       L +A+ TL     ++KN+++
Sbjct: 61  AIVSSQLSAEQKKELQNILNANVDNVIYPTYKELGDDVEALHAALGTLSEKQISQKNVDD 120

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           A   +++AR  +++SE +  G     + D  +++WPL+   +                  
Sbjct: 121 ACAAFLKAREQWEKSEAFLMGPASDFSIDPHIDSWPLNRTALHA---------------- 164

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
                N    + ++ I                         G+H +EF+L+       V 
Sbjct: 165 --YFGNPTAEIKDESI------------------------LGFHALEFILFRNGKPRKVA 198

Query: 190 E-PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP------------ 236
           E  GN  Y +F     +       ++Y + V K L++ + E+  AW P            
Sbjct: 199 EFQGNDTYPNFTDIKGSDE-----LKYAEAVIKDLLNHVYELEVAWNPTNATRLAAVKAA 253

Query: 237 ------------------DGQATKDLMKDINAGLNSII---TGMTSLSYNELAGERMNLG 275
                              G A K     I+  +  ++    G      NE+   +++  
Sbjct: 254 NLKYQTEKGFSYGENMRSAGDAAKSTFASIDVAVTQVLSETEGSCLGIANEVGTAKISNP 313

Query: 276 LILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNL 335
               D       +S N+   + N++  I + + G     N       S H     N   +
Sbjct: 314 FQAGDISYVESPYSYNSITDFQNNIRSIENIWYGGRNGKNSN--AAYSFHKFFQSNKTAV 371

Query: 336 AQEINDKFSNTMKDFHILKDRAENIES 362
            +++       ++    +        S
Sbjct: 372 GRKVEAAIETAIQKIGRMPKPFVKYVS 398


>gi|325860541|ref|ZP_08173645.1| imelysin [Prevotella denticola CRIS 18C-A]
 gi|325481926|gb|EGC84955.1| imelysin [Prevotella denticola CRIS 18C-A]
          Length = 417

 Score =  135 bits (340), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 60/387 (15%), Positives = 125/387 (32%), Gaps = 85/387 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQ-NYATIAHAKYEDALMCARTLDSAIETLVT-TPNKKNLEN 69
            + S  LS      L+ +L  N   + +  Y++       L +A+ TL     ++KN+++
Sbjct: 63  AIVSSQLSAEQKKELQNILNANVDNVIYPTYKELGDDVEALHAALGTLSEKQISQKNVDD 122

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           A   +++AR  +++SE +  G     + D  +++WPL+   +                  
Sbjct: 123 ACAAFLKAREQWEKSEAFLMGPASDFSIDPHIDSWPLNRTALHA---------------- 166

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
                N    + ++ I                         G+H +EF+L+       V 
Sbjct: 167 --YFGNPTAEIKDESI------------------------LGFHALEFILFRNGKPRKVA 200

Query: 190 E-PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT------- 241
           E  GN  Y +F     +       ++Y + V K L++ + E+  AW P            
Sbjct: 201 EFQGNDTYPNFTDIKGSDE-----LKYAEAVIKDLLNHVYELEVAWNPTNATRLAAVKAA 255

Query: 242 -----------------------KDLMKDINAGLNSII---TGMTSLSYNELAGERMNLG 275
                                  K     I+  +  ++    G      NE+   +++  
Sbjct: 256 DLKYQTEKGFSYGENMRSVGDAAKSTFASIDVAVTQVLSETEGSCLGIANEVGTAKISNP 315

Query: 276 LILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNL 335
               D       +S N+   + N++  I + + G     N       S H     N   +
Sbjct: 316 FQAGDISYVESPYSYNSITDFQNNIRSIENIWYGGRNGKNSN--AAYSFHKFFQSNKTAV 373

Query: 336 AQEINDKFSNTMKDFHILKDRAENIES 362
            +++       ++    +        S
Sbjct: 374 GRKVEATIETAIQKIGRMPKPFVKYVS 400


>gi|304382772|ref|ZP_07365256.1| imelysin superfamily protein [Prevotella marshii DSM 16973]
 gi|304336091|gb|EFM02337.1| imelysin superfamily protein [Prevotella marshii DSM 16973]
          Length = 448

 Score =  133 bits (333), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 59/475 (12%), Positives = 134/475 (28%), Gaps = 116/475 (24%)

Query: 3   FITIISIVFTLPSHALSIVP----------NVSLEKVLQNYAT-IAHAKYEDALMCARTL 51
            +  ++  FT+   + S             N  L+ +   Y   +    Y +    A  L
Sbjct: 9   LLLAVAGAFTVSFTSCSEDNDNSAERRKVQNEELQSLTTRYVNEVVFPTYTNLANEADNL 68

Query: 52  DSAIETLVTTPNKKN------LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWP 105
              I  L T            ++     +  AR  +++SE + +G       D  ++ WP
Sbjct: 69  YKKIAELKTKVKAGTTVTQSEIDAICTNYKVARSHWEESEAWLYGAASDFDIDPNIDTWP 128

Query: 106 LDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGID 165
           L    +     +  K  + +N      IA                   ++  +   N   
Sbjct: 129 LVVPTLASDLQNNTKMAKLDNQSDLGYIA-------------------VITDMAEEN--- 166

Query: 166 TNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCT------GGHCRRRVEYLKVV 219
                G+H IEF+ +      NV    +     F   + +          +  + +    
Sbjct: 167 ----RGFHGIEFIFFRDGKNRNVTFFNDGSKETFKEKDGSQPFAGKNVTAKEELIFATAA 222

Query: 220 SKILVSDLEEMMKAWGPDGQAT-------------------------------------- 241
           +  L   + ++  AW  D                                          
Sbjct: 223 AAYLRDRVYQLEVAWRGDNATPAHKTRLDACKAAYPDIFKVTVGNSNLSYGANMLAANTG 282

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILH-----------------DPEQE 284
               +     + +I+    S   +E+A ++M                        DP   
Sbjct: 283 TSTYQTWRKAVEAILVAGCSNICSEVANQKMGQAYRSAIGKPETHKDENGNDVVDDPNYI 342

Query: 285 IDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFS 344
              +S N++  +  +++ I ++  G    +N +K    SI   +   N  +A  + +K +
Sbjct: 343 ESPYSYNSFTDFYGNIMSIQNALYG---NLNKDKYESNSIIAYLQKYNSEMANNLQNKLT 399

Query: 345 NTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
             +      ++   +              G   V+  ++ +    ++L +    +
Sbjct: 400 AALDALKACQNSGTSFVK---------DPGATYVKTAMDKIGDLDKALNESANWI 445


>gi|300728287|ref|ZP_07061655.1| putative lipoprotein [Prevotella bryantii B14]
 gi|299774522|gb|EFI71146.1| putative lipoprotein [Prevotella bryantii B14]
          Length = 434

 Score =  133 bits (333), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 64/459 (13%), Positives = 133/459 (28%), Gaps = 103/459 (22%)

Query: 3   FITIISIVFTLPSHALSIVPNVS----------LEKVLQNYAT-IAHAKYEDALMCARTL 51
               ++ V  L   + S   + +          +  ++ NY   I    Y D     +TL
Sbjct: 9   LAFAMASVLALGVTSCSSDDDTNGNGSSNTSTVMSSIVANYVDNIVRPTYSDLAENTQTL 68

Query: 52  DSAIETLVTTPNKKNL-----ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPL 106
             A + L T      L     + A   +  AR  ++QSE + +G    +  D  +++WPL
Sbjct: 69  YDACQNLYTKRKAGTLTQSDIDAACEAFKNARKYWEQSESFLYGAATDNDIDPHIDSWPL 128

Query: 107 DEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDT 166
           D   +               L  A+IIA               I+     K       D 
Sbjct: 129 DHSQL------------VEALNNASIIAG--------------INGSQPDKYVYEQNKDF 162

Query: 167 NITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSD 226
               G+H +EF+L+       +         + + G  T         +   +S  L  +
Sbjct: 163 GSVLGFHGLEFILFRNGANRTLAAL--TADYETETGLTTVKTLD-ECAFAAAISGDL-RN 218

Query: 227 LEEMMKAWGPDGQATKDLMK---------------------------------------D 247
           +  ++        A+  ++                                         
Sbjct: 219 MTSLLAYGWIGSSASSSILNVINTASWVVEGTRFAGLTSKGVSYGEAVIGATTSVGLFTT 278

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLILHD--------PEQEIDCFSDNTYASYLND 299
               L++I  G  S    E+  +++     +           +     +S  ++  Y ++
Sbjct: 279 WQETLSNIYVGGCSKICQEVYTQKLGQAYRVATGQGEAEDAADYIESPYSKRSFQDYQDN 338

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
           +  I  S  G     N       S+   + + N +  + +N   +  +      K+  + 
Sbjct: 339 IYSIKHSLYGNRDD-NSSTPESNSLMAFMKNKNYSGYETLNTALNEAIASLETAKNSGKA 397

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIA 398
                      +  G+  V+  I+ +    E+L      
Sbjct: 398 FI---------DAPGDAQVKTCIDKIQALDEALNSAGAW 427


>gi|152996578|ref|YP_001341413.1| periplasmic lipoprotein-like protein [Marinomonas sp. MWYL1]
 gi|150837502|gb|ABR71478.1| periplasmic lipoprotein-like protein [Marinomonas sp. MWYL1]
          Length = 352

 Score =  132 bits (331), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 49/398 (12%), Positives = 107/398 (26%), Gaps = 73/398 (18%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  ++I  + P    +      L  ++ N   +    YE     ++TL    + L  +P+
Sbjct: 7   LIALAISASAPMLTFAGQWEGPLNGIVTN---VVKQGYESYSKSSKTLQQNTKALCASPS 63

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           K+ L +A+  +    + +QQ +   FG             WP  +G       +      
Sbjct: 64  KETLHDAQDAFQTNALDWQQVQWLNFGPVTYFMRYYAFEYWPDKKGVTQRQLRALA---- 119

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                            +   +D                   +    G   IE LL+  D
Sbjct: 120 ---------------QGDPAVMDAPKFWTSA-----------SIAVRGLTAIESLLYHPD 153

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
            +                              L+ V+   +   + + K    +G A   
Sbjct: 154 FEPTQSAE--------------------HCRLLEKVTAHHLESADAVAKQ-WQNGTAQDW 192

Query: 244 LMKDINAGLNSIITGMTSLSYNE------LAGERMNLGLILHDPEQ---EIDCFSDNTYA 294
           +  +   G +     +             +   ++   +  +  E         SD +  
Sbjct: 193 VFDEEGTGFDPEKVALELFLQQWIEHMSAVKDAKLETPIGYNSRENLKLAEFYRSDLSLR 252

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
           S   ++      Y               S++D+    N  LA++   + +  +K    L 
Sbjct: 253 SIQKNLQSYREIYHAGS----------PSLYDIAKQKNPELAEQFEVQLTQNIKLALQLP 302

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESL 392
               +     +          K + N  + L +    L
Sbjct: 303 SDFFHANHTQEDRIALAKPLVKSISNSQSYLASIVTQL 340


>gi|226945832|ref|YP_002800905.1| hypothetical protein Avin_37860 [Azotobacter vinelandii DJ]
 gi|226720759|gb|ACO79930.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 354

 Score =  131 bits (329), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/379 (12%), Positives = 107/379 (28%), Gaps = 79/379 (20%)

Query: 36  IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD 95
           +    Y       R L ++  +       ++L+ AR  ++ A+  +   +   FG     
Sbjct: 36  VLLPAYSGWAEADRQLAASALSFCA--GNEDLQQARQIFLTAQNSWAALQPLLFGPLAEG 93

Query: 96  TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLL 155
               +V  WP  +  +                            V         ++   L
Sbjct: 94  NLAWQVQFWPDKKNLV-------------------------ARQVENLLQQKPQLTQADL 128

Query: 156 RKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEY 215
            +        + +  G    E+LL+   L                          R    
Sbjct: 129 EQA-------SVVVKGLSAYEYLLFDNGLDLTDATQRQ-----------------RYCPL 164

Query: 216 LKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAG-----E 270
           L  + K   +   E+++ W  D      L +  N+        +  +   E+       +
Sbjct: 165 LTAIGKHQQTLSAEILQQWQGDAGMAVHLKRFPNSRYADAKEAIGEILRAEVTALDVLKK 224

Query: 271 RMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           ++   L      +  P Q     S +T ++    +      + G              I 
Sbjct: 225 KLGTPLGRQSKGVPQPLQAESWRSQSTLSNLAASLATAERLWLGVKQD---------GIR 275

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
           +L+  +   LAQ ++  F ++      L+        FD++++  +  G   +  L +  
Sbjct: 276 NLLDEDQAELAQRLDRAFGDSRGRLAALQ------RPFDELLA--DKAGRDQLNALYDSF 327

Query: 386 ITQTESLRK-IRIALDLIE 403
                   + +  ALD+  
Sbjct: 328 DRLHRLHERELAKALDIQL 346


>gi|108761823|ref|YP_633180.1| hypothetical protein MXAN_5025 [Myxococcus xanthus DK 1622]
 gi|108465703|gb|ABF90888.1| hypothetical protein MXAN_5025 [Myxococcus xanthus DK 1622]
          Length = 438

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 62/421 (14%), Positives = 131/421 (31%), Gaps = 73/421 (17%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
             +         +   +L++          +    A  L+SA+     TP+    + AR 
Sbjct: 66  AGTDNPGDTVAATRAALLESSGACVLQTAREFQTAATALESAVAAHAATPDATTRDTARE 125

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTW------DKKVNAWPLDEGFIDYVDSSYGKENEENN 126
            + +A   +Q +EV +FG     +          + +WPL       V     +E   N 
Sbjct: 126 AYHQAMDVWQMAEVMQFGPAAPRSLPGGAEIRDNIYSWPL-------VSRCAIEEQLVNR 178

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
            Y +                              +         G + +E+LL+ +   T
Sbjct: 179 SYES-----------------------------ESFDSSLVSRRGLYALEYLLFFEGNDT 209

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
                                   R+  Y  VV+  +    + ++ AW PD +     + 
Sbjct: 210 ACPGTSVIVSQGTWAALSADERAARKRAYAAVVAADVHRRADALVNAWAPDQENFGRTLT 269

Query: 247 DINAGLNSI---------ITGMTSLSYNELAGERMNLGLILHD------PEQEIDCFSDN 291
              +G             ++        E+   ++   L L D      PE     F+  
Sbjct: 270 TAGSGNAVYPSTQAALNSVSDAIFYFEREVKDLKVARPLALRDCATSTCPEHLESQFAAR 329

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRN-LAQEINDKFSNTMKDF 350
           + A+   +++G      G      GE   G    DL+  +  + LA ++ ++ +      
Sbjct: 330 SKANIRANLVGYRRITEGC-----GENFSGTGFDDLLEASGADALAAKLRERNAAAAAGI 384

Query: 351 HILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIEPNRVIG 409
             +           + ++    +    +R + + + + T+ L+ ++   LDL  P  V G
Sbjct: 385 DAVPG---------EDLATVLAQDKAAMRTMYDVIKSVTDVLKTELVTVLDLELPQSVEG 435

Query: 410 N 410
           +
Sbjct: 436 D 436


>gi|149377145|ref|ZP_01894894.1| predicted periplasmic lipoprotein [Marinobacter algicola DG893]
 gi|149358563|gb|EDM47036.1| predicted periplasmic lipoprotein [Marinobacter algicola DG893]
          Length = 347

 Score =  130 bits (325), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 51/410 (12%), Positives = 116/410 (28%), Gaps = 78/410 (19%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           I+ +   P   ++     +     Q +       Y+     A  L +A     + P + +
Sbjct: 10  IAALILAPISGMAGSQPETNNNAEQQWHQGILKGYQSLAAEAGDLSAAAADYCSAPEQAS 69

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
            +     W+ A + +Q+     FG    D    +   WP  +  I               
Sbjct: 70  RDALEQAWLNAFLAWQRVRYVDFGPVESDNLAWQFQFWPDPKNLI--------------- 114

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
                                S +                    G+ ++E+LL+ + L  
Sbjct: 115 -----------------ARKASYLLDSEAPVSSEVITESGVAVQGFPMLEYLLYDEALNA 157

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
           +                       +    L+ V+  + ++ +++   W       +  + 
Sbjct: 158 SNNALP----------------AEKTCGLLRAVAGHIEANGKQLRDQWQ---AFREHYLA 198

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEI---DCFSDNTYASYLNDVIGI 303
                  SI  GM +L   E       +GL  +            S ++  +    + G+
Sbjct: 199 TEQYRDTSIRAGMAALEILEDRRLAQPMGLRGNGKRSVYAADAWRSGSSLRTIEATIHGL 258

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNN-RNLAQEINDKFSNTMKDFHILKDRAENIES 362
             S+                +  L+  ++   L   I ++F + ++ F  L      + S
Sbjct: 259 EQSFL-------------PGLTRLLKESDQPELGPRIENQFKDVLEHFPELHRPMAELLS 305

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALD-LIEPNRVIGN 410
            D   S        +++    D+   T  +  +  + L  +   N   G+
Sbjct: 306 NDDAFS--------LLQGFYVDVSQLTTLINDQAAVELGVIRGFNSSDGD 347


>gi|163743024|ref|ZP_02150407.1| hypothetical protein RG210_02122 [Phaeobacter gallaeciensis 2.10]
 gi|161383707|gb|EDQ08093.1| hypothetical protein RG210_02122 [Phaeobacter gallaeciensis 2.10]
          Length = 372

 Score =  130 bits (325), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 50/411 (12%), Positives = 110/411 (26%), Gaps = 98/411 (23%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           T  + V    +   ++ P   L+ +L ++       ++     + TL     +   TP+ 
Sbjct: 38  TDTTAVSAPNTPPQTLAPAHQLDWILTHH---ILPGFDRLAQTSATLAEVAASHC-TPDD 93

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
                 R  +  A   +      RFG    D     +  WP     I         E   
Sbjct: 94  P---ALRAAFTHAFDAWITVSHLRFGPTETDNRAFALAFWPDSRNKIPGTLRRAVTETPR 150

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
             L T  + A+                              +    G++ +E+LL+    
Sbjct: 151 EELATPEVFASQ-----------------------------SVALRGFYALEYLLFDD-- 179

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG--------- 235
                               + G   +R   +  ++  +      +   W          
Sbjct: 180 -----------------AIQSEGSADQRCTLVAAITTDIAHTTAAIRDDWHNSYAVTLVS 222

Query: 236 -PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLI---LHDPEQEIDCFSDN 291
              G   +   +       ++ TG   L        R+   L       P +     S  
Sbjct: 223 PGPGNRYQSEAEIRQELFKTLTTGFQVLV-----DMRLGRPLGQFDAPRPNRAEARRSAR 277

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH 351
           +    + ++  +                    +   ++  +  L QEI+  F+  +K  +
Sbjct: 278 SQRHIMLNLTAME------------------PLALALAAGDPALMQEIDAGFAKALKRAN 319

Query: 352 ILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
            L D +    +             + ++  INDL +   +  ++   L + 
Sbjct: 320 ALDDPSLAGVA-----DPARRFRIEALQQDINDLRSLITT--RLGPKLGVT 363


>gi|327481863|gb|AEA85173.1| putative lipoprotein [Pseudomonas stutzeri DSM 4166]
          Length = 378

 Score =  129 bits (323), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/409 (12%), Positives = 109/409 (26%), Gaps = 84/409 (20%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +T + +    P+   +       + VL          Y       R L ++        
Sbjct: 34  LLTALLLSACTPADPQAETSKALTDGVL-------LPAYTHWAETDRRLAASAIAYCA-- 84

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + + LE AR  ++ A+  +   +    G         +V  WP  +  +           
Sbjct: 85  DNQTLEEAREAFVHAQTAWAGLQPLLIGPMGEGNLAWQVQFWPDKKNLV----------- 133

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                                   ++ +               + +  G    E++L+ +
Sbjct: 134 ---------------------ARQVTALLGAKPNLTQADLDGASVVVQGLSAYEYVLFDK 172

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
            +                          R    L  + +        +++ W        
Sbjct: 173 TIDLGDSATK-----------------ARYCPLLTSIGEHQQQLAAGVLQQWEDKDGMAD 215

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLIL-----HDPEQEIDCFSDNT 292
            L    N         +  L   ++       +++   L         P Q     SD T
Sbjct: 216 QLRSFPNERYAEPSEAIAELLRVQVTALDGLKKKLGAPLGRQTKGHPQPYQAEGWRSDTT 275

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHI 352
            AS    V G  S + G              +  L+     +LAQ I+  ++  ++    
Sbjct: 276 LASIAAAVKGAESLWLGADNN---------GLRSLLPAEQADLAQRIDAAYAQLLQHLGG 326

Query: 353 LKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           L      + + +Q  SE +      +   I+ L    +  +++  AL +
Sbjct: 327 LTQPFGALLADEQGRSELDA-----LYQGIDRLHRLHQ--QELARALGV 368


>gi|162454166|ref|YP_001616533.1| putative Iron-regulated protein A precursor [Sorangium cellulosum
           'So ce 56']
 gi|161164748|emb|CAN96053.1| Putative Iron-regulated protein A precursor [Sorangium cellulosum
           'So ce 56']
          Length = 482

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 63/423 (14%), Positives = 126/423 (29%), Gaps = 78/423 (18%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
            P   ++  P  S  K++   A  A  +  +    AR L  +   L   P + +   AR 
Sbjct: 111 CPPVPVAEGP-FSKAKLITAAADCALNRACEFEAQARALHESAAALARGPGEPSAAAARG 169

Query: 73  QWIRARIPYQQSEVYRFGNKIVD------TWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
            W+ A   +Q+ E++RFG               ++ +WPL       ++           
Sbjct: 170 AWLAAVAVWQEVELFRFGPAASSTQPGGQDLRDQIYSWPLVSRC--KIEEQIVSRAYAQP 227

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
            +++++I                                     G   +E+L +      
Sbjct: 228 SFSSSLING----------------------------------RGLAALEYLAFYGGGDN 253

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT----- 241
              +      +        G   +R+ +Y    +  +++    + +AW P+  +      
Sbjct: 254 ACSQYSPINASRTWAALGAGELAQRKADYAAAAAADVLAQAGALARAWAPEAGSFRQKLI 313

Query: 242 -----KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHD-------PEQEIDCFS 289
                  +       LN++   M      EL   ++   L   +       PE     F+
Sbjct: 314 QAGQGSPVFATEQDALNAVSDAM-FYVEKELKDWKLGRPLGFTEDCVTPTCPEALESRFA 372

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNN-RNLAQEINDKFSNTMK 348
             + A    ++ G    +        GE   G    D +   +  +LA  +    S    
Sbjct: 373 LASAAHIRANLRGFRRLFQ-----GCGEGGQGVGFDDWLRAVDSADLADRMLQALSEAQS 427

Query: 349 DFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIEPNRV 407
               L    E   S D             V ++   +   T+ L+ +   AL+L  P   
Sbjct: 428 AVDALDLPLEQALSTD----------RAKVESVYTAVKALTDLLKTEFVSALNLELPQSS 477

Query: 408 IGN 410
            G+
Sbjct: 478 EGD 480


>gi|146283466|ref|YP_001173619.1| putative lipoprotein [Pseudomonas stutzeri A1501]
 gi|145571671|gb|ABP80777.1| lipoprotein, putative [Pseudomonas stutzeri A1501]
          Length = 358

 Score =  127 bits (318), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 50/410 (12%), Positives = 107/410 (26%), Gaps = 86/410 (20%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +T + +    P+   +       + VL          Y       R L ++        
Sbjct: 14  LLTALLLSACTPADPQAETSKALTDGVL-------LPAYTHWAETDRRLAASAIAYCA-- 64

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           + + LE AR  ++ A+  +   +    G         +V  WP  +  +           
Sbjct: 65  DNQTLEEAREAFVHAQTAWAGLQPLLIGPMGEGNLAWQVQFWPDKKNLV----------- 113

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                                   ++ +               + +  G    E++L+ +
Sbjct: 114 ---------------------ARQVTALLGAKPNLTQADLDGASVVVQGLSAYEYVLFDK 152

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
            +                          R    L  + +        +++ W        
Sbjct: 153 TIDLGDSATK-----------------ARYCPLLTSIGEHQQQLAAGVLQQWEDKDGMAD 195

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLIL-----HDPEQEIDCFSDNT 292
            L    N         +  L   ++       +++   L         P Q     SD T
Sbjct: 196 QLRSFPNERYAEPSEAIAELLRVQVTALDGLKKKLGAPLGRQTKGHPQPYQAEGWRSDTT 255

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHI 352
            AS    V G  S + G              +  L+     +LAQ I+  ++       +
Sbjct: 256 LASIAAAVKGAESLWLGADNN---------GLRSLLPAEQADLAQRIDAAYA------QL 300

Query: 353 LKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDL 401
           L+ R    + F   +   + +G   +  L   L        +++  AL +
Sbjct: 301 LQHRGGLTQPFGAQLE--DEQGRSELDALYQGLDRLHRLHQQELARALGV 348


>gi|126725744|ref|ZP_01741586.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2150]
 gi|126704948|gb|EBA04039.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2150]
          Length = 171

 Score =  127 bits (318), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 103/165 (62%), Gaps = 5/165 (3%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           +++   +I   L + AL+    V    VL  YA IA A Y D+L+ A+ L +A+  LV  
Sbjct: 3   HYLLTTAIAVGLATPALA----VETTDVLDTYADIAAANYGDSLITAQRLQTAVNALVAD 58

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
           P+ +NL  AR  W+ AR+PYQQ+EV+RFGN IVD W+ KVNAWPLDEG IDYVD+SYG  
Sbjct: 59  PSAENLTAARAAWLAARVPYQQTEVFRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYGGP 118

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRK-LHRANGID 165
           ++EN     N+IAN    ++ ++ID + I+P LL   L  A+   
Sbjct: 119 SDENAFAALNVIANPTFTLSGQDIDATSITPALLEDTLQEADETP 163


>gi|294675425|ref|YP_003576041.1| lipoprotein [Prevotella ruminicola 23]
 gi|294472655|gb|ADE82044.1| putative lipoprotein [Prevotella ruminicola 23]
          Length = 444

 Score =  127 bits (318), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 51/390 (13%), Positives = 113/390 (28%), Gaps = 90/390 (23%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETL-VTTPNKKNLEN 69
           T+ +  LS      L KVL+     +    Y         L+  +  L V +  +  ++ 
Sbjct: 83  TIATAKLSEAQEAYLRKVLETLVGNVIVPTYTQLADDVEDLEKTLNGLTVNSITQAQIDK 142

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           A   + +AR  +++SE +  G       D  +++WPL+   +                  
Sbjct: 143 ACADFKQARQNWERSEAFLMGAASDFDIDPTIDSWPLNRSLL------------------ 184

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
            N   N                             +     G+H +EF+L+       V 
Sbjct: 185 LNYFNNGMNDEML----------------------EDATILGFHALEFILFRNGQNRKVA 222

Query: 190 E-PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG---------- 238
           E  GN  YT+F+          + + Y + +  +L     ++  AW  +           
Sbjct: 223 ELQGNDTYTNFEKI-----TGAQELAYAQTICTLLKQRCFQLQVAWEGETAANAARVAVV 277

Query: 239 ------------------------QATKDLMKDINAGLNSII---TGMTSLSYNELAGER 271
                                     +K     +   +  ++    G      NE+   +
Sbjct: 278 KAAGLDMTTAAGLSYGENLKQAGVSGSKSTFPTLKDAIAQVLINDEGSCLAICNEVGTAK 337

Query: 272 MNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH- 330
           +       D       +S N+   + +++  I + + G       +K +  S H   +  
Sbjct: 338 IANPFSAGDIAYVESPYSYNSITDFRDNIRSIRNVWLGS----TDKKANEYSFHTFFASV 393

Query: 331 NNRNLAQEINDKFSNTMKDFHILKDRAENI 360
            +  +   +   +   ++    +       
Sbjct: 394 KSDKVNTAVESNYVGAIEGISNMPTPFVKY 423


>gi|313497278|gb|ADR58644.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 354

 Score =  126 bits (317), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 50/411 (12%), Positives = 124/411 (30%), Gaps = 86/411 (20%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++    P    ++       +V           Y   +   RTL ++         
Sbjct: 11  LAALALGACSPQDPQAVTSAAIANQV-------ILPTYSRWVEADRTLAASALAYCE--G 61

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           K++LE AR  ++ A+  + + +    G         +V  WP  +  +            
Sbjct: 62  KESLEKARTDFLNAQKAWAELQPLLVGPLAEGNRAWQVQFWPDKKNLV------------ 109

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                        +++  +K +D                G  + +  G    E++L+   
Sbjct: 110 --------GRQVEQLVNGDKPVDA------------EVLGKSSVVVRGLSAYEYILF--- 146

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                         D      T     R    L  +     +  EE++K W         
Sbjct: 147 --------------DSKPDIATAEQKARYCPLLVAIGAHQKALAEEILKGWNSTDGMLSQ 192

Query: 244 LMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTY 293
           + K  N         +  L   ++       +++   +      +  P Q     S N+ 
Sbjct: 193 MTKFPNQRYADSHEAIADLLRAQVTALDTLKKKLGAPMGRQSKGIPQPLQAEAWRSHNSM 252

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
            S    +    + + G         +    +  L+  + + LA +I+  ++ ++K     
Sbjct: 253 NSLQASLKAAEAVWVG---------VDNQGLRGLLPSDQKALADKIDAAYATSLKLL--- 300

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
              A+N ++  ++++  +  G + +  + + L          +  AL++  
Sbjct: 301 ---ADNQKTLGELLA--DDAGQQTLNQIYDSLNVVHRLHEGDLAKALNIQL 346


>gi|124007533|ref|ZP_01692238.1| lipoprotein, putative [Microscilla marina ATCC 23134]
 gi|123987016|gb|EAY26772.1| lipoprotein, putative [Microscilla marina ATCC 23134]
          Length = 365

 Score =  126 bits (317), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 55/405 (13%), Positives = 119/405 (29%), Gaps = 75/405 (18%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +Y   ++ ++  +     S    + LE V  N   I   +         TL  A +   T
Sbjct: 7   LYIYCLLGLLGCIKQEQESYNRQLILENVGNN---IIVPQLNALQQEMSTLVKAAQAFET 63

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
               +NL+  R  W  A + +++   + FG   +     K++  P     I+ V      
Sbjct: 64  ETTAENLQLVRNAWQAATLQWERCAFFNFGPIKMQETSLKIDFNPARTHIIESVLGDADI 123

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
              +  + T                                         G+  IEFLL+
Sbjct: 124 TLNQAYMATLG-----------------------------------AAAKGFPTIEFLLF 148

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
                        +          T     RR  Y++  ++ +   +  + + W  +G  
Sbjct: 149 D----------REKTLEQMLALFTTDAQAIRRKAYVRAAAQNIEVQVTAVAQEWANNGGN 198

Query: 241 TKDLM----KDINAGLNSIITGMTSLSYNELAGERMNLGL------ILHDPEQEIDCFSD 290
                    +  N  +N++   M   +   +A  ++   L          PE+     S 
Sbjct: 199 YLQTFIKNSQGGNDAVNTLANKMIETAEI-VANTKLGAPLGVQLKDGTPQPEKTEAWRSK 257

Query: 291 NTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH-----NNRNLAQEINDKFSN 345
            + A  + ++  +   + G+          G    D ++      + ++LA  I    + 
Sbjct: 258 TSLAHLVANLDMMTMVFKGD---------SGDGFDDYLNALKASGSGQSLANSIVAHIAK 308

Query: 346 TMKDFHILKDRAENIESFDQMI--SENNPEGNKIVRNLINDLITQ 388
           T +    ++       S DQ    +        +V   ++ +   
Sbjct: 309 TKEAVLAIQPTLYEAVSADQTQTKAAYALARELVVLIKVDMMNAL 353


>gi|89092300|ref|ZP_01165254.1| hypothetical protein MED92_05793 [Oceanospirillum sp. MED92]
 gi|89083388|gb|EAR62606.1| hypothetical protein MED92_05793 [Oceanospirillum sp. MED92]
          Length = 361

 Score =  126 bits (317), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 53/422 (12%), Positives = 123/422 (29%), Gaps = 88/422 (20%)

Query: 1   MYFIT-IISIVFTLPSHALSIVPNVSLEKVLQNYATI--------AHAKYEDALMCARTL 51
           M  +T   +++  L S A+SI  + ++ +  + +  +            Y+     +  L
Sbjct: 1   MSLLTNSKTLIIGLASAAISIQAHGTVSQ--EQWRDLNMSIVNGHILPAYQALSESSTAL 58

Query: 52  DSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFI 111
           +    +L   P    L+ A+ Q+      +Q ++   FG   +      +  WP  +   
Sbjct: 59  EENTLSLCKDPQTATLDAAKTQFRATLSAWQGAQHITFGPIELLMRSYSIQFWPDKKNL- 117

Query: 112 DYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTG 171
                                  + ++    +  D   +S    +         +    G
Sbjct: 118 ----------------------TSKQLNKILQAEDPGSLSEKAFQTA-------SIAVKG 148

Query: 172 YHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMM 231
              +E +L+ ++                            R ++L  VS  +        
Sbjct: 149 LPAMERILFAEN------------------ALELIQTNPFRCQFLHAVSDYVKLQSRNTY 190

Query: 232 KAWGPDGQATKD------LMKDINAGLNSIITGMTSLSYNELAGERMNLGLI--LHDPEQ 283
             W               L +        ++          +   ++   L      P +
Sbjct: 191 NEWNAFKDEFAHLESEEGLYETAQEASIDLMKAQIEPLEV-IRDLKILRPLAKSTAKPRR 249

Query: 284 EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR-NLAQEINDK 342
                S+++  +   ++  +   Y+G         + GA++  L+      +LAQ I ++
Sbjct: 250 LESWRSNHSLQNMQLNIQSLHHMYSG---------VAGANLKALLEEQGAIDLAQGIEEQ 300

Query: 343 FSNTMKDFHILKDRAENIESFDQMISENN-PEGNKIVRNLINDLITQTESLRKIRIALDL 401
           F    K  + +           Q I + +  E   +V   I  L    +S  +    LD+
Sbjct: 301 FVGLEKILNDIPTPLH------QHIKDVSVREKLLLVSEGIELL---GKSFAQAMKLLDV 351

Query: 402 IE 403
             
Sbjct: 352 QL 353


>gi|26987645|ref|NP_743070.1| hypothetical protein PP_0909 [Pseudomonas putida KT2440]
 gi|24982327|gb|AAN66534.1|AE016282_2 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 354

 Score =  126 bits (316), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 50/411 (12%), Positives = 125/411 (30%), Gaps = 86/411 (20%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++    P    ++       +V           Y   +   RTL ++         
Sbjct: 11  LAALALGACSPQDPQAVTSAAIANQV-------ILPTYSRWVEADRTLAASALAYCE--G 61

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           K++L+ AR  ++ A+  + + +    G         +V  WP  +  +            
Sbjct: 62  KESLDKARADFLNAQKAWAELQPLLVGPLAEGNRAWQVQFWPDKKNLV------------ 109

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                        +++  +K +D              A G  + +  G    E++L+   
Sbjct: 110 --------GRQVEQLVNGDKPVDA------------EALGKSSVVVRGLSAYEYILF--- 146

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                         D      T     R    L  +     +  EE++K W         
Sbjct: 147 --------------DSKPDIATAEQKARYCPLLVAIGAHQKALAEEILKGWNSTDGMLSQ 192

Query: 244 LMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTY 293
           + K  N         +  L   ++       +++   +      +  P Q     S N+ 
Sbjct: 193 MTKFPNQRYADSHEAIADLLRAQVTALDTLKKKLGAPMGRQSKGIPQPLQAEAWRSHNSM 252

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
            S    +    + + G         +    +  L+  + + LA +I+  ++ ++K     
Sbjct: 253 NSLQASLKAAEAVWVG---------VDNQGLRGLLPSDQKALADKIDAAYATSLKLL--- 300

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
              A+N ++  ++++  +  G + +  + + L          +  AL++  
Sbjct: 301 ---ADNQKTLGELLA--DDAGQQTLNQIYDSLNVVHRLHEGDLAKALNIQL 346


>gi|148546191|ref|YP_001266293.1| periplasmic lipoprotein-like protein [Pseudomonas putida F1]
 gi|148510249|gb|ABQ77109.1| periplasmic lipoprotein-like protein [Pseudomonas putida F1]
          Length = 354

 Score =  126 bits (316), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 50/411 (12%), Positives = 125/411 (30%), Gaps = 86/411 (20%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++    P    ++       +V           Y   +   RTL ++         
Sbjct: 11  LAALALGACSPQDPQAVTSAAIANQV-------ILPTYSRWVEADRTLAASALAYCE--G 61

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           K++L+ AR  ++ A+  + + +    G         +V  WP  +  +            
Sbjct: 62  KESLDKARADFLNAQKAWAELQPLLVGPLAEGNRAWQVQFWPDKKNLV------------ 109

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                        +++  +K +D              A G  + +  G    E++L+   
Sbjct: 110 --------GRQVEQLLNGDKPVDA------------EALGKSSVVVRGLSAYEYILF--- 146

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                         D      T     R    L  +     +  EE++K W         
Sbjct: 147 --------------DSKPDIATAEQKARYCPLLVAIGAHQKALAEEILKGWNSTDGMLSQ 192

Query: 244 LMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTY 293
           + K  N         +  L   ++       +++   +      +  P Q     S N+ 
Sbjct: 193 MTKFPNQRYADSHEAIADLLRAQVTALDTLKKKLGAPMGRQSKGIPQPLQAEAWRSHNSM 252

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
            S    +    + + G         +    +  L+  + + LA +I+  ++ ++K     
Sbjct: 253 NSLQASLKAAEAVWVG---------VDNQGLRGLLPSDQKALADKIDAAYATSLKLL--- 300

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
              A+N ++  ++++  +  G + +  + + L          +  AL++  
Sbjct: 301 ---ADNQKTLGELLA--DDAGQQTLNQIYDSLNVVHRLHEGDLAKALNIQL 346


>gi|237799580|ref|ZP_04588041.1| putative lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331022436|gb|EGI02493.1| putative lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 354

 Score =  126 bits (316), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 48/403 (11%), Positives = 110/403 (27%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVEADRQLAASALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         +V  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQVQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                          +  +     +         + +  G    E++L+           
Sbjct: 110 ------------GRQVEQLVSAQPQVTVEELSKASVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      E+++ +W         L K  N  
Sbjct: 147 ------DAEIDMANAEQKARYCPLLMAIGERQKQLAEQILNSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++  S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADSWRSKSSLGSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++N+ K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRGLLPAEQKPLADKIDAAYANSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           + D         G + +    + L         ++  AL +  
Sbjct: 312 ATD--------AGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|323345640|ref|ZP_08085863.1| imelysin superfamily protein [Prevotella oralis ATCC 33269]
 gi|323093754|gb|EFZ36332.1| imelysin superfamily protein [Prevotella oralis ATCC 33269]
          Length = 448

 Score =  125 bits (313), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 57/448 (12%), Positives = 127/448 (28%), Gaps = 109/448 (24%)

Query: 20  IVPNVSLEKVLQNY-ATIAHAKYEDALMCARTLDSAIETLVT------TPNKKNLENARL 72
              N  ++ + Q Y   + +  Y +  + +  L + I  L          N+  ++    
Sbjct: 37  ATQNAEIQSITQRYLNDVVYPTYSNLAIESEGLYNKIAALKAKLNAGTNVNQSEIDAICS 96

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            +  AR  +++SE + +G       D  ++ WPL    +         ++  N    A +
Sbjct: 97  SYKAARNYWEESEAFLYGAATDFNIDPHIDTWPLAVEIL--------AKDLSNKDKIAGL 148

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
            AN+ +    K +    +                    G+H IEF+ +            
Sbjct: 149 NANTGVDFARKNLIPDNL--------------------GFHGIEFIFFRDGKNRPATFFN 188

Query: 193 NRPYTDF------DIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM- 245
           N    ++                +  V +   V+  L     ++  AW  +      +  
Sbjct: 189 NNEKENYVDPNGNAYFKNVTVTGKEEVIFASAVAGDLRDKCYQLEVAWEGNKAPANHIAR 248

Query: 246 -------------------------------------KDINAGLNSIITGMTSLSYNELA 268
                                                      L +I     S    E+A
Sbjct: 249 VAECAKNFDDFGTLTKTGLSYGEDLLAANTSKSSLASASWKKVLETIFISGCSNICAEVA 308

Query: 269 GERMNLGLILH------------------DPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
            ++M      H                  DP      +S N++  + +++  I +S  G 
Sbjct: 309 DQKMGQAYRTHTSSSPTYHEGENGNKEEDDPNYIESPYSYNSFTDFYDNIQSIQNSLYGN 368

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
           Y   N       SI   ++ +N  +A  + +K +  +      ++  +            
Sbjct: 369 Y---NQSAYSDNSIMAYLTAHNAAMATNLQNKLTAALLALKACQNSNKAFVQN------- 418

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRIA 398
              G   V+  ++ +    ++L +    
Sbjct: 419 --PGASYVKTAMDAVSALDDALTETSKW 444


>gi|330957932|gb|EGH58192.1| putative lipoprotein [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 354

 Score =  125 bits (313), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 51/403 (12%), Positives = 113/403 (28%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLAASALAFCQGKT--DLAAAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+ D L K        + +  G    E++L+           
Sbjct: 110 -----GRQVEQLVAAQPKITADELSKA-------SVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      EE++ +W         L K  N  
Sbjct: 147 ------DAEIDMANAEQKARYCPLLMAIGERQKQLAEEILNSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGL-----ILHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S  + +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKASLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++ + K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRGLLPAEQKPLADKIDAAYATSRKLLTELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           +        +  G + +    + L         ++  AL +  
Sbjct: 312 A--------SEAGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|49086968|gb|AAT51402.1| PA4372 [synthetic construct]
          Length = 355

 Score =  125 bits (313), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 48/410 (11%), Positives = 122/410 (29%), Gaps = 85/410 (20%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
             I++    P    ++      ++V           Y   +   + L S+         K
Sbjct: 11  LAIALGACSPQDPQAVTSAALAQQV-------ILPTYSRWVEADQALASSALAYCQ--GK 61

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           ++L  AR  +  A+  + + +    G         +V  WP  +  +             
Sbjct: 62  EDLAKARDAFHAAQKAWAELQPLLIGPLAEGNRAWQVQFWPDKKDLV------------- 108

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
                       +++ N  ++D + ++              + +  G    E++L+   +
Sbjct: 109 -------GRQVEQLLKNNPQVDAAALAKA------------SVVVQGLSAYEYILFDSKI 149

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
                                     R    L+ +        ++++  W  DG     +
Sbjct: 150 DLADAATK-----------------ARYCPLLEAIGTHQQQLAQDILARWKNDGGMLTQM 192

Query: 245 MKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYA 294
            K  N         +  L   ++       +++   L      +  P Q     S+ + A
Sbjct: 193 SKFPNDRYADAHEAIAELLRVQVTALDMLKKKLGTPLGRQSKGIPQPYQAEAWRSNASLA 252

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
           S    + G  + + G         I G  +  L+    ++LA +I+  ++++      L+
Sbjct: 253 SLDASLSGAQALWEG---------IDGKGLKTLLPAEQKDLAGKIDAAYADSHAKLAALE 303

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
                 +   ++++  + +G   +  L + L          +  AL +  
Sbjct: 304 -----QKPLSELLA--SEDGRNQLNALYDSLNVVHRLHEGDLARALGVQL 346


>gi|254448177|ref|ZP_05061640.1| conserved hypothetical protein [gamma proteobacterium HTCC5015]
 gi|198262303|gb|EDY86585.1| conserved hypothetical protein [gamma proteobacterium HTCC5015]
          Length = 383

 Score =  125 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 57/402 (14%), Positives = 124/402 (30%), Gaps = 75/402 (18%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
              + ++++ L +++ + + +Y +    A  L SA ET     + +NL   +  W     
Sbjct: 27  AQGSETVQQWLNSFSQLTYQRYLNLAQSADALHSASETFCQNRSAQNLALTQDAWKTLST 86

Query: 80  PYQQSEVYRFGNK-----IVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
            Y + E   FG          +  +++  WP                N +       +I+
Sbjct: 87  HYARVEAISFGPLSSSGEANSSRKQRLKTWPAQ------------GHNHKVERAIQQLIS 134

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNR 194
                          I+ D L +                 +E+LL+G            R
Sbjct: 135 ADN-----------EITTDSLAQY-------PTQFQSLDALEYLLFG-------HAEKAR 169

Query: 195 PYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA-------TKDLMKD 247
               F   + T    +R  ++L   S  + + L  + + W  +  A       +  L  D
Sbjct: 170 TAQCFSGDDHTACDPQRSCQFLMASSANIANLLNRVEQEWRNEFGASLASAGQSGSLYLD 229

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGL----ILHDPEQEIDCFSDNTYASYLNDVIGI 303
               +  II G+ S     L  +++   L     + DP+      S ++      ++  +
Sbjct: 230 QGTAVGDIINGLKSHLI-LLRNKKVRDPLNSGYDVADPKSLEAWRSQHSLKLLQTNIDSL 288

Query: 304 ISSYTGEYIRMNGEKIHGASIHD-LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
              Y            +   + + L++      AQ+      +  +    +   +   + 
Sbjct: 289 SEIY---------SSPNQFGLKNVLLAGGFEAEAQQFEAALQHAKQQLKAMDTSSLRNQL 339

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEP 404
             Q            +  L   +   +E     R  LD+++P
Sbjct: 340 SGQQ------PDKAAMTALYKAVFELSE-----RYTLDVVQP 370


>gi|15599568|ref|NP_253062.1| hypothetical protein PA4372 [Pseudomonas aeruginosa PAO1]
 gi|107100044|ref|ZP_01363962.1| hypothetical protein PaerPA_01001065 [Pseudomonas aeruginosa PACS2]
 gi|218893463|ref|YP_002442332.1| putative lipoprotein [Pseudomonas aeruginosa LESB58]
 gi|9950601|gb|AAG07760.1|AE004853_3 hypothetical protein PA4372 [Pseudomonas aeruginosa PAO1]
 gi|218773691|emb|CAW29505.1| putative lipoprotein [Pseudomonas aeruginosa LESB58]
          Length = 354

 Score =  125 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 48/410 (11%), Positives = 122/410 (29%), Gaps = 85/410 (20%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
             I++    P    ++      ++V           Y   +   + L S+         K
Sbjct: 11  LAIALGACSPQDPQAVTSAALAQQV-------ILPTYSRWVEADQALASSALAYCQ--GK 61

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           ++L  AR  +  A+  + + +    G         +V  WP  +  +             
Sbjct: 62  EDLAKARDAFHAAQKAWAELQPLLIGPLAEGNRAWQVQFWPDKKDLV------------- 108

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
                       +++ N  ++D + ++              + +  G    E++L+   +
Sbjct: 109 -------GRQVEQLLKNNPQVDAAALAKA------------SVVVQGLSAYEYILFDSKI 149

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
                                     R    L+ +        ++++  W  DG     +
Sbjct: 150 DLADAATK-----------------ARYCPLLEAIGTHQQQLAQDILARWKNDGGMLTQM 192

Query: 245 MKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYA 294
            K  N         +  L   ++       +++   L      +  P Q     S+ + A
Sbjct: 193 SKFPNDRYADAHEAIAELLRVQVTALDMLKKKLGTPLGRQSKGIPQPYQAEAWRSNASLA 252

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
           S    + G  + + G         I G  +  L+    ++LA +I+  ++++      L+
Sbjct: 253 SLDASLSGAQALWEG---------IDGKGLKTLLPAEQKDLAGKIDAAYADSHAKLAALE 303

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
                 +   ++++  + +G   +  L + L          +  AL +  
Sbjct: 304 -----QKPLSELLA--SEDGRNQLNALYDSLNVVHRLHEGDLARALGVQL 346


>gi|311695457|gb|ADP98330.1| periplasmic lipoprotein [marine bacterium HP15]
          Length = 344

 Score =  125 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 59/414 (14%), Positives = 124/414 (29%), Gaps = 82/414 (19%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +    +  T P    S     + ++  +  AT     Y+     A  L  +       P
Sbjct: 7   LLCTSILALTSPLAWTSDANTQARQQWYEGIAT----GYQSLTTEAGELAESARDYCQNP 62

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
            + + E+    W+ A + +Q+  +  FG    +    +   WP  +  I           
Sbjct: 63  AEGSREHVEAAWLNAFLAWQKVRLVDFGPVENNNLSWQFQFWPDPKNLI----------- 111

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                  A +I N +            I+P ++ +             G+ +IE+LL+ Q
Sbjct: 112 ---ARKAAYLIGNDE-----------PITPSVINQS-------GVAVQGFPMIEYLLFDQ 150

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           +                     T     R  E L  V+  +  + + +M  W        
Sbjct: 151 EFN----------------AGETSLPVARTCELLTNVAGHVKGNSDALMAGWQ---AFRP 191

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILH---DPEQEIDCFSDNTYASYLND 299
             ++       +I  GM +L   E       +GL      +P       S  +  +    
Sbjct: 192 HYLETEQYFDTTIRAGMATLEILEERRLAQPMGLRGSNKRNPYIADAWRSGKSLQTVAAT 251

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR-NLAQEINDKFSNTMKDFHILKDRAE 358
           V G+   +                +   +      +LA  I  +F+   ++F        
Sbjct: 252 VDGLNRYFL-------------PGLEISLEAKGASDLADRIRKQFNEVQQNF-------- 290

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI-EPNRVIGN 410
                    +    +  + +++L  D+   T  +  +  +AL ++   N   G+
Sbjct: 291 PGAHLPLATALKEEDQFRALQSLYVDISQLTTLVNDQAAVALGVVRGFNSSDGD 344


>gi|296391079|ref|ZP_06880554.1| putative lipoprotein [Pseudomonas aeruginosa PAb1]
 gi|313106902|ref|ZP_07793105.1| putative lipoprotein [Pseudomonas aeruginosa 39016]
 gi|310879607|gb|EFQ38201.1| putative lipoprotein [Pseudomonas aeruginosa 39016]
          Length = 354

 Score =  124 bits (311), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 48/410 (11%), Positives = 121/410 (29%), Gaps = 85/410 (20%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
             I++    P    ++      ++V           Y   +   + L S+         K
Sbjct: 11  LAIALGACSPQDPQAVTSAALAQQV-------ILPTYSRWVEADQALASSALAYCQ--GK 61

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           ++L  AR  +  A+  + + +    G         +V  WP  +  +             
Sbjct: 62  EDLAKARDAFHAAQKAWAELQPLLIGPLAEGNRAWQVQFWPDKKDLV------------- 108

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
                       +++ N  ++D + ++              + +  G    E++L+   +
Sbjct: 109 -------GRQVEQLLKNNPQVDAAALAKA------------SVVVQGLSAYEYILFDSKI 149

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
                                     R    L+ +        ++++  W  DG     +
Sbjct: 150 DLADAATK-----------------ARYCPLLEAIGTHQQQLAQDILARWKNDGGMLTQM 192

Query: 245 MKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYA 294
            K  N         +  L   ++       +++   L      +  P Q     S+ + A
Sbjct: 193 SKFPNDRYADAHEAIAELLRVQVTALDMLKKKLGTPLGRQSKGIPQPYQAEAWRSNASLA 252

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
           S    + G  + + G         I G  +  L+    + LA +I+  ++++      L+
Sbjct: 253 SLDASLSGAQALWEG---------IDGKGLKTLLPAEQKALAGKIDAAYADSHAKLAALE 303

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
                 +   ++++  + +G   +  L + L          +  AL +  
Sbjct: 304 -----QKPLSELLA--SEDGRNQLNALYDSLNVVHRLHEGDLARALGVQL 346


>gi|167035470|ref|YP_001670701.1| lipoprotein [Pseudomonas putida GB-1]
 gi|166861958|gb|ABZ00366.1| lipoprotein [Pseudomonas putida GB-1]
          Length = 354

 Score =  124 bits (311), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 48/411 (11%), Positives = 129/411 (31%), Gaps = 86/411 (20%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++    P    ++      ++V           Y   +   RTL ++         
Sbjct: 11  LAALALGACSPQDPQAVTSAAIAKQV-------ILPTYSRWVEADRTLAASALAYCE--G 61

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           K++L+ AR  ++ A+  + + +    G         +V  WP  +  +            
Sbjct: 62  KESLDKARADFLNAQKAWAELQPLLVGPLAEGNRAWQVQFWPDKKNLV------------ 109

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                        +++  +K +D + +            G  + +  G    E++L+   
Sbjct: 110 --------GRQVEQLVNGDKPVDAAAL------------GKASVVVRGLSAYEYILF--- 146

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                         D      T     R    L  + +      EE++K+W         
Sbjct: 147 --------------DSKPDIATAEQKARYCPLLVAIGEHQKVLAEEILKSWNSTDGMLSQ 192

Query: 244 LMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTY 293
           + K  N         +  L  +++       +++   +      +  P Q     S ++ 
Sbjct: 193 MTKFPNQRYADSHEAIADLLRSQVTALDTLKKKLGAPMGRQSKGIPQPLQAEAWRSHSSL 252

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
            S    +    + + G         +    +  L+  + + LA +I+  ++ ++K     
Sbjct: 253 KSLEATLKAAETVWVG---------VDNQGLRGLLPSDQKALADKIDAAYATSLKLL--- 300

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
              A+N ++  ++++  +  G + +  + + L          +  AL++  
Sbjct: 301 ---ADNQKTLGELLA--DDAGQQTLNQIYDSLNAVHRLHEGDLAKALNIQL 346


>gi|254238965|ref|ZP_04932288.1| hypothetical protein PACG_05135 [Pseudomonas aeruginosa C3719]
 gi|254244818|ref|ZP_04938140.1| hypothetical protein PA2G_05690 [Pseudomonas aeruginosa 2192]
 gi|126170896|gb|EAZ56407.1| hypothetical protein PACG_05135 [Pseudomonas aeruginosa C3719]
 gi|126198196|gb|EAZ62259.1| hypothetical protein PA2G_05690 [Pseudomonas aeruginosa 2192]
          Length = 354

 Score =  124 bits (311), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 48/410 (11%), Positives = 120/410 (29%), Gaps = 85/410 (20%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
             I++    P    ++      ++V           Y   +   + L S+         K
Sbjct: 11  LAIALGACSPQDPQAVTSAALAQQV-------ILPTYSRWVEADQALASSALAYCQ--GK 61

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           ++L  AR  +  A+  + + +    G         +V  WP  +  +             
Sbjct: 62  EDLAKARDAFHAAQKAWAELQPLLIGPLAEGNRAWQVQFWPDKKDLV------------- 108

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
                       +++ N  ++D + ++              + +  G    E++L+   +
Sbjct: 109 -------GRQVEQLLKNNPQVDAAALAKA------------SVVVQGLSAYEYILFDSKI 149

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
                                     R    L+ +        ++++  W  DG     +
Sbjct: 150 DLADAATK-----------------ARYCPLLEAIGTHQQQLAQDILARWKNDGGMLTQM 192

Query: 245 MKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYA 294
            K  N         +  L   ++       +++   L      +  P Q     S+ + A
Sbjct: 193 SKFPNDRYADAHEAIAELLRVQVTALDMLKKKLGTPLGRQSKGIPQPYQAEAWRSNASLA 252

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
           S    + G  + + G         I G  +  L+    + LA +I+  ++ +      L+
Sbjct: 253 SLDASLSGAQALWEG---------IDGKGLKTLLPAEQKALAGKIDAAYAESHAKLAALE 303

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
                 +   ++++  + +G   +  L + L          +  AL +  
Sbjct: 304 -----QKPLSELLA--SEDGRNQLNALYDSLNVVHRLHEGDLARALGVQL 346


>gi|152987936|ref|YP_001350277.1| putative lipoprotein [Pseudomonas aeruginosa PA7]
 gi|150963094|gb|ABR85119.1| lipoprotein, putative [Pseudomonas aeruginosa PA7]
          Length = 354

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 48/414 (11%), Positives = 123/414 (29%), Gaps = 87/414 (21%)

Query: 3   FITIISIV--FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
            +T ++I      P    ++      ++V           Y   +   + L S+      
Sbjct: 7   LLTSLAIALGACSPQDPQAVTSAALAQQV-------ILPTYSRWVEADQALASSALAYCQ 59

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
              K++L  AR  +  A+  + + +    G         +V  WP  +  +         
Sbjct: 60  --GKEDLAKARDAFHAAQKAWAELQPLLIGPLAEGNRAWQVQFWPDKKDLV--------- 108

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
                           +++ +  ++D + ++              + +  G    E++L+
Sbjct: 109 -----------GRQVEQLLKSNPQVDAAALAKA------------SVVVQGLSAYEYILF 145

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
              +                          R    L+ +        ++++  W  DG  
Sbjct: 146 DSKIDLADAATK-----------------ARYCPLLEAIGTHQQQLAQDILARWKNDGGM 188

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSD 290
              + K  N         +  L   ++       +++   L      +  P Q     S+
Sbjct: 189 LTQMSKFPNDRYADAHEAIAELLRVQVTALDMLKKKLGTPLGRQSKGIPQPYQAEAWRSN 248

Query: 291 NTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDF 350
            + AS    + G  + + G         I G  +  L+    + LA +I+  ++++    
Sbjct: 249 ASLASLDASLGGAQALWEG---------IDGKGLKTLLPAEQKELAGKIDAAYADSHAKL 299

Query: 351 HILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
             L+      +   ++++  + +G   +  L + L          +  AL +  
Sbjct: 300 TALE-----QKPLSELLA--SEDGRTQLNALYDSLNVVHRLHEGDLARALGVQL 346


>gi|120555746|ref|YP_960097.1| periplasmic lipoprotein [Marinobacter aquaeolei VT8]
 gi|120325595|gb|ABM19910.1| periplasmic lipoprotein [Marinobacter aquaeolei VT8]
          Length = 344

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 54/414 (13%), Positives = 115/414 (27%), Gaps = 82/414 (19%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
                +++    +   +     + E+    +       YE        L SA       P
Sbjct: 7   LFFASALLVCTTAALAANADTRAREQ----WHGAIQNGYESLATKTEQLASAAVGYCNAP 62

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
              +       W+ A + +Q+     FG    +    +   WP  +     V        
Sbjct: 63  TSDSRPALNDAWLDAFLAWQRVRFVDFGPVENNNLSWQFQFWPDPKNL---VARKARYLL 119

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                  A++I  S                                  G+ + E+LL+ +
Sbjct: 120 GTEAPVNADVINQS-----------------------------GVAVQGFPMAEYLLFDE 150

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
            L +                        +  E L  V++ +  +  ++  +W       +
Sbjct: 151 QLNSGENALP----------------AAKNCEVLSAVTRHMARNARDLADSWVS---FKQ 191

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILH---DPEQEIDCFSDNTYASYLND 299
             +        ++  GMT+L   E       +GL  +   +P       S  +  +    
Sbjct: 192 HYLDTAPYRDTTVKAGMTALEILEERRLAQPMGLRGNGKRNPYITDAWRSGQSLMAVEAT 251

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRN-LAQEINDKFSNTMKDFHILKDRAE 358
           V G+   Y                +  L+  +    LA+ I  +F     +F        
Sbjct: 252 VAGLEKFYL-------------PGLITLLKTDGEARLAERIQRQFEEVADNFPEAHAAMT 298

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI-EPNRVIGN 410
            +   D        E  +I++ L  D+   +  +  +  +AL ++   N   G+
Sbjct: 299 TLMESD--------ERFRILQGLFVDVSQLSTLVNDEAAVALGVVRGFNSSDGD 344


>gi|325298463|ref|YP_004258380.1| Peptidase M75, Imelysin [Bacteroides salanitronis DSM 18170]
 gi|324318016|gb|ADY35907.1| Peptidase M75, Imelysin [Bacteroides salanitronis DSM 18170]
          Length = 440

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 58/433 (13%), Positives = 133/433 (30%), Gaps = 94/433 (21%)

Query: 23  NVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAI----ETLVTTPNKKNLENARLQWIRA 77
             +L++++ +Y T      YE     +  L +A        V       +  A   W +A
Sbjct: 42  EAALKEIVNDYTTKTVIPTYEALADASVELHTACMAMYNAGVGNVTTDQVRTAGEAWKKA 101

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R  +++SE + +G       D  +++WPLD+  +D +               AN    +K
Sbjct: 102 REYWERSEAWLYGPAGDYNVDPHIDSWPLDQIALDALL--------------ANETEMAK 147

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD----LKTNVREPGN 193
           + VN   I                         G+H +E++L+  +     +T+V    +
Sbjct: 148 MDVNGVYIS-----------------SQDYGLLGFHALEYMLFAIEGSGMSQTSVPHSTD 190

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKV----------VSKILVSDL-------------EEM 230
               +        G  R    +L+             +  ++D+             + +
Sbjct: 191 YTAQELSYIAGVAGDLRNHCIFLEAAWVGEDNISSAKQQALADVRNEAQFAANNVSIQRV 250

Query: 231 MKAWGPDGQATKDLMKDINAGLNSIIT-----------GMTSLSYNELAGERMNLGLILH 279
           ++          ++      G N  +                   NE+   ++     + 
Sbjct: 251 LQDLANGLCYADEMNNPAEGGGNDFVNYLQAVQSLAGEDGIQNIANEVGNIKIGNPTGMG 310

Query: 280 -------DPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN-GEKIHGA-----SIHD 326
                  DP+     +S N+   +L ++I I ++Y G     +    +  A     S+  
Sbjct: 311 AGDEYEYDPDYIESPYSLNSINDFLGNIISIENAYRGIQTSKSYNSGVTYAQPVEHSLSS 370

Query: 327 LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLI 386
            ++  + +L   +     N       +++          +         +I RN I    
Sbjct: 371 YVASLDADLDTRVIAAIDNAYNAIDQMEEPF-------VVTCAQGGAYTEINRNAITACR 423

Query: 387 TQTESLRKIRIAL 399
              +   ++   +
Sbjct: 424 ELNDIFDEVLALI 436


>gi|146308317|ref|YP_001188782.1| periplasmic lipoprotein-like protein [Pseudomonas mendocina ymp]
 gi|145576518|gb|ABP86050.1| periplasmic lipoprotein-like protein [Pseudomonas mendocina ymp]
          Length = 353

 Score =  123 bits (309), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 46/409 (11%), Positives = 110/409 (26%), Gaps = 86/409 (21%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++V        + V    ++ VL          Y       R L  +         
Sbjct: 10  LLGLALVGCNQQDPRAKVSAALVDGVL-------LPAYSSWQEADRQLAGSTAAFCA--G 60

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
             +L  AR  ++ A+  +   +    G         ++  WP  +  +            
Sbjct: 61  TADLPAARQAFLGAQNAWAGLQPLLIGPLAEGNRAWQIQFWPDKKNLV------------ 108

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                        +  V     +   ++P  L          + +  G    E++L+  +
Sbjct: 109 -------------QRQVEALLKNKPQLTPADLASA-------SVVVQGLTAYEYVLFDAN 148

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
           L  N  E                    R    L+ +     +   ++++ W       + 
Sbjct: 149 LDLNDAEQK-----------------ARYCPLLQAIGTHQQALAADIVEQWQAKPGMAEQ 191

Query: 244 LMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGL-----ILHDPEQEIDCFSDNTY 293
           L K  N         +  L   +++      +++   +      +  P Q     S  + 
Sbjct: 192 LRKFPNERYAEANEAIAELLRVQVSALDGLKKKLGAPMGRQSKGIPQPYQAESWRSAASL 251

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
           ++    +      + G              I  L+  +   L Q I+  + +T +    L
Sbjct: 252 SNQAAALASAERLWHGSNRD---------GIQSLLDKDQAQLGQRIDAAYQDTRQRLAAL 302

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDL 401
                 + +        +  G   +  L + L         ++  AL +
Sbjct: 303 DRPLGELLA--------DDAGRTSLNELYDSLNRLHRLQESELAKALGV 343


>gi|330811315|ref|YP_004355777.1| lipoprotein [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327379423|gb|AEA70773.1| Conserved hypothetical protein; putative lipoprotein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 354

 Score =  123 bits (309), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 53/411 (12%), Positives = 120/411 (29%), Gaps = 86/411 (20%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  I++    P    ++      ++V           Y   +   R L ++         
Sbjct: 11  LAAIALGACSPQDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLATSALAFCQ--G 61

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           K+NLE AR  +++A+  + + +    G         +V  WP  +  +            
Sbjct: 62  KENLETARADFLKAQKAWAELQPLLIGPLAEGNRAWQVQFWPDKKNLV------------ 109

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                           V +       I    L K        + +  G    E+LL+   
Sbjct: 110 -------------GRQVEQLVNSEPQIDAAGLAKS-------SVVVQGLSAYEYLLF--- 146

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                         D  I         +    L  + +      EE++  W  +      
Sbjct: 147 --------------DAKIDMADSAQKAKYCPLLTAIGERQKQLAEEILSRWNTNDGMLAQ 192

Query: 244 LMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTY 293
           + K  N         +  L   ++       +++   +      +  P Q     S ++ 
Sbjct: 193 MSKFPNQRYADSHEAIADLLRVQVTALDTLKKKLGTPMGRQSKGVPQPFQADAWRSQSSL 252

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
                 +    + + G         +    +  L+  + + LA +I+  +  ++K F   
Sbjct: 253 QGLEASLSAARTVWAG---------VDNKGLRGLLPSDQKPLADKIDAAYDASLKLF--- 300

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
              A +  S  +M+  N+  G + + +L + L         ++  AL +  
Sbjct: 301 ---ASSQRSLTEML--NDDAGRQQLNDLYDSLNVVHRLHEGELAKALGIQL 346


>gi|116052406|ref|YP_792717.1| putative lipoprotein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115587627|gb|ABJ13642.1| putative lipoprotein [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 354

 Score =  123 bits (309), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 48/410 (11%), Positives = 120/410 (29%), Gaps = 85/410 (20%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
             I++    P    ++      ++V           Y   +   + L S+         K
Sbjct: 11  LAIALGACSPQDPQAVTSAALAQQV-------ILPTYSRWVEADQALASSALAYCQ--GK 61

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           ++L  AR  +  A+  + + +    G         +V  WP  +  +             
Sbjct: 62  EDLAKARDAFHAAQKAWAELQPLLIGPLAEGNRAWQVQFWPDKKDLV------------- 108

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
                       +++ N  ++D + ++              + +  G    E++L+   +
Sbjct: 109 -------GRQVEQLLKNNPQVDAAALAKA------------SVVVQGLSAYEYILFDSKI 149

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
                                     R    L+ +        ++++  W  DG     +
Sbjct: 150 DLADAATK-----------------ARYCPLLEAIGTHQQQLAQDILARWKNDGGMLTQM 192

Query: 245 MKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYA 294
            K  N         +  L   ++       +++   L      +  P Q     S+ + A
Sbjct: 193 SKFPNDRYADAHEAIAELLRVQVTALDMLKKKLGTPLGRQSKGIPQPYQAEAWRSNASLA 252

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
           S    + G  + + G         I G  +  L+    + LA +I+  + ++      L+
Sbjct: 253 SLDASLSGAQALWEG---------IDGKGLKTLLPAEQKALAGKIDAAYVDSHAKLAALE 303

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
                 +   ++++  + +G   +  L + L          +  AL +  
Sbjct: 304 -----QKPLSELLA--SEDGRNQLNALYDSLNVVHRLHEGDLARALGVQL 346


>gi|325277940|ref|ZP_08143477.1| lipoprotein [Pseudomonas sp. TJI-51]
 gi|324096914|gb|EGB95223.1| lipoprotein [Pseudomonas sp. TJI-51]
          Length = 354

 Score =  123 bits (307), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 50/411 (12%), Positives = 130/411 (31%), Gaps = 86/411 (20%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++    P    ++      ++V           Y   +   RTL ++         
Sbjct: 11  LAALALGACSPQDPQAVTSAAIAKQV-------ILPTYSRWVEADRTLAASALAYCE--G 61

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           K++LE AR  ++ A+  + + +    G         +V  WP  +  +            
Sbjct: 62  KEDLEKARADFLNAQKAWAELQPLLVGPLAEGNRAWQVQFWPDKKNLV------------ 109

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                        +++  +K +D++ +            G  + +  G    E++L+   
Sbjct: 110 --------GRQVEQLVNGDKPVDVAAL------------GKASVVVRGLSAYEYILF--- 146

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                         D      T     R    L  +S+      E+++K+W         
Sbjct: 147 --------------DSKPDIATAEQKARYCPLLVAISEHQKLLAEDILKSWNSTDGMLSQ 192

Query: 244 LMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLILHD-----PEQEIDCFSDNTY 293
           + K  N         +  L  +++       +++   +         P Q     S ++ 
Sbjct: 193 MTKFPNQRYADSHEAIADLLRSQVTALDTLKKKLGAPMGRQSKGIAQPLQAEAWRSHSSL 252

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
            S    +    + + G         +    +  L+  + + LA +I+  ++ ++K     
Sbjct: 253 KSLEATLKAAQTVWVG---------VDNQGLRGLLPSDQKALADKIDAAYATSLKLL--- 300

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
              A+N ++  ++++  +  G + +  L + L          +  AL++  
Sbjct: 301 ---ADNQKTLGELLA--DDAGQQTLNQLYDSLNVVHRLHEGDLAKALNIQL 346


>gi|170720163|ref|YP_001747851.1| lipoprotein [Pseudomonas putida W619]
 gi|169758166|gb|ACA71482.1| lipoprotein [Pseudomonas putida W619]
          Length = 354

 Score =  123 bits (307), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 49/411 (11%), Positives = 127/411 (30%), Gaps = 86/411 (20%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++    P    ++      ++V           Y   +   R L ++         
Sbjct: 11  LAALALGACSPQDPQAVTSAAIAKQV-------ILPTYSRWVEADRQLAASALAYCE--G 61

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           K++L+ AR  ++ A+  + + +    G         +V  WP  +  +            
Sbjct: 62  KESLDTARADFLNAQKAWAELQPLLVGPLAEGNRAWQVQFWPDKKNLV------------ 109

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                        +++  +K ID   +            G  + +  G    E++L+   
Sbjct: 110 --------GRQVEQLVNGDKPIDAQTL------------GKSSVVVRGLSAYEYILF--- 146

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                         D      T     R    L  + +   +  EE++K W         
Sbjct: 147 --------------DSKPDVATAEQKARYCPLLVAIGEHQKALAEEILKGWNSTDGMLSQ 192

Query: 244 LMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLILHD-----PEQEIDCFSDNTY 293
           + K  N         +  L   ++       +++   +         P Q     S  + 
Sbjct: 193 MTKFPNQRYADSHEAIADLLRAQVTALDTLKKKLGAPMGRQSKGIAQPLQAEAWRSHASL 252

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
            S    +    + + G         +    +  L+  + + LAQ+I+D ++ ++K     
Sbjct: 253 RSLEASLKAAQAVWVG---------VDNQGLRGLLGSDQKALAQKIDDAYATSLKLLT-- 301

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
               +N ++  ++++  + +G + +  + + L         ++  AL++  
Sbjct: 302 ----DNQKTLGELLA--DEDGMQRLNQIYDSLNVVHRLHEGELAKALNIQL 346


>gi|332663707|ref|YP_004446495.1| peptidase M75, Imelysin [Haliscomenobacter hydrossis DSM 1100]
 gi|332332521|gb|AEE49622.1| Peptidase M75, Imelysin [Haliscomenobacter hydrossis DSM 1100]
          Length = 368

 Score =  123 bits (307), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 48/365 (13%), Positives = 109/365 (29%), Gaps = 72/365 (19%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTP 62
           + I+       + +           +L++YA  I    Y         L SA     ++ 
Sbjct: 14  MLIVMGFACDSNESGKDEETFDRAAMLEHYASNIIKPAYTTLAEKTLALQSATAVFRSSS 73

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD----KKVNAWPLDEGFIDYVDSSY 118
           N  NL   +  W  A + +Q++  + FG    +       ++V  +P+    I+      
Sbjct: 74  NDVNLAALQKAWKDAALAWQKANGFNFGPAGEEGLRKGLVEEVGTFPVSTAKIE------ 127

Query: 119 GKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFL 178
                       N ++N +  + +   D                        G   IE+L
Sbjct: 128 ------------NSVSNGQWNLADFNRDA----------------------RGLLAIEYL 153

Query: 179 LWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           L+G++  +                  +     +R E+L  ++K +   + E+ +AW    
Sbjct: 154 LFGENKTS-------------IEILNSFTGVSKRAEFLDALAKDVHQRVTEINEAWKTYA 200

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL------HDPEQEIDCFSDNT 292
                          S++      S+  L   ++ + L         +P+     +S  +
Sbjct: 201 TEFTKNAGTDVGSSTSMLYNEFVRSFEALKNFKVGVPLGKRVGQTKSEPQLAEAYYSGES 260

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHN--NRNLAQEINDKFSNTMKDF 350
            +        + + + G         + GAS    +      + L      + +   + F
Sbjct: 261 LSLLRAHFNAVENLWYGH------ASVPGASFRAYLETVVGGKELIASTETQLAAVRQAF 314

Query: 351 HILKD 355
             +  
Sbjct: 315 EAVPA 319


>gi|104780330|ref|YP_606828.1| lipoprotein [Pseudomonas entomophila L48]
 gi|95109317|emb|CAK14017.1| putative lipoprotein [Pseudomonas entomophila L48]
          Length = 354

 Score =  122 bits (306), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 48/411 (11%), Positives = 123/411 (29%), Gaps = 86/411 (20%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++    P    ++      ++V           Y   +   R L ++         
Sbjct: 11  LAALALGACSPQDPQAVTSAAIAKQV-------ILPTYSRWVEADRALAASALAYCEGKT 63

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
             +LE AR  ++ A+  + + +    G         +V  WP  +  +            
Sbjct: 64  --SLETARADFLNAQKAWAELQPLLVGPLAEGNRAWQVQFWPDKKNLV------------ 109

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                        +++  +K +D              + G  + +  G    E++L+   
Sbjct: 110 --------GRQVEQLVNGDKPVDA------------ESLGKASVVVRGLSAYEYILF--- 146

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                         D      +     R    L  + +      EE++K W         
Sbjct: 147 --------------DSKPDVASAEQKARYCPLLVAIGEHQKVLAEEILKGWNSTDGMLSQ 192

Query: 244 LMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTY 293
           + K  N         +  L   ++       +++   +      +  P Q     S ++ 
Sbjct: 193 MTKFPNQRYADSHEAIADLLRAQVTALDTLKKKLGAPMGRQSKGIPQPLQAEAWRSHSSL 252

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
            S    +    + + G         +    +  L+  +   LAQ+I+D ++ ++K     
Sbjct: 253 KSLEASLKAAQTVWVG---------VDNQGLRGLLGKDQAPLAQKIDDAYAASLKLL--- 300

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
              A N ++  ++++  +  G + +  + + L          +  AL++  
Sbjct: 301 ---ASNQKTLGELLA--DDAGQQSLNQIYDSLNAVHRLHEGDLAKALNIQL 346


>gi|187736416|ref|YP_001878528.1| hypothetical protein Amuc_1934 [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187426468|gb|ACD05747.1| conserved hypothetical protein [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 368

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 64/423 (15%), Positives = 126/423 (29%), Gaps = 101/423 (23%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPN 63
           TI++      +   +          +  YA  +    Y+     A     A + L   P 
Sbjct: 17  TILAFGSQAQAAKAASPKVDKTSAAIAAYADELVIPTYKTMSDNALKFAKAAKELKAAPT 76

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
              +  A    +  R+P++ SE + FG       D K+++WPLD   +D V  +   ++ 
Sbjct: 77  DAKVAEAGKLLLETRVPWELSESFLFGPAAFANLDPKLDSWPLDTTNLDAVAKNADSKS- 135

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                                ID + +   L  +           T G+H  E+LL+   
Sbjct: 136 -------------------VTIDAAYVRNSLGAE-----------TRGFHAAEYLLFRDG 165

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--------- 234
                     R   D   G          + YL  V++++  D   +   W         
Sbjct: 166 Q--------PRKAADLTPGQ---------LSYLAAVAEVIAEDAITLEAWWAGSDKISEE 208

Query: 235 ----------GPDGQATKDLMKDINAGLN--------SIITGMTSLSYNELAGERMNLGL 276
                      P      +  K   AG            I G +    +E+A  ++    
Sbjct: 209 KAKILEEAEIEPGKSYAGEFKKAGQAGSRYESNSEVLDEIIGGSKDIIDEIADSKVGKPY 268

Query: 277 ILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLA 336
              D       +S  +     ++V  +  SY                I  L++  +  + 
Sbjct: 269 ETADAADCESLYSYTSLVDSRHNVQSVEKSYNA--------------ISPLVAAKSAKVG 314

Query: 337 QEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
           Q +    +   K    ++                N +  + ++ +I+     +E+L K++
Sbjct: 315 QAVKGSIAKVFKSLDAIQGPL-----------VKNLDKKEQLKAIIDSCKELSENLDKVQ 363

Query: 397 IAL 399
             L
Sbjct: 364 ELL 366


>gi|120405724|ref|YP_955553.1| hypothetical protein Mvan_4774 [Mycobacterium vanbaalenii PYR-1]
 gi|119958542|gb|ABM15547.1| protein of unknown function DUF451 [Mycobacterium vanbaalenii
           PYR-1]
          Length = 387

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/387 (12%), Positives = 106/387 (27%), Gaps = 130/387 (33%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
           FT+   A+ +      ++   +Y    +            L  A+E  V      ++E A
Sbjct: 129 FTVTGDAVQVDTEGKFKEAADSYKRYVN-------SQVEALVPAVEAFVAAIKSGDIEAA 181

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           + Q+  +R+ Y++ E                   P+ E F D                  
Sbjct: 182 KAQYPTSRVYYERIE-------------------PVAESFPD------------------ 204

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
                                 D    L  A+       TG+H +E  LW    + +   
Sbjct: 205 --------------------DLDPRIDLREADLEPGQKWTGFHRLEKDLWVTGPQADTN- 243

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
                                       ++  LV+D++E+         +          
Sbjct: 244 ---------------------------AIADQLVADVKELQAGVSAPDFSVDSTQ----- 271

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
                I G      +E+A  +++          E D FS      +  ++ G        
Sbjct: 272 -----IAGGAQGLLDEIATSKISG---------EEDIFSHTDLWDFNANLQGSQ------ 311

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
                      AS+  ++   N +L   ++ +F          ++  +   S+D++    
Sbjct: 312 --------TAVASVRPILDERNPDLGTRVDQRFEEVEALLERYRE-GDGFVSYDKV---- 358

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRI 397
                + +   I+ L  +   ++ +  
Sbjct: 359 TEPERQELSRAIDALSKEVSQVQGVIA 385


>gi|313207239|ref|YP_004046416.1| peptidase m75, imelysin [Riemerella anatipestifer DSM 15868]
 gi|312446555|gb|ADQ82910.1| Peptidase M75, Imelysin [Riemerella anatipestifer DSM 15868]
          Length = 387

 Score =  121 bits (302), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 58/424 (13%), Positives = 122/424 (28%), Gaps = 80/424 (18%)

Query: 2   YFITIISIVFTL----------PSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCART 50
           YF    S +F L          P+    +      +++L+++A        E     A  
Sbjct: 3   YFKLFFSALFCLVLFSCGGNDSPTENAKVDDGFDRKEMLRHWADNFIIPYTEKFKDEATN 62

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV--DTWDKKVNAWPLDE 108
           LD+ I+     PN+ +L   R    +    YQ    YR G        +  +VN +P + 
Sbjct: 63  LDTKIKAFAQEPNQTHLTAVREALNKTYEAYQYIGFYRLGKAEEVSMNFLYRVNTYPTNT 122

Query: 109 GFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNI 168
             I      +     + +      IA                                  
Sbjct: 123 ERIKQNAKDHNYNFRQLSEIQGGKIA---------------------------------- 148

Query: 169 TTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLE 228
             G   I++L+ G + + N                 +G        YL  +S  ++    
Sbjct: 149 -QGLPAIDYLVNGLEPEDNAILMEY----------TSGQEAADYKAYLSALSAEILKSAT 197

Query: 229 EMMKAWGPDGQATKDLMKD---INAGLNSIITGMTSLSYNELAGERMNLGLI-------- 277
           E++      G   K +       +  ++ ++          L   ++             
Sbjct: 198 EVLAD-WKGGYRNKFVENTDSNASGSISLMVNAYVQYYEKNLRAAKIGYPSGVLTPMFLA 256

Query: 278 ---LHDPEQEIDCFS-DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR 333
                 P      F+   + A  L     ++  + G+ I             D ++  N 
Sbjct: 257 QSEAPKPHLIESQFAPQYSRAYALLGTKAMLEFFQGKGINGK-SGKSLQHYIDYMATKNA 315

Query: 334 ---NLAQEINDKFSNTMKDFHILKDRAENIESFD--QMISENNPEGNKIVRNLINDLITQ 388
               L+Q+I  +F   +K+   L    +   + D  QM +        + +  ++ + + 
Sbjct: 316 HHKTLSQDIVRQFEEAIKNIEALNPNLKIQITQDLAQMKNAYFSLQQNVSKLKVDMVQSL 375

Query: 389 TESL 392
             ++
Sbjct: 376 NITI 379


>gi|70732155|ref|YP_261911.1| putative lipoprotein [Pseudomonas fluorescens Pf-5]
 gi|68346454|gb|AAY94060.1| lipoprotein, putative [Pseudomonas fluorescens Pf-5]
          Length = 354

 Score =  121 bits (302), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 46/411 (11%), Positives = 122/411 (29%), Gaps = 86/411 (20%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++    P    ++      ++V           Y   +   R L  +         
Sbjct: 11  LAALALGACSPQDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLAISALAFCE--G 61

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           K++L+ AR  ++ A+  + + +    G         +V  WP  +  +            
Sbjct: 62  KESLDTARADFLHAQKAWAELQPLLIGPLAEGNRSWQVQFWPDKKNLV------------ 109

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                        +++    +ID + ++              + +  G    E++L+   
Sbjct: 110 --------GRQVEQLVTANPQIDAAALAKS------------SVVVQGLSAYEYILFDSK 149

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
           +                          R    L  + +      EE++ +W  +      
Sbjct: 150 IDMADSAQK-----------------ARYCPLLTAIGERQKQLAEEILSSWNTNDGMLAQ 192

Query: 244 LMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTY 293
           + K  N         +  L   ++       +++   +      +  P Q     S ++ 
Sbjct: 193 MSKFPNQRYADSHEAIADLLRVQVTALDTLKKKLGTPMGRQTKGIPQPFQADAWRSQSSL 252

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
                 +    + + G         +    +  L+  + + LA +I+  ++ ++K F   
Sbjct: 253 QGLEASLSAAQTVWAG---------VDNKGLRGLLPADQKPLADKIDAAYAASLKLF--- 300

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
              A    S  +M+S  +  G + + +L + L         ++  AL +  
Sbjct: 301 ---ASTQRSLTEMLS--DDAGRQQLNDLYDSLNVVHRLHEGELAKALGIQL 346


>gi|325335314|gb|ADZ11588.1| Peptidase M75, Imelysin [Riemerella anatipestifer RA-GD]
          Length = 387

 Score =  120 bits (301), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 58/424 (13%), Positives = 122/424 (28%), Gaps = 80/424 (18%)

Query: 2   YFITIISIVFTL----------PSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCART 50
           YF    S +F L          P+    +      +++L+++A        E     A  
Sbjct: 3   YFKLFFSALFCLVLFSCGGNDSPTENAKVDDGFDRKEMLRHWADNFIIPYTEKFKDEATN 62

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV--DTWDKKVNAWPLDE 108
           LD+ I+     PN+ +L   R    +    YQ    YR G        +  +VN +P + 
Sbjct: 63  LDTKIKAFAQEPNQTHLTAVREALNKTYEAYQYIGFYRLGKAEEVSMNFLYRVNTYPTNT 122

Query: 109 GFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNI 168
             I      +     + +      IA                                  
Sbjct: 123 ERIKQNAKDHNYNFRQLSEIQGGKIA---------------------------------- 148

Query: 169 TTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLE 228
             G   I++L+ G + + N                 +G        YL  +S  ++    
Sbjct: 149 -QGLPAIDYLVNGLEPEDNAILMEY----------TSGQEAAAYKAYLSALSAEILKSAT 197

Query: 229 EMMKAWGPDGQATKDLMKD---INAGLNSIITGMTSLSYNELAGERMNLGLI-------- 277
           E++      G   K +       +  ++ ++          L   ++             
Sbjct: 198 EVLAD-WKGGYRNKFVENTDSNASGSISLMVNAYVQYYEKNLRAAKIGYPSGVLTPMFLA 256

Query: 278 ---LHDPEQEIDCFS-DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR 333
                 P      F+   + A  L     ++  + G+ I             D ++  N 
Sbjct: 257 QSEAPKPHLIESQFAPQYSRAYALLGTKAMLEFFQGKGINGK-SGKSLQHYIDYMATKNA 315

Query: 334 ---NLAQEINDKFSNTMKDFHILKDRAENIESFD--QMISENNPEGNKIVRNLINDLITQ 388
               L+Q+I  +F   +K+   L    +   + D  QM +        + +  ++ + + 
Sbjct: 316 HHKTLSQDIVRQFEEAIKNIEALNPNLKIQITQDLAQMKNAYFSLQQNVSKLKVDMVQSL 375

Query: 389 TESL 392
             ++
Sbjct: 376 NITI 379


>gi|254448071|ref|ZP_05061534.1| conserved hypothetical protein [gamma proteobacterium HTCC5015]
 gi|198262197|gb|EDY86479.1| conserved hypothetical protein [gamma proteobacterium HTCC5015]
          Length = 422

 Score =  120 bits (300), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 48/417 (11%), Positives = 110/417 (26%), Gaps = 80/417 (19%)

Query: 20  IVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
                  + ++ N A  I      +    A  L +A+++    P+   +  A+  W  A 
Sbjct: 58  PCDGFDCKALVANIADNIIVPATAEFKTEADALKTAVDSYCADPDANLIAPAQTAWSEAM 117

Query: 79  IPYQQSEVYRFGNKIV--DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
             +Q  E+ + G      +     + +WP                        +  +   
Sbjct: 118 AAFQALELMQVGPLADKSNALRDTIYSWPA---------------------VNSCGVDQD 156

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
            I       D++  + D                 G   +E+LL    L  +         
Sbjct: 157 VIEAENAGYDITQRTVDR---------------KGLDALEYLLHTDTLGHSCPTG----- 196

Query: 197 TDFDIGNCTGGHCRR---RVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
            D   G  T     R   R  YL + +  +      +  AW        +L +  +    
Sbjct: 197 VDAVDGWNTRTDGERRTARCGYLTLAAADIAEQANALQSAWQGSDSFANELKQAGSDSSR 256

Query: 254 --------SIITGMTSLSYNELAGERMNLGLI----------LHDPEQEIDCFSDNTYAS 295
                   + ++        +    ++                   E     +S+ +   
Sbjct: 257 YGSTLEAVNALSDALFYFEKKTKDLKLGGPTGIKPIAGCTADQACEEALESPYSETSLDH 316

Query: 296 YLNDVIGIISSYTGEYIRMNGEKIHGASIHDLIS-HNNRNLAQEINDKFSNTMKDFHILK 354
             N+ + + + Y G       E        D +      N++Q +    +  +     + 
Sbjct: 317 IRNNAVTLQTLYLGNKAGEADEI----GFDDFLENAGGTNVSQTLAQDIAAVITAVDNIP 372

Query: 355 D-RAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN 410
           D   +   + +   +      +K V +             ++   + L  P    G+
Sbjct: 373 DNTLKEAINNNMATAREVHAQSKKVTD------ELKRDFLEV---IGLSIPAAAAGD 420


>gi|312962820|ref|ZP_07777307.1| lipoprotein [Pseudomonas fluorescens WH6]
 gi|311282847|gb|EFQ61441.1| lipoprotein [Pseudomonas fluorescens WH6]
          Length = 354

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 49/411 (11%), Positives = 120/411 (29%), Gaps = 86/411 (20%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++    P    ++      ++V           Y   +   R L  +         
Sbjct: 11  LAALALGACSPQDPQAVTSAAIAKQV-------ILPTYSRWVEADRQLAVSALAYCQ--G 61

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           K+NL+ AR  ++ A+  + + +    G         +V  WP  +  +            
Sbjct: 62  KENLDTARADFLHAQKAWAELQPLLIGPLAEGNRSWQVQFWPDKKNLV------------ 109

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                           V +       I    L K        + +  G    E++L+   
Sbjct: 110 -------------GRQVEQLVEAQPQIDGAALAKS-------SVVVQGLSAYEYILYDAK 149

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                                      R    L  + +   +  EE++ +W         
Sbjct: 150 TDLADDAQK-----------------ARYCPLLVAIGERQKALAEEILASWNSTDGMLAQ 192

Query: 244 LMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTY 293
           + K  N         +  L   ++       +++   +      +  P Q     S ++ 
Sbjct: 193 MTKFPNQRYADSHEAIADLLRVQVTALDTLKKKLGTPMGRQTKGIPQPFQADAWRSQSSL 252

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
            S    +    + + G         +    +  L+  + + LA +I+  ++ ++K F   
Sbjct: 253 QSLEASLTAARTVWVG---------VDNKGLRGLLPADQKPLADKIDAAYAASLKLF--- 300

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
              A N  + ++++  N+  G + + +L + L         ++  AL +  
Sbjct: 301 ---ASNQRTLNELL--NDDAGRQQLNDLYDSLNVVHRLHEGELAKALGIQL 346


>gi|315022959|gb|EFT35980.1| hypothetical protein RAYM_09789 [Riemerella anatipestifer RA-YM]
          Length = 387

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 58/424 (13%), Positives = 121/424 (28%), Gaps = 80/424 (18%)

Query: 2   YFITIISIVFTL----------PSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCART 50
           YF    S +F L          P+    +      +++L+++A        E     A  
Sbjct: 3   YFKLFFSALFCLVLFSCGGNDSPTENAKVDDGFDRKEMLRHWADNFIIPYTEKFKDEATN 62

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV--DTWDKKVNAWPLDE 108
           LD+ I+     PN+ +L   R    +    YQ    YR G        +  +VN +P + 
Sbjct: 63  LDTKIKAFAQEPNQTHLTEVREALNKTYEAYQYIGFYRLGKAEEVSMNFLYRVNTYPTNT 122

Query: 109 GFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNI 168
             I      +     + +      IA                                  
Sbjct: 123 ERIKQNAKDHNYNFRQLSEIQGGKIA---------------------------------- 148

Query: 169 TTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLE 228
             G   I++L+ G + + N                 +G        YL  +S  ++    
Sbjct: 149 -QGLPAIDYLVNGLESEDNAILMEY----------TSGQEAAAYKAYLSALSAEILKSAT 197

Query: 229 EMMKAWGPDGQATKDLMKD---INAGLNSIITGMTSLSYNELAGERMNLGLI-------- 277
           E++      G   K +       +  ++ ++          L   ++             
Sbjct: 198 EVLAD-WKGGYRNKFVENTDSNASGSISLMVNAYVQYYEKNLRAAKIGYPSGVLTPMFLA 256

Query: 278 ---LHDPEQEIDCFS-DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR 333
                 P      F+   + A  L     ++  + G+ I             D ++  N 
Sbjct: 257 QSEAPKPHLIESQFAPQYSRAYALLGTKAMLEFFQGKGINGK-SGKSLQHYIDYMATKNA 315

Query: 334 ---NLAQEINDKFSNTMKDFHILKDRAENIESFD--QMISENNPEGNKIVRNLINDLITQ 388
               L+Q+I  +F   +K+   L    +   + D  QM +        + +  ++   + 
Sbjct: 316 HHKTLSQDIVRQFEEAIKNIEALNPNLKIQITQDLAQMKNAYFSLQQNVSKLKVDMAQSL 375

Query: 389 TESL 392
             ++
Sbjct: 376 NITI 379


>gi|77460711|ref|YP_350218.1| putative lipoprotein [Pseudomonas fluorescens Pf0-1]
 gi|77384714|gb|ABA76227.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 354

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/411 (11%), Positives = 115/411 (27%), Gaps = 86/411 (20%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++    P    ++      + V           Y   +   + L  +         
Sbjct: 11  LAALALGACSPQDPQAVTSAAIAKSV-------ILPTYTRWVEADKQLAVSALAYCQ--G 61

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           K++L+ AR  ++ A+  + + +    G         +V  WP  +  +            
Sbjct: 62  KESLDTARADFLHAQKAWAELQPLLIGPLAEGNRSWQVQFWPDKKNLV------------ 109

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                           V +       I    L K        + +  G    E++L+   
Sbjct: 110 -------------GRQVEQLVTAQPQIDAAALAKS-------SVVVQGLSAYEYILF--- 146

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                         D            +    L  + +      EE++ +W         
Sbjct: 147 --------------DAKPDVANDAQKAKYCPLLVAIGERQKQLAEEILSSWNNTDGMLAQ 192

Query: 244 LMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTY 293
           + K  N         +  L   ++       +++   +      +  P Q     S ++ 
Sbjct: 193 MSKFPNQRYADSHEAIADLLRVQVTALDTLKKKLGTPMGRQSKGVPQPFQADAWRSQSSM 252

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
            S    +    + + G         +    +  L+    + LA +I+  ++ ++K F   
Sbjct: 253 ESLEASLAAAKTVWEG---------VDNKGLRGLLPAEQKPLADKIDAAYAASLKLF--- 300

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
                   S  +M+  N+  G + + ++ + L         ++  AL +  
Sbjct: 301 ---GSTQRSLTEML--NDDAGRQQLNDIYDSLNVVHRLHEGELAKALGIQL 346


>gi|229592361|ref|YP_002874480.1| hypothetical protein PFLU4974 [Pseudomonas fluorescens SBW25]
 gi|229364227|emb|CAY51917.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 354

 Score =  117 bits (293), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 46/411 (11%), Positives = 118/411 (28%), Gaps = 86/411 (20%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  +++    P    ++      ++V           Y   +   R L  +         
Sbjct: 11  LAALALGACSPQDPQAVTSAAIAKQV-------ILPTYSRWVEADRQLAVSALAYCQ--G 61

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
           K++L+ AR  ++ A+  + + +    G         +V  WP  +  +            
Sbjct: 62  KESLDTARADFLHAQKAWAELQPLLIGPLAEGNRAWQVQFWPDKKNLV------------ 109

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                           V +       I    L K        + +  G    E++L+   
Sbjct: 110 -------------GRQVEQLVASQPQIDGAALAKS-------SVVVQGLSAYEYILY--- 146

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
                         D            R    L  +     +  EE++ +W         
Sbjct: 147 --------------DAKTDIADDAQKARYCPLLMAIGDRQKALAEEILASWNSTDGMLAQ 192

Query: 244 LMKDINAGLNSIITGMTSLSYNELAG-----ERMNLGL-----ILHDPEQEIDCFSDNTY 293
           + K  N         +  L   ++       +++   +      +  P Q     S ++ 
Sbjct: 193 MTKFPNQRYADSHEAIADLLRVQVTALDTLKKKLGTPMGRQTKGIPQPFQADAWRSQSSL 252

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
            S    +    + + G         +    +  L+    + LA +I+  ++ ++K F   
Sbjct: 253 QSLQASLAAAQTVWVG---------VDNKGLRGLLPSEQKPLADKIDAAYAASLKLFD-- 301

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
                N  + +++++  +  G + + ++ + L         ++  AL +  
Sbjct: 302 ----SNPRTLNELLA--DDAGRQQLNDIYDSLNVVHRLHEGELAKALGIQL 346


>gi|94499739|ref|ZP_01306275.1| hypothetical protein RED65_14497 [Oceanobacter sp. RED65]
 gi|94427940|gb|EAT12914.1| hypothetical protein RED65_14497 [Oceanobacter sp. RED65]
          Length = 433

 Score =  116 bits (291), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 69/385 (17%), Positives = 130/385 (33%), Gaps = 77/385 (20%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
               V+ E++L       + +  DAL  A+TLDS I +L+  PN  +LE ++  W +A  
Sbjct: 38  AKAEVNSEQLLSAMNLYVYTQLSDALNKAQTLDSEITSLLHHPNPVSLEQSQNAWQQAYE 97

Query: 80  PYQQSEVY----RF-------GNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
            Y +        RF        N+  D   +++++WP++ G+IDY+              
Sbjct: 98  GYVKVSFLHRVPRFEKPQYYENNRTYDDIRQRIDSWPIEPGYIDYLPQ----------YP 147

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL---- 184
            + I+ +  + ++           D L   H         + G+H +EFLL+ ++     
Sbjct: 148 LSGIVNDLTLKISL----------DNLVDQHGF-SDPRYASIGFHPLEFLLFAENSERSA 196

Query: 185 --------------------KTNVREPGNRPYTDFDIGNCTGG--------HCRRRVEYL 216
                                       +  + D DI +            +  RR +YL
Sbjct: 197 KDFIPQENSMEVVATEPEIQAETQAINSDAEHVDSDIKDIRHAQPVINGPQNHNRRRDYL 256

Query: 217 KVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG--LNSIITGMTSLSYNELAGERMNL 274
           +++S  LV  L+ +   W P         +  +    + S+  G+      +L  +   +
Sbjct: 257 RILSADLVKQLQALTDRWDPANGYYAKQWRQPDHAANVASLYQGLVDALQTDLLEQHFQV 316

Query: 275 GLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRN 334
                        F+    A+    + GI +    E                 I   +  
Sbjct: 317 LATQKPLYDLRSPFAQQDTANMQALLTGIENILLAE-----------NGFIKEIRLQDAE 365

Query: 335 LAQEINDKFSNTMKDFHILKDRAEN 359
           LA +I  +F     D   L +  E 
Sbjct: 366 LADKIKAQFERLKYDMKQLPNNWET 390


>gi|163738588|ref|ZP_02146002.1| hypothetical protein RGBS107_11207 [Phaeobacter gallaeciensis
           BS107]
 gi|161387916|gb|EDQ12271.1| hypothetical protein RGBS107_11207 [Phaeobacter gallaeciensis
           BS107]
          Length = 374

 Score =  116 bits (291), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 52/411 (12%), Positives = 112/411 (27%), Gaps = 98/411 (23%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
           T  + V T  +   ++ P   L+ +L ++       ++     + TL     +   TP+ 
Sbjct: 40  TDTTAVSTPNTPPQTLAPAHQLDWILTHH---ILPGFDRLAQTSATLAEVAASHC-TPDD 95

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
                 R  + RA   +  +   RFG    D     +  WP     I         E   
Sbjct: 96  P---ALRDAFARAFDAWIAASHLRFGPTETDNRAFALAFWPDSRNKIPGTLRRALTEATR 152

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
           + L  A+  A+                              +    G++ +E+LL+    
Sbjct: 153 DTLTDADTFASQ-----------------------------SVALRGFYALEYLLFDN-- 181

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG--------- 235
                               + G   +R   +  +S  +      +   W          
Sbjct: 182 -----------------AIQSEGTADQRCALVAAISADIARTTAAIRDDWHNSYAVTLVS 224

Query: 236 -PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLI---LHDPEQEIDCFSDN 291
              G   +   +       ++ TG   L        R+   L       P +     S  
Sbjct: 225 PGPGNRYQSEAEIRQELFKTLTTGFQVLV-----DMRLGRPLGQFDAPRPNRAEARRSAR 279

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH 351
           +    +  +  +                    +   ++  +  L Q+I+  F+  +K   
Sbjct: 280 SQRHIVLTLTAME------------------PLALALAAGDPALMQDIHAGFAKALKRAS 321

Query: 352 ILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
            L D +    +             + ++  INDL +   +  ++   L + 
Sbjct: 322 ALDDPSLAGVA-----DPARRFRIEALQQDINDLRSLITT--RLGPKLGVT 365


>gi|159043118|ref|YP_001531912.1| hypothetical protein Dshi_0565 [Dinoroseobacter shibae DFL 12]
 gi|157910878|gb|ABV92311.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 338

 Score =  116 bits (290), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 44/410 (10%), Positives = 110/410 (26%), Gaps = 91/410 (22%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M  + +  ++   P  A +      ++ ++   +     ++      +  L  A      
Sbjct: 1   MKHLLVTFLLTCAPVLAFADDNAPDIDGIV---SDHILPRFAMLSETSADLSHAAAQECR 57

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
                +    R  +  A   +  +   RFG   VD     +  WP   G    V S    
Sbjct: 58  A----DAPELRAAYGAAFDAWIAASHLRFGPTEVDDRAFALAFWPDSRGATPRVLSDL-- 111

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
                                       I + D + +        +    G++ +EFLL+
Sbjct: 112 ----------------------------IATEDPVAQGGETYSDVSIAARGFYALEFLLY 143

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ- 239
              L                    T G+   R   ++ ++  + +    ++  W      
Sbjct: 144 DPGL-------------------STVGNADFRCTLVRTITADIAATAAAILADWETRYAD 184

Query: 240 -----ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDN 291
                    + +     L  +   +T+      A  R+   L       P +     S  
Sbjct: 185 LLRTPRADGVYRTEQEALQEMFKAVTTG-LQFTADTRLGRPLGTFERPRPMRAEARRSGR 243

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH 351
           +       +  +                    +   ++  N  L + + D+F+       
Sbjct: 244 SARHVAISLASVED------------------LALRLATGNAALRERLGDQFARAQSRLK 285

Query: 352 ILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            L D       F  + +       ++++  +N++ +      ++   + +
Sbjct: 286 ALDDPI-----FASVTAPQTRLKVEVIQQSVNEIRSTVS--DRLGPKIGV 328


>gi|126727959|ref|ZP_01743783.1| hypothetical protein RB2150_00045 [Rhodobacterales bacterium
           HTCC2150]
 gi|126702762|gb|EBA01871.1| hypothetical protein RB2150_00045 [Rhodobacterales bacterium
           HTCC2150]
          Length = 332

 Score =  116 bits (289), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 47/403 (11%), Positives = 110/403 (27%), Gaps = 92/403 (22%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           I I   +    L+   N S+  ++ N+      ++E     ++ L          P   +
Sbjct: 4   ILIAAAVVCAPLAATANPSISAIIDNH---ILPRFEALASTSQALSETAAQDCD-PTSDD 59

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L   R  +  A   +  +   RFG   VD     +  WP   G                 
Sbjct: 60  L---RTAYGVAFDAWVSASHLRFGPTEVDDRAFALAFWPDSRG----------------- 99

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
                           + +   I   D +     A    +    G++ +EFLL+  +L  
Sbjct: 100 -------------ATPRALAALIADEDPIGLDAEAYSEVSIAARGFYALEFLLYDDELMQ 146

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ-----AT 241
                                        ++ V++ + +    +   W            
Sbjct: 147 PR---------------------DYHCALVQTVTEDIAATSLAIHNDWQTHKGVLLSPGP 185

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDNTYASYLN 298
               +     L  ++  +T+         R+   L       P +     S  +    + 
Sbjct: 186 DATYRSDEEVLQEMLRALTAG-LQFTQDSRLGRPLGTFDRPRPTRAEARRSGRSAQHVML 244

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
            ++ +                    +   ++ ++  LA  +N +F +++     L D   
Sbjct: 245 SLMSLQD------------------LASHLAVSDATLANTLNRQFEDSLGKLADLDDSVF 286

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
              +        +    ++V   I  + T  ++  ++   L +
Sbjct: 287 AGVA-----DPQSRLRVEVVSQSIGTIRTTVQA--ELGPTLGV 322


>gi|87122312|ref|ZP_01078194.1| hypothetical protein MED121_03537 [Marinomonas sp. MED121]
 gi|86162455|gb|EAQ63738.1| hypothetical protein MED121_03537 [Marinomonas sp. MED121]
          Length = 357

 Score =  115 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/380 (11%), Positives = 102/380 (26%), Gaps = 73/380 (19%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTP 62
           +T +S+   L + A ++                +    Y+     A  L + I++     
Sbjct: 9   LTFVSLTLPLLTSANTLNDQSPWSDTFNGINKELIIPNYDAFAQSALDLSTGIQSFCQQA 68

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           ++  L   +  +      +QQ +   FG   +         WP  +G             
Sbjct: 69  DENTLVQTQALFKANLSDWQQVQWLNFGPVTLFMRYYSFEYWPDKKGL------------ 116

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                   ++I N     ++K    + I                    G   IE LL+  
Sbjct: 117 --TQRQLTSLIKNDVDTQDDKFWRSASI-----------------AVRGLTAIEALLYRP 157

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
                                    +     + L  V +        ++     +GQ   
Sbjct: 158 QFDPI--------------------NKPEYCDLLVQVGEHHQQSTANIL-LEWQNGQLED 196

Query: 243 DLMKDINAGLNSIITGMTSLSYNE------LAGERMNLGLILH---DPEQEIDCFSDNTY 293
            +  D +   N I   +  +          +   ++   +  H   + +      S+ + 
Sbjct: 197 WMYLDEDESGNLITLSLEKMIQQWLEHISMVKESKIETPIGWHGKTNVKLAEFYRSEQSL 256

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
            +   ++    + Y               S++D+       LA++++      +   + L
Sbjct: 257 VAIKENIKLYNALYHAGSK----------SLYDMAKLKEPALAEQLDQSLKQALVKVNAL 306

Query: 354 KDRA-ENIESFDQMISENNP 372
                    + D+ I+   P
Sbjct: 307 PSHFYSASLAKDERINMATP 326


>gi|300772152|ref|ZP_07082022.1| iron-regulated protein A [Sphingobacterium spiritivorum ATCC 33861]
 gi|300760455|gb|EFK57281.1| iron-regulated protein A [Sphingobacterium spiritivorum ATCC 33861]
          Length = 328

 Score =  115 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 61/406 (15%), Positives = 120/406 (29%), Gaps = 95/406 (23%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           F+ ++ +   +   A     N  ++ +    + I    ++        L  AI+  +   
Sbjct: 5   FLGLVILPVLVSCSAGQDKINTQIKIIDNIESHIIIPTHQLLCERVIDLQGAIQR-IEIG 63

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVN--AWPLDEGFIDYVDSSYGK 120
           N  +L  AR  W+  R  ++Q+E Y  G   +    ++++   +PL +   D ++     
Sbjct: 64  NDISLLQARDAWVETRELWEQAEGYAIGESKIVRIRQRMDESTYPLSQQQPDRINKGE-- 121

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
                                                              +  IE++LW
Sbjct: 122 ---------------------------------------------------FQQIEYILW 130

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           G D        G R   D    +            L  +S  +V    +++         
Sbjct: 131 GSD--------GMRMAADLTETDLAS---------LMTISDSMVVQTNQLLAFAKETAWT 173

Query: 241 TKDLMKDINAGLNSI-------ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTY 293
              L        + I         G       ++   ++          Q  + +SDNT 
Sbjct: 174 KTKLKAKNEEQRSQICQQRMKDYVGGMIGVTQQILETKITEPDAPISAVQIEEPYSDNTK 233

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
           +  LN++I I + YTG           GA I  ++   ++ L + +     ++ K  + L
Sbjct: 234 SDILNNIIAIENLYTGRLD-----LHKGAGIAAVVDRQDKVLDETLRKSIEDSKKAINAL 288

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            +      S D             V      L T  E L+   + L
Sbjct: 289 PESYSMALSND----------RDAVLVAKVKLQTLQELLKDRLLPL 324


>gi|283458453|ref|YP_003363079.1| putative periplasmic lipoprotein [Rothia mucilaginosa DY-18]
 gi|283134494|dbj|BAI65259.1| predicted periplasmic lipoprotein involved in iron transport
           [Rothia mucilaginosa DY-18]
          Length = 408

 Score =  115 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/387 (12%), Positives = 106/387 (27%), Gaps = 119/387 (30%)

Query: 14  PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ 73
            +  +S       +  +  Y                 L +  E          +E A+  
Sbjct: 139 NAGTISADEQALRDTAVTQYTAYVK-------DQVEALKTKTEQFAELYTAGKVEEAKAL 191

Query: 74  WIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
           +  AR+ Y++ E                   P+ E F D   +                 
Sbjct: 192 YSSARLHYERIE-------------------PVAESFGDLDPALDA-------------- 218

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN 193
                                      A+  +    TG+H IE  LW    +    + G 
Sbjct: 219 -------------------------READVEEGKEWTGWHKIEKDLW----QPTAEKNGG 249

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
           + YT                E    ++K LV+D +++           +           
Sbjct: 250 KEYTPLT------------KEQRAELAKKLVADTQKLYDEVHSSEFKLEAF--------- 288

Query: 254 SIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR 313
            I  G   L  +E+   +++          E + +S    + +  ++ G   +Y      
Sbjct: 289 QISNGAKEL-LDEVVNTKISG---------EEETWSHTDLSDFQGNIDGARVAYE----- 333

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPE 373
                     +  ++   +  LA++I  KF    K  +  K   ++  S++++      E
Sbjct: 334 ---------DVLPILKQKDPKLAEDIAKKFDAVQKLLNQHKK-GDSFVSYEEL----TKE 379

Query: 374 GNKIVRNLINDLITQTESLRKIRIALD 400
             + + + +  L      + ++     
Sbjct: 380 QVRELSDAVEALSEPVSKMTEVVTGAG 406


>gi|126666891|ref|ZP_01737867.1| hypothetical protein MELB17_06619 [Marinobacter sp. ELB17]
 gi|126628607|gb|EAZ99228.1| hypothetical protein MELB17_06619 [Marinobacter sp. ELB17]
          Length = 366

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 54/413 (13%), Positives = 114/413 (27%), Gaps = 88/413 (21%)

Query: 14  PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN---- 69
              A +       ++    +       Y+     + TL    +     P+ +        
Sbjct: 26  ALAASAEFGTAVEQQTRAGWHQGIGRGYQALANDSETLLQQAKAYCQQPSTEARSTIAHS 85

Query: 70  ------ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
                     W +A   +QQ     FG    +    ++  WP  +  I            
Sbjct: 86  TVARSTVESAWKQAFKAWQQVRFVDFGPVETNNRAWQLQFWPDPKNLI------------ 133

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                                    ++  D         G       G+ ++E+LL    
Sbjct: 134 --------------------ARKADLLLKDGTAVSAETVGQAGVAVQGFPMLEYLLSDTR 173

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
             T                           + L  V+  +V + ++++  W   G+    
Sbjct: 174 FNTGDHALP----------------AETSCQILIQVAAHVVDNSQQLVADW---GEFKPH 214

Query: 244 LMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEI---DCFSDNTYASYLNDV 300
            +   N    +I   MT+L   E       +GL  +            S ++ AS    V
Sbjct: 215 YLATGNYTHATIRAAMTALEVVEERRLATPMGLRGNGKRSVYAADAWRSGSSLASIGASV 274

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNN-RNLAQEINDKFSNTMKDFHILKDRAEN 359
            G+   +                +  L++     +LAQ IN +F   ++ F  +    + 
Sbjct: 275 DGLQKYFL-------------PGLEKLLNEQGESDLAQRINKQFGEVLEHFPAMDLALKP 321

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALD-LIEPNRVIGN 410
                 ++ ++N    + ++ L  D+   T  +  +    L  +   N   G+
Sbjct: 322 ------LLDDDNA--YRSLQGLYVDVSQLTTLVNGEAATRLGVIRGFNASDGD 366


>gi|86136369|ref|ZP_01054948.1| hypothetical protein MED193_19639 [Roseobacter sp. MED193]
 gi|85827243|gb|EAQ47439.1| hypothetical protein MED193_19639 [Roseobacter sp. MED193]
          Length = 348

 Score =  115 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 44/404 (10%), Positives = 114/404 (28%), Gaps = 89/404 (22%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           II  +    +   S+V    ++++L           +     +  L    +T+   P   
Sbjct: 18  IIFALAIGAAFTPSLVRADIVDEILD---DQVLPAMQALAESSEDLAQIAQTICR-PGAS 73

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
            L   R  + +A   + +    RFG    +     +  WP   G                
Sbjct: 74  PL---RDAYHQAFDAWVRVSHLRFGPTETNNRAFALAFWPDSRGK--------------- 115

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
                       +  + +  D ++++P+ + +   A         G++ +EF+ + Q+  
Sbjct: 116 --------TPKTLAKHLRSADPALLTPEGIAQSSIAG-------RGFYALEFMYFDQNFT 160

Query: 186 TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ----AT 241
           +                         R      +++ +  +   + + W         + 
Sbjct: 161 SAKP-------------------HEYRCALTAAMAQDIAVNTAAIHRDWQDSYADQMRSA 201

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDNTYASYLN 298
               +D       +   + +     LA  R+   L       P++     S  +    + 
Sbjct: 202 SGRYQDETEVKQELYKSLNTG-LQLLADMRLGRPLGSFDKPRPKRAEAWRSGRSQHHIVL 260

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
            +  +                    +   ++  +++L   +   F   +     L D   
Sbjct: 261 ALQSLQ------------------PLAIALADGDQDLIARLETAFQKPILRALRLDDPRL 302

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
              +        N    + ++  +NDL    ES   +  +L ++
Sbjct: 303 AGVA-----DPANRFRLEALQQEVNDLRALIES--DLGPSLGVL 339


>gi|319901230|ref|YP_004160958.1| Peptidase M75, Imelysin [Bacteroides helcogenes P 36-108]
 gi|319416261|gb|ADV43372.1| Peptidase M75, Imelysin [Bacteroides helcogenes P 36-108]
          Length = 388

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/231 (16%), Positives = 80/231 (34%), Gaps = 32/231 (13%)

Query: 17  ALSIVPNVSLEKVLQNYATIA-HAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
             ++  N  L+ ++ +Y  +     Y         L +A +   +TP+  N E     W+
Sbjct: 181 TAAVNTNAVLDPIIVSYVDVVVLPTYNSLKEKNAALYTAAQKFNSTPSNANFEAVCEAWL 240

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
            AR P++ SE + FG       D  +++WPLD+  I  + +S   ++   +    N    
Sbjct: 241 EARQPWETSEAFLFGPVDALGLDPNMDSWPLDQSAIVNILNSGNYDDLNWSDGDNN---- 296

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
                                              G+H +EFL +   +   + +  +  
Sbjct: 297 -------------------------DKVEAAQSVRGFHTLEFLAFRNGVARTLTDVAD-- 329

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
            ++      T  +      Y+  V+ +L SD E +  +W    +  +    
Sbjct: 330 SSNSADLVYTSANAASWGNYMVQVAYLLKSDAETLYNSWSVSYEGGESYAA 380



 Score = 76.9 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 57/159 (35%), Gaps = 16/159 (10%)

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQ------EIDCFSDNTYASYLND 299
           ++  + +  I+ G      NE+   ++   +     +Q          +S ++   Y N+
Sbjct: 36  EEAFSCIEQILDGCMD-IANEVGETKIGEPVSKWATDQTAALYSVESWYSWHSREDYSNN 94

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
           +  I ++Y G      G      S+ +LI+ NN +L  ++ +  S+ +     +K    N
Sbjct: 95  IYSIRNAYYGTLDGTVGTN----SLANLIAKNNASLDTQVRNAISDAVDAILAIKSPFRN 150

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIA 398
             +  +  +           +L + L      + +    
Sbjct: 151 NINSTEARTAMTA-----CADLNDVLKDLKGYIERTAAV 184


>gi|330973347|gb|EGH73413.1| putative lipoprotein [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 354

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 52/404 (12%), Positives = 114/404 (28%), Gaps = 86/404 (21%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
              PS   ++      ++V           Y   +   R L ++           +L  A
Sbjct: 18  VCSPSDPQAVTSAAIAKQV-------ILPTYSRWVEADRQLAASALAFCQGKT--DLATA 68

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           R  +++A+  + + +    G         ++  WP  +  +                   
Sbjct: 69  RADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV------------------- 109

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
                    V +       I+   L K        + +  G    E++L+  D+     E
Sbjct: 110 ------GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILFDADIDMANAE 156

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
                               R    L  + +      EE++ +W         L K  N 
Sbjct: 157 QK-----------------ARYCPLLMAIGERQKQLAEEILNSWNSTDGMLAQLSKFPNQ 199

Query: 251 GLNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDV 300
                   +  L   ++       +++   L         P Q     S ++ +S    +
Sbjct: 200 RYADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASL 259

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           I   + +TG         +    +  L+    + LA +I+  ++N+ K    LK    ++
Sbjct: 260 ISAETVWTG---------VDNKGLRSLLPAEQKPLADKIDAAYANSRKLLSELKPPLADL 310

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
            + D         G + +    + L         ++  AL +  
Sbjct: 311 LATD--------AGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|330721296|gb|EGG99381.1| hypothetical protein imdm_1167 [gamma proteobacterium IMCC2047]
          Length = 374

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/416 (12%), Positives = 113/416 (27%), Gaps = 80/416 (19%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           ++  +F++     S  P    + +      +    Y +     + L    +     P+++
Sbjct: 21  LLVALFSVLLVGCSKAPT-EPKLLADTANQVISPLYAELNSQTQQLFQQSQAFCQAPSEQ 79

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
             +  + QW      + + +   FG         K+  WP  +                 
Sbjct: 80  TQQQLQQQWRDTMNAWARVQPIGFGPVETGNLRWKIQFWPDRK----------------- 122

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
                         +  K+ +  I S + L          +    G   +E+LL+ +   
Sbjct: 123 -------------DLTSKKTEALIRSDEALTA--ERVAAASVSGQGVAALEYLLFDER-- 165

Query: 186 TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD-- 243
                                    RR E L+ +++ +    +++   W           
Sbjct: 166 --------------VKAVSFYQQNSRRCELLQAIAERVHQVTQQVEDEWPDFAAKFAQPS 211

Query: 244 ----LMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL------HDPEQEIDCFSDNTY 293
               L  D  A L  ++  +       +   ++ L +          P +     S  + 
Sbjct: 212 VDNPLYPDNKAALAELLNTLVVGGEV-VKRNKLGLPIANGANAQHAKPYRLEAWRSQYSL 270

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR---NLAQEINDKFSNTMKDF 350
           A        +   Y G           G  +   +   +     L   I++ F+     F
Sbjct: 271 ALMRASTETLEQLYRGN---------GGFGLSAYLQEQDAVDDTLLGAIDEAFAAVNTQF 321

Query: 351 HILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLIEPN 405
             ++        F Q+           +R  ++ L  Q   L  K+ I+L     +
Sbjct: 322 AAIEAPL-----FTQIKQPEYYAQLTNLRQRLDLLQRQLAKLPEKLDISLGFNSND 372


>gi|302189747|ref|ZP_07266420.1| putative lipoprotein [Pseudomonas syringae pv. syringae 642]
          Length = 354

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 52/403 (12%), Positives = 114/403 (28%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVEADRQLAASALAFCQGKT--DLAAAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+  D+     E 
Sbjct: 110 -----GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILFDADIDMANAEQ 157

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                              R    L  + +      EE++ +W         L K  N  
Sbjct: 158 K-----------------ARYCPLLMAIGERQKQLAEEILNSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++N+ K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLLPTEQKPLADKIDAAYANSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           + D         G + +    + L         ++  AL +  
Sbjct: 312 ATD--------AGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|222147267|ref|YP_002548224.1| hypothetical protein Avi_0333 [Agrobacterium vitis S4]
 gi|221734257|gb|ACM35220.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 374

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 43/314 (13%), Positives = 97/314 (30%), Gaps = 61/314 (19%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
            +      HA ++      + + +         Y + L  A+ L S +  L  +P+++ +
Sbjct: 25  VLAQDATPHATALQTAAVPDVMAKTVDGFIRPGYRNFLDKAKALHSGMNALCASPSEQTV 84

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           + A+  + +A   + + E+ R G  I +   + +  +P  +G                  
Sbjct: 85  KAAKNGFEQALRAWARIEIVRVGPVIEENRFEHILFYPDRKGL----------------- 127

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
                 A  +I       D S   P+ L +        +    G   +E++L+G      
Sbjct: 128 ------ALKQIQGAIASNDDSFTKPEALHE-------KSVAIQGLGALEYVLYGTGSDIL 174

Query: 188 VREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---------GPDG 238
            +  G                   R  Y   ++  + +   E+   W             
Sbjct: 175 NQADG-----------------AFRCRYGAAIAGNIENMAGELSSLWEAPGGIQTAWKQP 217

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERM----NLGLILHDPEQEIDCFSDNTYA 294
               D+ +  +  +  ++ G+       +  ER+            P+Q I   S  T+ 
Sbjct: 218 GPDNDVFRTPSEAVTGLL-GILVHGTETVRDERIETFFKGAGGRIAPKQAIFWRSGLTFV 276

Query: 295 SYLNDVIGIISSYT 308
           S   ++ G+     
Sbjct: 277 SMQENLTGLKQLLN 290


>gi|298488567|ref|ZP_07006597.1| Iron-regulated protein A precursor [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156908|gb|EFH97998.1| Iron-regulated protein A precursor [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 354

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 51/403 (12%), Positives = 112/403 (27%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++       +V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIARQV-------ILPTYSRWVDADRQLATSALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +D                   
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLVDR------------------ 111

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+           
Sbjct: 112 -------QVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      EE++ +W         L K  N  
Sbjct: 147 ------DAEIDMANTEQKARYCPLLMAIGERQKQLAEEILSSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++ + K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLLPAEQKPLADKIDAAYATSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           +           G + +    + L         ++  AL +  
Sbjct: 312 A--------TETGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|307545019|ref|YP_003897498.1| hypothetical protein HELO_2429 [Halomonas elongata DSM 2581]
 gi|307217043|emb|CBV42313.1| K07338 hypothetical protein [Halomonas elongata DSM 2581]
          Length = 340

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/403 (10%), Positives = 105/403 (26%), Gaps = 74/403 (18%)

Query: 10  VFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
           +  L      ++ N    +  + +      +Y      +  L+++       P+  + + 
Sbjct: 10  LAALTLATAPLMANEDTPQARERWHQAIDQRYGVLSDASERLEASAIRFCQQPDTPHRKR 69

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
               W+ A   +Q      FG     +   ++  WP  +  +                  
Sbjct: 70  LSQDWMDAYQAWQAVRFVDFGPIEQQSRAWQLQFWPDRKNLV------------------ 111

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
                  K+                          D+  T G+  +E+LL+ + +     
Sbjct: 112 -----GRKMQAWLAADQPPTA---------EQIAGDSVATQGFPALEYLLFDEHM----- 152

Query: 190 EPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDIN 249
                                     +K ++  L      +   W    +  +      +
Sbjct: 153 -------------ETKTLSQPVACGLMKAIANHLADGTSALRSDWQRFAEHYRTTRSYTD 199

Query: 250 AGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTG 309
           A L+  +  + +L    L    M L     +        S  +       + G+  ++  
Sbjct: 200 ATLHGALRALETLEDKRLGDP-MGLTGGAANGYLAEAWRSGRSIRLIEGTLHGLEDTFL- 257

Query: 310 EYIRMNGEKIHGASIHDLISHNN-RNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
                         +  L++      LA +  +    T      +        + D  ++
Sbjct: 258 ------------PGLKTLLASRGQAELADDFRELLDRTRHRAAEM--SPGLAPALDDSVA 303

Query: 369 ENNPEGNKIVRNLINDLITQTESLRKIRIALDLI-EPNRVIGN 410
            ++      ++ L   +      L +I   L L+   N   G+
Sbjct: 304 FSD------LQGLYVQVGQLRRQLEEIGGTLGLVRGFNSSDGD 340


>gi|257486394|ref|ZP_05640435.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|331009884|gb|EGH89940.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 354

 Score =  113 bits (282), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 50/403 (12%), Positives = 112/403 (27%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLATSALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+           
Sbjct: 110 -----GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      EE++ +W         L K  N  
Sbjct: 147 ------DAEIDMANAEQKARYCPLLMAIGERQKQLAEEILSSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++ + K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLLPAEQKPLADKIDAAYATSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           +           G + +    + L         ++  AL +  
Sbjct: 312 A--------TEAGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|66047291|ref|YP_237132.1| putative lipoprotein [Pseudomonas syringae pv. syringae B728a]
 gi|63257998|gb|AAY39094.1| lipoprotein, putative [Pseudomonas syringae pv. syringae B728a]
          Length = 354

 Score =  113 bits (282), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 52/403 (12%), Positives = 115/403 (28%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L +AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVEADRQLAASALAFCQGKT--DLASAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+  D+     E 
Sbjct: 110 -----GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILFDADIDMANAEQ 157

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                              R    L  + +      EE++ +W         L K  N  
Sbjct: 158 K-----------------ARYCPLLMAIGERQKQLAEEILNSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++N+ K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLLPAEQKPLADKIDAAYANSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           + D         G + +    + L         ++  AL +  
Sbjct: 312 ATD--------AGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|88803061|ref|ZP_01118588.1| predicted periplasmic lipoprotein [Polaribacter irgensii 23-P]
 gi|88781919|gb|EAR13097.1| predicted periplasmic lipoprotein [Polaribacter irgensii 23-P]
          Length = 356

 Score =  113 bits (282), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 52/408 (12%), Positives = 120/408 (29%), Gaps = 86/408 (21%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTT 61
            I  + ++F      LS      L +  Q YA    +    + +   + L+ A       
Sbjct: 10  LIISLVLLFGCNKEELSEKNAFDLFRYRQTYATDFINPAITEFVSDIKKLNEATTKFTAQ 69

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
            N++NL N +  W  A + Y ++EV   G+         + +W  +E  I+         
Sbjct: 70  TNQENLLNLQNLWKNAALSYAKTEVGNLGDIQSSAIYISMYSWGANENKIE--------- 120

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
                          + +   + ID   ++                 T G   +E+LL+ 
Sbjct: 121 ---------------EFVAATETIDEDSVNK------------LPTKTRGLSAVEYLLFN 153

Query: 182 QDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
            +    V    +                 RR ++L  ++K L+     + + W       
Sbjct: 154 DNAAQTVSSFSDV----------------RRKDFLIALNKNLLIKATSLKEQWEVYSDYF 197

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLI-----LHDPEQEIDCFSDNTYASY 296
            +       G  ++I    +    ++   ++            +        S+ + A  
Sbjct: 198 INNTATGITGSVNLIVNQLNFLLEDVLRFKIGEPAGLDNTSSTNTTMLQAYRSEISLAII 257

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNN--RNLAQEINDKFSNTMKDFHILK 354
             ++  + + Y G              + D +       ++   I   FS+   +   L 
Sbjct: 258 QENITAVKAVYYGMPD----------GLDDYVREIATTEDINNAITASFSSIEANIASL- 306

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
                          +N    K + N    +    + ++++ I + + 
Sbjct: 307 ---------------SNTTLKKAIENKNTTVTALHKHIKELIILIKVD 339


>gi|262201527|ref|YP_003272735.1| peptidase M75, Imelysin [Gordonia bronchialis DSM 43247]
 gi|262084874|gb|ACY20842.1| Peptidase M75, Imelysin [Gordonia bronchialis DSM 43247]
          Length = 404

 Score =  113 bits (282), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 53/368 (14%), Positives = 107/368 (29%), Gaps = 101/368 (27%)

Query: 30  LQNYATIAHAKYEDAL-MCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           +      A A Y   +     TL +  ++ V      NL+ AR Q+   R PY++ E   
Sbjct: 134 VPADVNAAKAAYLSYVRNQLNTLQAQTKSFVDNVKANNLDAARAQFGLTRTPYERIE--- 190

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
                           P+ E F D   +   + ++  +                      
Sbjct: 191 ----------------PVAESFPDLDPAIDMRWDDTEDGAQP------------------ 216

Query: 149 IISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGH 208
                                TG+H IE  LW           G     D      T   
Sbjct: 217 --------------------FTGFHRIERFLWPPQPNEVGDAEGQIAPADAANAKATDTK 256

Query: 209 CRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELA 268
                  +  V+  L++++  +           +           S + G  +L  +E+A
Sbjct: 257 AA-----IDAVADQLLANVNRLHDEVNKPDFTFET---------RSFVQGPQALI-DEVA 301

Query: 269 GERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLI 328
             ++N          E D +S      +  +V              +G +   A++  +I
Sbjct: 302 ATKVNG---------EEDRYSHTDLWDFAANV--------------DGSETAIATMQPII 338

Query: 329 SHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQ 388
              ++ L  +I  +F +        + + E   S+ Q+ ++      + + N I+ L   
Sbjct: 339 VAKDKALMDKITAQFGDVRTAIDKFQ-QGEGYVSYTQVTAD----QRRDLSNKIDALSAT 393

Query: 389 TESLRKIR 396
              +  + 
Sbjct: 394 LSQVPGLV 401


>gi|50955233|ref|YP_062521.1| lipoprotein [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|50951715|gb|AAT89416.1| lipoprotein [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 401

 Score =  113 bits (282), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 61/382 (15%), Positives = 106/382 (27%), Gaps = 123/382 (32%)

Query: 14  PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ 73
              A +      +++ + NY              A  L SA +T        +   AR Q
Sbjct: 137 SGDAKAAGETKQIQQAVTNYTGYVK-------DQAGQLLSATQTFAAAYEAGDDTAARAQ 189

Query: 74  WIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
           +  AR  Y++ E                   P  E F D   +                 
Sbjct: 190 YPAARQHYERIE-------------------PTAEQFGDIDPAL---------------- 214

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN 193
                                   L  A+       TG+H IE  LW             
Sbjct: 215 -----------------------DLREADLEQGQSWTGWHRIEKDLWAP----------- 240

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
                   G+       R+      +   LVSD + +       G          +  L+
Sbjct: 241 -------AGHVPSNAADRKR-----LGDRLVSDTQRLYDLVYAKGF---------SLTLD 279

Query: 254 SIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR 313
            I  G +SL   E+AG ++           E + FS +    +  +V G   +Y      
Sbjct: 280 QISNGASSLME-EVAGSKITG---------EEETFSHSDLWDFAANVEGAQVAYETVRDV 329

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPE 373
           +  +   G           + +A++++ +F+   K         E   S+ Q+    +  
Sbjct: 330 LVEKGDAG-----------KAMAKKLDAEFAAIGKLLSRY-ASGEGYASYTQL----STA 373

Query: 374 GNKIVRNLINDLITQTESLRKI 395
             K + + +N L      L  I
Sbjct: 374 QVKELSDKVNALSEPLSQLTSI 395


>gi|330989420|gb|EGH87523.1| putative lipoprotein [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 354

 Score =  113 bits (281), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 50/403 (12%), Positives = 112/403 (27%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLATSALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+           
Sbjct: 110 -----GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      EE++ +W         L K  N  
Sbjct: 147 ------DAEIDMANSEQKARYCPLLMAIGERQKQLAEEILSSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++ + K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLLPAEQKPLADKIDAAYATSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           +           G + +    + L         ++  AL +  
Sbjct: 312 A--------TETGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|326794856|ref|YP_004312676.1| peptidase M75, Imelysin [Marinomonas mediterranea MMB-1]
 gi|326545620|gb|ADZ90840.1| Peptidase M75, Imelysin [Marinomonas mediterranea MMB-1]
          Length = 359

 Score =  113 bits (281), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 46/407 (11%), Positives = 106/407 (26%), Gaps = 81/407 (19%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
             T ++      ++A +     +L  + +         Y+     ++ L + IETL  +P
Sbjct: 14  LTTALTASLIFSTNAFADDWKSTLSGIKE---DQIAPSYQAFANSSQALSNRIETLCQSP 70

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +   L   +  +      +Q  +   FG             WP  +G             
Sbjct: 71  SASALAKTKDLFAANVDDWQAIQWLNFGPVTYFMRYYAFQYWPDKKGVTQRQL------- 123

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                          +  +   +D                   +    G   IE LL+  
Sbjct: 124 -------------RTLKKDPSVMDQPKFWKAA-----------SIAVRGLTAIESLLYRA 159

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           D     +                          L+ ++K      + + K    D   + 
Sbjct: 160 DFNPVNKPA--------------------DCHLLESIAKHHAETTQSVYKQ-WSDSAVSD 198

Query: 243 DLMKDINAGLNSIITGMTSLSYNE------LAGERMNLGL---ILHDPEQEIDCFSDNTY 293
            +  +  +   +    M  +          +   ++   +       P+      SD   
Sbjct: 199 WVFMEEGSTETADKLAMEQVIQQWLEHMSVVKDSKLETPIGYKGKPKPKFAEFYRSDLAL 258

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
           AS   ++    + Y               S+  +    N   A  ++++     +    L
Sbjct: 259 ASMRTNLTSYQALYHSGN----------PSLFAVALEQNPETANALDEQLIKNQELVGDL 308

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
            D   + +        ++ E   + R L++ +      L K+   L 
Sbjct: 309 PDNYFSNQL-------SHEEKVALARPLVSSISQSQTLLTKVVTELG 348


>gi|330943751|gb|EGH46035.1| putative lipoprotein [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 354

 Score =  112 bits (280), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 52/403 (12%), Positives = 115/403 (28%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L +AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVEADRQLAASALAFCQGKT--DLASAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+  D+     E 
Sbjct: 110 -----GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILFDADIDMANAEQ 157

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                              R    L  + +      EE++ +W         L K  N  
Sbjct: 158 K-----------------TRYCPLLMAIGERQKLLAEEILNSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++N+ K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLLPAEQKPLADKIDAAYANSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           + D         G + +    + L         ++  AL +  
Sbjct: 312 ATD--------AGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|320330117|gb|EFW86104.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330874922|gb|EGH09071.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 354

 Score =  112 bits (280), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 50/403 (12%), Positives = 112/403 (27%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLATSALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+           
Sbjct: 110 -----GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      EE++ +W         L K  N  
Sbjct: 147 ------DAEIDMANTEQKARYCPLLMAIGERQKQLAEEILSSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++ + K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLLPAEQKPLADKIDAAYATSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           +           G + +    + L         ++  AL +  
Sbjct: 312 A--------TETGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|320322415|gb|EFW78508.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. B076]
          Length = 354

 Score =  112 bits (280), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 50/403 (12%), Positives = 112/403 (27%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLATSALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+           
Sbjct: 110 -----GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      EE++ +W         L K  N  
Sbjct: 147 ------DAEIDMANTEQKARYCPLLMAIGERQKQLAEEILSSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLETSLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++ + K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLLPAEQKPLADKIDAAYATSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           +           G + +    + L         ++  AL +  
Sbjct: 312 A--------TETGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|330888535|gb|EGH21196.1| putative lipoprotein [Pseudomonas syringae pv. mori str. 301020]
          Length = 354

 Score =  112 bits (280), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 50/403 (12%), Positives = 112/403 (27%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLATSALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+           
Sbjct: 110 -----GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      EE++ +W         L K  N  
Sbjct: 147 ------DAEIDMANAEQKARYCPLLMAIGERQKQLAEEILSSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++ + K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLLPAEQKPLADKIDAAYATSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           +           G + +    + L         ++  AL +  
Sbjct: 312 A--------TEAGRQQLNAFYDRLNAVHRLHEGELAKALGIQL 346


>gi|110833102|ref|YP_691961.1| hypothetical protein ABO_0241 [Alcanivorax borkumensis SK2]
 gi|110646213|emb|CAL15689.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 345

 Score =  112 bits (280), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 44/409 (10%), Positives = 111/409 (27%), Gaps = 89/409 (21%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
            I+     L    L+   N   E  +Q    +    ++        L  ++E     P +
Sbjct: 4   LIMQGAVALSVLMLAACSNPRQEVTVQLATEVLLPAHQQWHDSNAALMDSVEAYCADP-Q 62

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
            ++E  +  +  A+  +   +    G         +V  WP     +  V  +    +E 
Sbjct: 63  ASVEKMKAAFFHAQSQWSYLQPLMIGPLSEGNRSWQVQFWPDKRNLV--VRQTEALLDEA 120

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
             L                                      + +  G    EF+L+ +  
Sbjct: 121 GPLTG------------------------------EQLEKASVVVQGLTAFEFVLFDE-- 148

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG------ 238
                                     R    LK ++    +  EE++K W          
Sbjct: 149 -----------------SIALASSRDRYCPLLKGIANHQWALSEEVLKLWRGPEGMLLQL 191

Query: 239 -QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGL-----ILHDPEQEIDCFSDNT 292
                +     + GL +I+    +     +  +++ + +      +  P Q     S  +
Sbjct: 192 SDFPNERYATADDGLAAILRVQITGVD--VLKKKLGVPMGRLNKGVAQPYQAEAWRSQQS 249

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHI 352
             +    + G  + +                +  L+S  +  L  +I+  +++       
Sbjct: 250 IENLQASLKGAWAVWQ--------------RVRSLVS--DEGLVSDIDQAYADVNSRMEA 293

Query: 353 LKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           L      +       + ++ +    +   ++ L        ++  AL++
Sbjct: 294 LPGPLVELVQ-----APSHRDTLAALYTALDQLEN--RQQIELARALNI 335


>gi|71735005|ref|YP_276195.1| lipoprotein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71555558|gb|AAZ34769.1| lipoprotein, putative [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 354

 Score =  112 bits (280), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 51/403 (12%), Positives = 112/403 (27%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLATSALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+           
Sbjct: 110 -----GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      EE++ +W         L K  N  
Sbjct: 147 ------DAEIDMANTEQKARYCPLLMAIGERQKQLAEEILSSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +IN  ++ + K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLLPAEQKPLADKINAAYATSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           +           G + +    + L         ++  AL +  
Sbjct: 312 A--------TETGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|330966151|gb|EGH66411.1| lipoprotein [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 354

 Score =  112 bits (280), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 54/403 (13%), Positives = 114/403 (28%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L S+           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLASSALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         +V  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQVQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+           
Sbjct: 110 -----GRQVEQLVTAQPQINAQELAKA-------SVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      EE++ +W         L K  N  
Sbjct: 147 ------DAEIDMANAEQKARYCPLLMAIGERQKLLAEEILSSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+S   + LA +I+  ++ + K    LK    ++ 
Sbjct: 261 SAQTVWTG---------VENKGLRSLLSAEQKPLADKIDAAYATSRKLLSELKPPLVDLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           + D         G + +    + L         ++  AL +  
Sbjct: 312 ATD--------AGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|28871504|ref|NP_794123.1| lipoprotein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28854755|gb|AAO57818.1| lipoprotein, putative [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 354

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 52/403 (12%), Positives = 113/403 (28%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLATSALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         +V  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQVQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+           
Sbjct: 110 -----GRQVEQLVTTQPQINAQELAKA-------SVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      EE++ +W         L K  N  
Sbjct: 147 ------DAEIDMANAEQKARYCPLLMAIGERQKLLAEEILSSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++ + K    LK    ++ 
Sbjct: 261 SAQTVWTG---------VDNKGLRSLLPAEQKPLADKIDAAYATSRKLLSELKPPLVDLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           + D         G + +    + L         ++  AL +  
Sbjct: 312 ATD--------AGREQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|121605458|ref|YP_982787.1| periplasmic lipoprotein-like protein [Polaromonas naphthalenivorans
           CJ2]
 gi|120594427|gb|ABM37866.1| periplasmic lipoprotein-like protein [Polaromonas naphthalenivorans
           CJ2]
          Length = 369

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 55/418 (13%), Positives = 113/418 (27%), Gaps = 95/418 (22%)

Query: 3   FITIISIVFTLPSHALS-----IVPNVSLEKVLQNYATI-AHAKYEDALMCARTLDSAIE 56
            +  +S++    + A +      VP  + + +LQ         + +D    A+ L +A++
Sbjct: 20  LVLAVSLLACGSAMAQANWAKVAVPAYTPDNILQGLHQHWTRPRADDFAREAQALPAAVK 79

Query: 57  TLVTT--PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYV 114
            L     P  +    AR+QW      +++      G  I     ++++  P     ID  
Sbjct: 80  ALCNASPPAGEAQSAARMQWQATTRAWERLSTVAVGPLITRRSQRQIDFSPTRPALID-- 137

Query: 115 DSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHV 174
                                            +I +           G       G   
Sbjct: 138 --------------------------------KAIRTAPQGPAAMERVGTPA---KGLPA 162

Query: 175 IEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW 234
           +E+LLW Q +                              Y + V+  +  +   +   +
Sbjct: 163 LEWLLWTQPVVPASAA----------------------CAYAQEVALDVEREALALQHDF 200

Query: 235 GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAG------ERMNLGLILHDPEQEIDC- 287
                         NA   ++I GM  L    + G       +M   L    P +  +  
Sbjct: 201 KALAAT-----DWPNAEPETVIAGMGELVNQWVGGLERLRWAQMEKPLRAAKPREAPEWP 255

Query: 288 --FSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSN 345
              S  T  S+ N    + S                  +   +      L    +   + 
Sbjct: 256 RAASGQTAQSWANQWEALRSLGVLTGQEAPLPGQGLVPLETYLRGKG--LNPVADALLAA 313

Query: 346 TMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLI 402
           T +    +++           ++     G+  V +    L +       K+  ALD+ 
Sbjct: 314 TRQTDLRIRN-----------LAAGRAPGHTQVLDAARSLASLKRVAEGKVAPALDIS 360


>gi|254511777|ref|ZP_05123844.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221535488|gb|EEE38476.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 336

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/405 (11%), Positives = 111/405 (27%), Gaps = 90/405 (22%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
             ++    +P  A +      L  V++ +      ++        TL +A +    TP  
Sbjct: 4   LALATALLVPLCAHAQDRTPILMDVVETH---ILPRFTQLSGATETLVTAAQDDC-TPES 59

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           + L   R  +  A   +  +   RFG          +  WP  +GF              
Sbjct: 60  EGL---RTAYGTAFDRWISASHLRFGPTETGDRAFAMAFWPDTKGF-------------- 102

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
                        +       D  + +P+   ++  A         G+  +E +L+    
Sbjct: 103 ---------TPKTLSRLITAEDAVVNTPETYAEISIAG-------RGFLALERMLYD--- 143

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG-----Q 239
                                 G    R   ++ ++  +  + + +   W          
Sbjct: 144 ----------------PAMTQQGSAAYRCALIRAIATDIDRNADAITADWQTYAPNLTQP 187

Query: 240 ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDNTYASY 296
                 +  +  +  +   + +      A  R+   L       P +     S+ +    
Sbjct: 188 GADSPYRSGDEAMQQLYGALITG-LEFTADTRLGRPLGTFERPRPNRAEARRSERSLRHV 246

Query: 297 LNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDR 356
              +I +                    +   +S ++  +A +++  F+  +     L D 
Sbjct: 247 ELSLIALRD------------------LAARLSFDHPQIATDLDTAFARAIDRAQALDDP 288

Query: 357 AENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           A    +  Q          + ++  IND+     +  ++   L +
Sbjct: 289 ALVGVATPQ-----GRIRVEALQQSINDIRAIASA--ELGPTLGI 326


>gi|184200797|ref|YP_001855004.1| hypothetical protein KRH_11510 [Kocuria rhizophila DC2201]
 gi|183581027|dbj|BAG29498.1| hypothetical protein [Kocuria rhizophila DC2201]
          Length = 383

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/378 (12%), Positives = 91/378 (24%), Gaps = 127/378 (33%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                 E+    YA+            +  L S  E         +   AR  +   R+ 
Sbjct: 133 EDGQLKEQATTQYASYVK-------DQSEQLLSGTEEFARAYRAGDDARARELYAPVRMH 185

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           +++ E                   P+ E F D                            
Sbjct: 186 WERIE-------------------PVAESFGDLDPKL----------------------- 203

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                            L  A+  D    TG+H IE  LW            +R      
Sbjct: 204 ----------------DLREADLEDGQTWTGWHRIEKDLWPPRTGYTALPQKDRD----- 242

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                             + + LVSD   + +           L       L        
Sbjct: 243 -----------------ALGEQLVSDTRTLHERTRGITFTADQLSNGAKELL-------- 277

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
               +E+A  ++           E + +S      +  +V G   ++             
Sbjct: 278 ----DEVATGKVTG---------EEEAWSHTDLWDFQGNVDGARIAWE------------ 312

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
              +  L+   +  L   +  +F+   K     + R +   ++DQ+         K + +
Sbjct: 313 --DLSPLLQKRDPELDSTLKTRFAELQKLLDQHR-RGDGFVTYDQL----TKAQVKELSD 365

Query: 381 LINDLITQTESLRKIRIA 398
            +N L     ++    + 
Sbjct: 366 AVNALSEPLSTVTDKVVE 383


>gi|330955270|gb|EGH55530.1| putative lipoprotein [Pseudomonas syringae Cit 7]
          Length = 354

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 52/403 (12%), Positives = 114/403 (28%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVEADRQLAASALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+  D+     E 
Sbjct: 110 -----GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILFDADIDMANAEQ 157

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                              R    L  + +      EE++ +W         L K  N  
Sbjct: 158 K-----------------ARYCPLLMAIGERQKLLAEEILNSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++N+ K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLLPAEQKPLADKIDAAYANSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           + D         G + +    + L         ++  AL +  
Sbjct: 312 ATD--------GGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|330981179|gb|EGH79282.1| putative lipoprotein [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 354

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/403 (12%), Positives = 114/403 (28%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVEADRQLAASALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+  D+     E 
Sbjct: 110 -----GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILFDADIDMANAEQ 157

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                              R    L  + +      EE++ +W         L K  N  
Sbjct: 158 K-----------------ARYCPLLMAIGERQKLLAEEILNSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++N+ K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLMPAEQKPLADKIDAAYANSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           + D         G + +    + L         ++  AL +  
Sbjct: 312 ATD--------AGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|330877894|gb|EGH12043.1| lipoprotein [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 354

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 54/403 (13%), Positives = 114/403 (28%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L S+           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLASSALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         +V  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQVQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+           
Sbjct: 110 -----GRQVEQLVTAQPQINAQELAKA-------SVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      EE++ +W         L K  N  
Sbjct: 147 ------DAEIDMANAEQKARYCPLLMAIGERQKLLAEEILNSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+S   + LA +I+  ++ + K    LK    ++ 
Sbjct: 261 SAQTVWTG---------VDNKGLRSLLSAEQKPLADKIDAAYATSRKLLSELKPPLVDLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           + D         G + +    + L         ++  AL +  
Sbjct: 312 ATD--------AGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|256788106|ref|ZP_05526537.1| lipoprotein [Streptomyces lividans TK24]
 gi|289771998|ref|ZP_06531376.1| lipoprotein [Streptomyces lividans TK24]
 gi|289702197|gb|EFD69626.1| lipoprotein [Streptomyces lividans TK24]
          Length = 384

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/387 (12%), Positives = 101/387 (26%), Gaps = 129/387 (33%)

Query: 14  PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ 73
            +   +   +  L++ +  Y      + ++ L  A                 +L  A+  
Sbjct: 124 ATGGKAAARDPRLDEAVAAYRQYVQQQADETLPKAE-------AFAKAVKAGDLAAAKKA 176

Query: 74  WIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
           +  +RI ++++E                   P+ E F D       +E+           
Sbjct: 177 YAPSRIGWERTE-------------------PVAESFGDIDPQVDVREDGL--------- 208

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN 193
                                               TG+H +E  LW      +      
Sbjct: 209 --------------------------EDGQDPATDWTGWHRLEKALWQDGKIGDRE---- 238

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
                                  K ++  LV+DL++     G        +       L 
Sbjct: 239 -----------------------KELATTLVTDLKDWQNRVGKAEITPTSMANGAKELL- 274

Query: 254 SIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR 313
                      +E+A  ++           E + +S      +  +V G   SY      
Sbjct: 275 -----------DEVATGKVTG---------EEERYSHTDLVDFKANVEGAQQSY------ 308

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE--SFDQMISENN 371
                   A +  +   N+  L  E++ +F+   K     +    + E  S+D++     
Sbjct: 309 --------ALLKPVAKENDAALTTELDRQFAALDKLLDRYRPSTSSYEFTSYDKV----G 356

Query: 372 PEGNKIVRNLINDLITQTESLRKIRIA 398
               K + + +N L      L    + 
Sbjct: 357 KADRKELSDAVNALAEPLSKLAAAVVT 383


>gi|213970318|ref|ZP_03398448.1| lipoprotein [Pseudomonas syringae pv. tomato T1]
 gi|301385470|ref|ZP_07233888.1| lipoprotein, putative [Pseudomonas syringae pv. tomato Max13]
 gi|302063000|ref|ZP_07254541.1| lipoprotein, putative [Pseudomonas syringae pv. tomato K40]
 gi|302135284|ref|ZP_07261274.1| lipoprotein, putative [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213924990|gb|EEB58555.1| lipoprotein [Pseudomonas syringae pv. tomato T1]
 gi|331017970|gb|EGH98026.1| lipoprotein, putative [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 354

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/403 (12%), Positives = 113/403 (28%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLATSALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         +V  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQVQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+           
Sbjct: 110 -----GRQVEQLVTAQPQINAQELAKA-------SVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      EE++ +W         L K  N  
Sbjct: 147 ------DAEIDMANAEQKARYCPLLMAIGERQKLLAEEILSSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++ + K    LK    ++ 
Sbjct: 261 SAQTVWTG---------VDNKGLRSLLPAEQKPLADKIDAAYATSRKLLSELKPPLVDLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           + D         G + +    + L         ++  AL +  
Sbjct: 312 ATD--------AGREQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|288961783|ref|YP_003452093.1| hypothetical protein AZL_c02560 [Azospirillum sp. B510]
 gi|288914063|dbj|BAI75549.1| hypothetical protein AZL_c02560 [Azospirillum sp. B510]
          Length = 371

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/399 (12%), Positives = 118/399 (29%), Gaps = 60/399 (15%)

Query: 15  SHALSIVPNVSLEKVLQNYA-TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ 73
           S A +   +      L     T A  +++  +  A      ++     P    LE AR  
Sbjct: 23  SPAFAARQSDKDAAFLGGMVGTHALPRFDALVAAAAAYADTLDRFAAGPTPAGLEEARTA 82

Query: 74  WIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
             +    + + +  R G   ++    +++ WP   G +                      
Sbjct: 83  HTKVTDGWARVQHLRPGPLTMNLRADRMSFWPERPGVV---------------------- 120

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN 193
              +I    ++ D  ++ P  L +        +    G  V+E LL+ + +  +     +
Sbjct: 121 -QRQIGQILRDHDPKLLQPGALARQ-------SAAVQGLTVLERLLFDEGVTADGFTGSD 172

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
                            R +  +   ++    +LE  +            L +  +  +N
Sbjct: 173 AK----QYRAQLAAAAARNILVIATEARDGWKELEAPLA-----TGRPTALGQTASEAVN 223

Query: 254 SIITGMTSLSYNELAGERMNLGLIL----HDPEQEIDCFSDNTYASYLNDVIGIISSYTG 309
           ++     +     +  +++   L        P       S  +  + + ++  + +   G
Sbjct: 224 TLYASAITAMQV-VIDQKLLAPLGTGIEDAKPMVVEALRSGRSLRNIVLNLESLRALLMG 282

Query: 310 EYIRMNGEKIHGASIHDLISHNN--RNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI 367
           E+         G     L+  N+      Q I++ F+  +     +        + D   
Sbjct: 283 EH--------GGPGFVSLLPANDDGATAKQAIDESFAAAVGAVEAIPGPLNKAVT-DPAA 333

Query: 368 SENNPEGNKIVRNL-INDLITQTESLRKIRIALDLIEPN 405
            +      ++V+   +  L T    L    I L   E +
Sbjct: 334 RKKTEGALRLVKAARVEMLGTLAPLLD---ITLGFNELD 369


>gi|289677759|ref|ZP_06498649.1| putative lipoprotein [Pseudomonas syringae pv. syringae FF5]
          Length = 354

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/403 (12%), Positives = 114/403 (28%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVEADRQLAASALAFCQGKT--DLATAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+  D+     E 
Sbjct: 110 -----GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILFDADIDMANAEQ 157

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                              R    L  + +      EE++ +W         L K  N  
Sbjct: 158 K-----------------ARYCPLLMAIGERQKLLAEEILNSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++N+ K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLLPAEQKPLADKIDAAYANSCKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
           + D         G + +    + L         ++  AL +  
Sbjct: 312 ATD--------AGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|126729381|ref|ZP_01745195.1| hypothetical protein SSE37_24314 [Sagittula stellata E-37]
 gi|126710371|gb|EBA09423.1| hypothetical protein SSE37_24314 [Sagittula stellata E-37]
          Length = 337

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/399 (12%), Positives = 106/399 (26%), Gaps = 80/399 (20%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           ++   L   A + + N +  +++   AT     +E     A  L++  +T   TP+    
Sbjct: 6   ALSALLCLCAGAALANPTPSEIV---ATEVIPGFERLAEKADALETVAQTDC-TPDSA-- 59

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
              R  W  A   + +    R G          +  WP   GF                 
Sbjct: 60  -ALRSAWSEAFDAWVRVSHLRLGPTETGDRAFALAFWPDTRGF--------------TPK 104

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
             A +IA+          D ++ + D    +       +    G++ +EFLL+       
Sbjct: 105 TLATLIADE---------DAAVETADAFTHV-------SIAARGFYAMEFLLFDPQFTDA 148

Query: 188 VREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSD-LEEMMKAWGPDGQATKDLMK 246
                     D+                +  +S  ++ D   +   A+           +
Sbjct: 149 G---------DYGCALVQAVTRD-----ISDISDAILDDWRTDFSDAFTEAEIGPDGRYR 194

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDNTYASYLNDVIGI 303
                L ++ T +TS      +  R+   L       P++     S+ +       +   
Sbjct: 195 TEEEALQALYTTLTSG-LQFTSDTRLGRPLGTFERPRPKRAEAYRSERSLRHVRLSLEAT 253

Query: 304 ISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESF 363
                        +                    EI+D +     +              
Sbjct: 254 EELALALAQDAPEKVR-----------------TEISDAYDAAFAEVEAQDSPVFAGVDT 296

Query: 364 DQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
                       +I++  I+ +     S  ++   L L 
Sbjct: 297 -----PMGRFRVEILQQKIDTIRNVIAS--ELGPELGLS 328


>gi|21220744|ref|NP_626523.1| lipoprotein [Streptomyces coelicolor A3(2)]
 gi|6469260|emb|CAB61721.1| putative lipoprotein [Streptomyces coelicolor A3(2)]
          Length = 384

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/387 (12%), Positives = 101/387 (26%), Gaps = 129/387 (33%)

Query: 14  PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ 73
            +   +   +  L++ +  Y      + ++ L  A                 +L  A+  
Sbjct: 124 ATGGKAAARDPRLDEAVAAYRQYVQQQADETLPKAE-------AFAKAVKAGDLAAAKKA 176

Query: 74  WIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
           +  +RI ++++E                   P+ E F D       +E+           
Sbjct: 177 YAPSRIGWERTE-------------------PVAESFGDIDPQVDVREDGL--------- 208

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN 193
                                               TG+H +E  LW      +      
Sbjct: 209 --------------------------EDGQDPATDWTGWHRLEKALWQDGKIGDRE---- 238

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
                                  K ++  LV+DL++     G        +       L 
Sbjct: 239 -----------------------KELATTLVTDLKDWQNRVGKAEITPTSMANGAKELL- 274

Query: 254 SIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR 313
                      +E+A  ++           E + +S      +  +V G   SY      
Sbjct: 275 -----------DEVATGKVTG---------EEERYSHTDLVDFKANVEGAQQSY------ 308

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE--SFDQMISENN 371
                   A +  +   N+  L  E++ +F+   K     +    + E  S+D++     
Sbjct: 309 --------ALLKPVAKENDAALTTELDRQFAALDKLLDRYRPSTSSYEFTSYDKV----G 356

Query: 372 PEGNKIVRNLINDLITQTESLRKIRIA 398
               K + + +N L      L    + 
Sbjct: 357 KADRKELSDAVNALAEPLSKLAAAVVT 383


>gi|297161089|gb|ADI10801.1| lipoprotein [Streptomyces bingchenggensis BCW-1]
          Length = 375

 Score =  111 bits (276), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 52/378 (13%), Positives = 100/378 (26%), Gaps = 132/378 (34%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
              N  L+K + +Y   A A+ ++ L  A+              K +LE A+  +  +R+
Sbjct: 129 AKRNPKLDKAVADYRAYAQAQADETLPKAQ-------AFADAVKKGDLEAAKKAYAPSRV 181

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKII 139
            ++++E                   P+ E F D                           
Sbjct: 182 GWERTE-------------------PVAESFGDIDPK----------------------- 199

Query: 140 VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
                             +           TG+H +E  LW     T             
Sbjct: 200 ----------------VDIREDGLEKGQKWTGWHRLEKSLWKDKKITAED---------- 233

Query: 200 DIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGM 259
                            K ++  L+ DL++  K  G        +       L       
Sbjct: 234 -----------------KTLADQLIKDLKDWQKRVGTADITPTGMANGAKELL------- 269

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
                +E+   ++           E + +S      +  +V G   SY            
Sbjct: 270 -----DEVQTGKVTG---------EEERYSHTDLVDFEGNVDGAQKSYQL---------- 305

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVR 379
               +  + S NN  L +E++ +F+   K     ++  +   S+D           K + 
Sbjct: 306 ----LKPVASQNNPALTKELDKQFAAVKKLLDKYRE-GDGFVSYD----TVGEAKRKELS 356

Query: 380 NLINDLITQTESLRKIRI 397
           + +N L      L     
Sbjct: 357 DAVNALAEPLSKLAAAVA 374


>gi|330504537|ref|YP_004381406.1| periplasmic lipoprotein-like protein [Pseudomonas mendocina NK-01]
 gi|328918823|gb|AEB59654.1| periplasmic lipoprotein-like protein [Pseudomonas mendocina NK-01]
          Length = 354

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 47/408 (11%), Positives = 106/408 (25%), Gaps = 82/408 (20%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNY-AT-IAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           S++ +L   AL           +    A  +    Y       R L              
Sbjct: 5   SLIASLLGLALVGCGQQDQTAKVTGALADGVLLPAYTSWQEADRQLAERATAFC--TGNA 62

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
           +L  AR  ++ A   +   +    G         +V  WP  +  +              
Sbjct: 63  DLPAARQAFLGAMSAWSALQPLMLGPLAEGNRAWQVQFWPDKKNLV-------------- 108

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
                      +  V         ++   L          + +  G    E++L+  D+ 
Sbjct: 109 -----------QRQVEALLKSKPQLTQADLASA-------SVVVQGLTASEYVLFDADID 150

Query: 186 TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA-TKDL 244
               E                    R    L+ + +   +   +++  W  D       L
Sbjct: 151 LTQEEQK-----------------ARYCPLLQAIGQHQHALAADIVAQWQADKSGMAAQL 193

Query: 245 MKDINAGLNSIITGMTSLSYNELAG-----ERMNLGL-----ILHDPEQEIDCFSDNTYA 294
            +  N         +  L   +++G     +++   L      +  P Q     S+ + A
Sbjct: 194 KQFPNERYADSKEAVAELLRVQVSGIDGLKKKLGAPLGRQTKGIPQPYQAESWRSNASLA 253

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILK 354
           +  + +      + G              +  L+  +   L Q I+  + +T +      
Sbjct: 254 NLGSALASAELLWHGNNKD---------GLQSLLGSDQAELVQRIDAAYLDTRQRLAAFD 304

Query: 355 DRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDL 401
                + +        + +G   +  L + L          +  AL +
Sbjct: 305 LPLTELLA--------SEDGRNQLNELYDSLNRLHRLQESDLAKALGV 344


>gi|163792728|ref|ZP_02186705.1| hypothetical protein BAL199_17813 [alpha proteobacterium BAL199]
 gi|159182433|gb|EDP66942.1| hypothetical protein BAL199_17813 [alpha proteobacterium BAL199]
          Length = 360

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/376 (11%), Positives = 95/376 (25%), Gaps = 72/376 (19%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +  ++++      A++         V    +      +      AR L+  +      P
Sbjct: 4   LLICLTVLVACIGPAMADDQARDAAIVAHGVSDYVRPAFIRFAEDARALEDTVARFCKAP 63

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
                +     +  A   +   +  RFG  I     +++  WP  +G             
Sbjct: 64  APDTRQPLDTAFRTAVEGWSGIQFLRFGPLIDQHRLERIAFWPDPKG------------- 110

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                     +   +I     + D ++  P  L          +    G   +E+LL+G 
Sbjct: 111 ----------VGLRQIRRALADRDPTVADPAQLA-------GKSVALQGLTALEYLLYGG 153

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT- 241
           D                     +G     R  Y    ++ L      + + W        
Sbjct: 154 DGDPAGD---------------SGDAGAFRCAYSVAAARALTDLANAVSQEWSDPQGFAT 198

Query: 242 --------KDLMKDINAGLNSIITGMTSLSYNELAGER----MNLGLILHDPEQEIDCFS 289
                     L +  +  L+ +   + +     +  ++    +   L    P       S
Sbjct: 199 RLLAPGGDDPLYRTPSEALSELHRALGTG-LQVVQDQKLKPTLGDELKSARPLGAPFRRS 257

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
             T A    D+  + +         +     G             +   +  +F N    
Sbjct: 258 GLTPAVLAADIKALKAFTVTSGFARSLPDEFG------------WIGGSMAFEFDNAAAA 305

Query: 350 FHILKDRAENIESFDQ 365
              +    E    +DQ
Sbjct: 306 AETVTIPIEEAV-YDQ 320


>gi|289625014|ref|ZP_06457968.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647072|ref|ZP_06478415.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330868746|gb|EGH03455.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 354

 Score =  110 bits (275), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/403 (12%), Positives = 111/403 (27%), Gaps = 86/403 (21%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
             PS   ++      ++V           Y   +   R L ++           +L  AR
Sbjct: 19  CSPSDPQAVTSAAIAKQV-------ILPTYSRWVDADRQLATSALAFCQGKT--DLAAAR 69

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
              ++A+  + + +    G         ++  WP  +  +                    
Sbjct: 70  ADLLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLV-------------------- 109

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                   V +       I+   L K        + +  G    E++L+           
Sbjct: 110 -----GRQVEQLVTAQPQITAQELSKA-------SVVVQGLSAYEYILF----------- 146

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                 D +I         R    L  + +      EE++ +W         L K  N  
Sbjct: 147 ------DAEIDMANTEQKARYCPLLMAIGERQKQLAEEILSSWNSTDGMLAQLSKFPNQR 200

Query: 252 LNSIITGMTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVI 301
                  +  L   ++       +++   L         P Q     S ++ +S    +I
Sbjct: 201 YADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQPFQADAWRSKSSLSSLEASLI 260

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
              + +TG         +    +  L+    + LA +I+  ++ + K    LK    ++ 
Sbjct: 261 SAETVWTG---------VDNKGLRSLLPAEQKTLADKIDAAYATSRKLLSELKPPLADLL 311

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIE 403
                    +  G + +    + L         ++  AL +  
Sbjct: 312 --------VSETGRQQLNAFYDSLNAVHRLHEGELAKALGIQL 346


>gi|255262287|ref|ZP_05341629.1| imelysin superfamily protein [Thalassiobium sp. R2A62]
 gi|255104622|gb|EET47296.1| imelysin superfamily protein [Thalassiobium sp. R2A62]
          Length = 332

 Score =  110 bits (274), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 42/364 (11%), Positives = 94/364 (25%), Gaps = 85/364 (23%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           I +   +    L+   N S+  ++         ++E     ++ L  A       P   +
Sbjct: 4   ILLAAAVACAPLTATANPSISAIID---DHILPRFEALASTSQALSKAAMQNCD-PTSDD 59

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L   R  +  A   +  +   R G   VD     +  WP   G      ++   + +   
Sbjct: 60  L---RTAYGVAFDVWVSTSHLRLGPTEVDDRAFALAFWPDSRGATPRALATLISDEDPIG 116

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
           L  A                              A    +    G++ +EFLL+ + L  
Sbjct: 117 LDAA------------------------------AYSEVSIAARGFYALEFLLYDETLMQ 146

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ-----AT 241
                                        ++ V+  + +    +   W            
Sbjct: 147 PS---------------------EYHCALVQTVTTDIAATSSAIHDDWHSHKDVLLSPGP 185

Query: 242 KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDNTYASYLN 298
               +     L  ++  +T+         R+   L       P +     S  +      
Sbjct: 186 DATYRSEEEVLQEMLRALTAG-LQFTQDSRLGRPLGTFDRPQPARAEARRSGRSAKHVTL 244

Query: 299 DVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAE 358
            ++ +                    +   +S ++ NL+  +N +F + +     L D   
Sbjct: 245 SLMSLQD------------------LASHLSVSDANLSDTLNRQFEDALGKLATLNDPVF 286

Query: 359 NIES 362
              +
Sbjct: 287 AGVA 290


>gi|83955094|ref|ZP_00963750.1| hypothetical protein NAS141_03276 [Sulfitobacter sp. NAS-14.1]
 gi|83840423|gb|EAP79596.1| hypothetical protein NAS141_03276 [Sulfitobacter sp. NAS-14.1]
          Length = 338

 Score =  110 bits (274), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 41/399 (10%), Positives = 102/399 (25%), Gaps = 89/399 (22%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M  + +   +F  P  A + V +  L  V+ ++      +Y         L +  +    
Sbjct: 1   MKKLVLALGLFCAPLGAAAEVGSAVLRDVVDHH---ILPRYTTLAERTDALAAVAQQNCA 57

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
                +    R  +  A   +      RFG    D     +  WP   G           
Sbjct: 58  ----PDDAALRDAYHEAFDAWIAVSHLRFGPSETDNRAFALAFWPDSRG----------- 102

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
                                 K +   I   D + +  +A    +    G++ +EFLL+
Sbjct: 103 -------------------ATPKTLAGLITDADPVGRDPQAYADVSIAGRGFYALEFLLY 143

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
              +                    T G    R   ++ V+  + +  + ++  W      
Sbjct: 144 DDQI-------------------STMGDAGYRCALVQTVTADIATQSQAILDGWTSGYAE 184

Query: 241 TKDL------MKDINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDN 291
                      +        +   +  L     A  R+   +       P +     S  
Sbjct: 185 AVATPAEGGPYRSTEEAAQELFKALN-LGLEFTADTRIGRPMGSFDRPRPNRAETRRSGR 243

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH 351
           +  + +  +  +                    + + ++  +  +    +D+F   +    
Sbjct: 244 SLRNVVVALTSLQD------------------LAERLAAYDMAVVAAFDDRFDEALAIAA 285

Query: 352 ILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTE 390
            L D      +        +    ++++  +  +     
Sbjct: 286 DLDDPVFAGTA-----KPQSRLRVEVLQQSVAAIRDVAR 319


>gi|269219784|ref|ZP_06163638.1| putative lipoprotein [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269211026|gb|EEZ77366.1| putative lipoprotein [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 402

 Score =  110 bits (274), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 57/371 (15%), Positives = 100/371 (26%), Gaps = 121/371 (32%)

Query: 26  LEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSE 85
            ++ + NY       Y      A  L    +         NL+ AR  +   R  Y++ E
Sbjct: 142 QDQAVSNYN-----AYNR--DQAGQLLEKTKAFAEAYKAGNLDKARSLYAATRQHYERIE 194

Query: 86  VYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEI 145
                              P  E F D   +   +E                        
Sbjct: 195 -------------------PTAEKFGDLDPALDERE------------------------ 211

Query: 146 DLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCT 205
                              DT    G+H IE  LW  D    + +               
Sbjct: 212 ----------ADWQETEDKDTRAWKGWHYIEKDLWRPDGFEGLND--------------- 246

Query: 206 GGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYN 265
                   E     S+ LV+D +++               KD +  L  I  G  +L   
Sbjct: 247 --------EQRAKASEQLVADTQKLYDLVY---------AKDFSIKLADISNGAINL-LE 288

Query: 266 ELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIH 325
           E+A  ++           E + FS      +  +V G   +Y                + 
Sbjct: 289 EVATTKITG---------EEEAFSHTDLWDFQANVEGAKVAYGN--------------VE 325

Query: 326 DLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDL 385
            +    +  LA+EI+ +F     +    K + +    +D++    N    K + + +N L
Sbjct: 326 AIAKKKDSALAKEISKRFDQLQAELDKYK-QGDGYVYYDKL----NEAQRKQLSDSVNAL 380

Query: 386 ITQTESLRKIR 396
                 L +  
Sbjct: 381 RKPLAKLTEAI 391


>gi|302534150|ref|ZP_07286492.1| lipoprotein [Streptomyces sp. C]
 gi|302443045|gb|EFL14861.1| lipoprotein [Streptomyces sp. C]
          Length = 383

 Score =  110 bits (274), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 49/386 (12%), Positives = 103/386 (26%), Gaps = 129/386 (33%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
                 +   +  L+  +  Y      + ++ L  A+         V      +LE AR 
Sbjct: 123 ATGKGGTEKRSPELDAAVAAYRKYVQEQADETLPKAQ-------AFVDAVKAGDLEAARK 175

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            +  +RI ++++E                   P+ E F D       +E+          
Sbjct: 176 AYAPSRIGWERTE-------------------PVAESFGDIDPKVDVREDGL-------- 208

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
                                       A        TG+H +E  L+  +   +     
Sbjct: 209 ---------------------------EAGQDPAKDWTGWHRLEKSLFQDNKIDDND--- 238

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGL 252
                                   K ++  L++DL E  K  G        +       L
Sbjct: 239 ------------------------KKLADTLIADLTEWQKKVGQAEITPTSMANGAKELL 274

Query: 253 NSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYI 312
                       +E+A  ++           E + +S      +  +V G   SY     
Sbjct: 275 ------------DEVATGKVTG---------EEERYSHTDLVDFKANVEGAQKSYEL--- 310

Query: 313 RMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE--SFDQMISEN 370
                      +  + + N+  LA++++ +F+         +      E  S+D++    
Sbjct: 311 -----------LKTVTAKNDPELAKQLDTQFAAMNTLLDKYRADKNTYEFTSYDKV---- 355

Query: 371 NPEGNKIVRNLINDLITQTESLRKIR 396
                K + + ++ L      L    
Sbjct: 356 GEAERKELSDAVSALGEPLSKLAAAV 381


>gi|149921136|ref|ZP_01909594.1| predicted periplasmic lipoprotein [Plesiocystis pacifica SIR-1]
 gi|149818023|gb|EDM77482.1| predicted periplasmic lipoprotein [Plesiocystis pacifica SIR-1]
          Length = 371

 Score =  110 bits (274), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 56/354 (15%), Positives = 98/354 (27%), Gaps = 73/354 (20%)

Query: 59  VTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSY 118
              P+   L+ A+  W   R P++Q     FG  + + +D  V+ WP     I+   +  
Sbjct: 72  CEAPDPSTLDAAQAAWWALREPWRQFRALPFGPLVDEGFDSAVDFWPARPSSIEGGVTGG 131

Query: 119 GKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFL 178
                                                       G     + G   +E+L
Sbjct: 132 -------------------------------------SSTVEEVGALGVASKGLPAVEYL 154

Query: 179 LWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWG--- 235
           LW         E G+             G   +R  YL  V   +   LE +        
Sbjct: 155 LWD-------PEGGDEAVLAALTAEEPSG--AQRCAYLHAVVGDVGVQLEALEAQTESFA 205

Query: 236 ------PDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFS 289
                         +   ++  LN+ I G+  LS   + G+ + L     D EQ    FS
Sbjct: 206 DTLATAGSNARYPTVSLAVDELLNAAIAGLHDLSERSM-GKPLGLSTAEPDLEQLESRFS 264

Query: 290 DNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKD 349
           D + A  L+ + G  + Y G      G    G     +++ ++  +   +       +  
Sbjct: 265 DRSRADILDALAGFSAFYLG------GADRDGEGFTVIVAASSAEIDAAVRADLDVALAA 318

Query: 350 FHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI 402
              L D        D             V      +     +L   +   L + 
Sbjct: 319 AEALPDPLRTGLDTD----------PAAVNAAWEAIRALRLTLAADVAGLLGVT 362


>gi|254488221|ref|ZP_05101426.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214045090|gb|EEB85728.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 328

 Score =  109 bits (273), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 46/399 (11%), Positives = 101/399 (25%), Gaps = 91/399 (22%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
            LP  A +  P   +  V+         ++      A+ L          P  + L   R
Sbjct: 2   ALPMAAGAETPQDIITDVVN---DHILVQFGTLDTMAQRLRDVALDDCD-PASETL---R 54

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +  A   +  +   RFG    D     +  WP   G                      
Sbjct: 55  ASYGDAFDAWIAASHLRFGPTETDNRAFALAFWPDSRG---------------------- 92

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                      + +   I   D + +   +    +    G++ +E+LL+ + L       
Sbjct: 93  --------ATPRALAALIADEDKIAQSPESYAEMSIAARGFYAMEYLLYDETL------- 137

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                        T G        ++ V+  + ++   ++        A + +    +  
Sbjct: 138 ------------STAGDPAYHCTLVQTVAGDIAANSAAILND-WQSFYADRLIAPAPDGT 184

Query: 252 LNSIITGMTSLSYNELAGE------RMNLGLIL---HDPEQEIDCFSDNTYASYLNDVIG 302
            +S    +  L   E AG       RM   L         +     +  +       +I 
Sbjct: 185 YHSHEEVLKELFKAETAGLEFTSDVRMGRPLGTFDHPRASRAESWRAGRSARHVELSLIA 244

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           +                    +   ++    +L  E+   F   +     L D       
Sbjct: 245 LRD------------------LALRLAMGKPDLVAELGGDFQKALDQLAALNDPVFAGVD 286

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
                   +    ++V+  I+ +         +   L +
Sbjct: 287 -----DPQSRLRVEVVQQSIDAIRATVR--EDLGPTLGV 318


>gi|325676605|ref|ZP_08156283.1| lipoprotein [Rhodococcus equi ATCC 33707]
 gi|325552783|gb|EGD22467.1| lipoprotein [Rhodococcus equi ATCC 33707]
          Length = 386

 Score =  109 bits (273), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 49/388 (12%), Positives = 107/388 (27%), Gaps = 129/388 (33%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
           F +   +++       +  L   A   + +Y D+ + A  L   +   V +    ++  A
Sbjct: 127 FVVTGDSVAAT---DQDGRLTEAAD-GYKRYVDSQLTA--LQETVTAFVASIKAGDVAAA 180

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           + Q+   R  Y++ E                   P+ E F D                  
Sbjct: 181 KAQYPLTRTYYERIE-------------------PIAESFPD------------------ 203

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
                                 D    L   +       TG+H +E  LW Q L+ +   
Sbjct: 204 --------------------DLDPRIDLREVDVEPGWNWTGFHRLEKDLWVQGLQPDTN- 242

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
                                       ++  LV+D++E+             +      
Sbjct: 243 ---------------------------AIADQLVADIQELADGVAAPDFVVDPIQ----- 270

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
                + G      +E+A  ++           E D FS      +  +           
Sbjct: 271 -----VAGGAQTLLDEIARTKITG---------EEDIFSHTDLYDFQANA---------- 306

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
               +G +   AS+  ++   N  LA  I+ +F++   +    + + +   S+       
Sbjct: 307 ----DGSQAAIASLRPILDDRNPELAARIDQRFADLDAELAQFR-QGDGFVSY----ETV 357

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRIA 398
                + +   I+ L  +   ++ +   
Sbjct: 358 TEPQRQALSQKIDALSAEVSQVQGVVAG 385


>gi|291303130|ref|YP_003514408.1| hypothetical protein Snas_5685 [Stackebrandtia nassauensis DSM
           44728]
 gi|290572350|gb|ADD45315.1| conserved hypothetical protein [Stackebrandtia nassauensis DSM
           44728]
          Length = 376

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 46/387 (11%), Positives = 110/387 (28%), Gaps = 130/387 (33%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
           FT+   A  +  + +L   +++Y              +  L       V     ++++ A
Sbjct: 118 FTVTGKAEKLTEDENLADAVKSYKRYV-------AKQSEALVDKTGEFVDAVKDEDIDKA 170

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           +  +  +R  +++ E                   P+ E F D       +E++       
Sbjct: 171 KELFPISRTYWERIE-------------------PVAEIFGDLDPRVDAREDDFPK---- 207

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
                                           G       G+H +E+ LW   +  +V +
Sbjct: 208 --------------------------------GPKDPEFGGFHKLEYDLW---ITKDVSK 232

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
            G                          V+  L+ D++E++     +      L      
Sbjct: 233 SGK-------------------------VADQLLKDVKEVVDRAEKEELTPLHLANGAKE 267

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
            L            +E+A  ++           E D +S      +  ++ G        
Sbjct: 268 LL------------DEVATSKITG---------EEDRYSHTDLWDFAANLAG-------- 298

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
                  +   AS+  +I   +  L +++++KF+   +       + +    +D++    
Sbjct: 299 ------SEAAVASLRPVIDEKDPKLGKKLDEKFAAAEEALGEH-AKGDGWRLWDEL---- 347

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRI 397
           +    K + + IN L      +  +  
Sbjct: 348 SKSELKELSDAINALGEPVSEVAGVVS 374


>gi|312138706|ref|YP_004006042.1| peptidase [Rhodococcus equi 103S]
 gi|311888045|emb|CBH47357.1| putative secreted peptidase [Rhodococcus equi 103S]
          Length = 386

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 49/388 (12%), Positives = 107/388 (27%), Gaps = 129/388 (33%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
           F +   +++       +  L   A   + +Y D+ + A  L   +   V +    ++  A
Sbjct: 127 FVVTGDSVAAT---DQDGRLTEAAD-GYKRYVDSQLTA--LQETVTAFVASIKAGDVAAA 180

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           + Q+   R  Y++ E                   P+ E F D                  
Sbjct: 181 KAQYPLTRTYYERIE-------------------PIAESFPD------------------ 203

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
                                 D    L   +       TG+H +E  LW Q L+ +   
Sbjct: 204 --------------------DLDPRIDLREVDVEPGWNWTGFHRLEKDLWVQGLQPDTN- 242

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
                                       ++  LV+D++E+             +      
Sbjct: 243 ---------------------------AIADQLVADIQELADGVAAPDFVVDPIQ----- 270

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
                + G      +E+A  ++           E D FS      +  +           
Sbjct: 271 -----VAGGAQTLLDEIARTKITG---------EEDIFSHTDLYDFQANA---------- 306

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
               +G +   AS+  ++   N  LA  I+ +F++   +    + + +   S+       
Sbjct: 307 ----DGSQAAIASLRPILDDRNPELAARIDQRFADLDAELAQFR-QGDGFVSY----ETV 357

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRIA 398
                + +   I+ L  +   ++ +   
Sbjct: 358 TEPQRQALSQKIDALSAEVSQVQGVVAG 385


>gi|28898692|ref|NP_798297.1| hypothetical protein VP1918 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839459|ref|ZP_01992126.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|260363709|ref|ZP_05776493.1| imelysin family protein [Vibrio parahaemolyticus K5030]
 gi|260879724|ref|ZP_05892079.1| imelysin family protein [Vibrio parahaemolyticus AN-5034]
 gi|260898802|ref|ZP_05907243.1| imelysin family protein [Vibrio parahaemolyticus Peru-466]
 gi|260901615|ref|ZP_05910010.1| imelysin family protein [Vibrio parahaemolyticus AQ4037]
 gi|28806910|dbj|BAC60181.1| hypothetical protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747016|gb|EDM58004.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|308086598|gb|EFO36293.1| imelysin family protein [Vibrio parahaemolyticus Peru-466]
 gi|308093219|gb|EFO42914.1| imelysin family protein [Vibrio parahaemolyticus AN-5034]
 gi|308108695|gb|EFO46235.1| imelysin family protein [Vibrio parahaemolyticus AQ4037]
 gi|308113397|gb|EFO50937.1| imelysin family protein [Vibrio parahaemolyticus K5030]
          Length = 345

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 45/414 (10%), Positives = 113/414 (27%), Gaps = 84/414 (20%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
            +  +S+V    +   S         + Q    +     +  L  A  L+ +       P
Sbjct: 10  VVATLSLVGCQSTTGSSDAQPEQTSHISQAVYEVEFHAAQSFLSQASQLEQSFADFCLAP 69

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
              ++E  + QW    + +   +    G          V  WP  +              
Sbjct: 70  K-NDVEPVQQQWHSTMLAWMALQGQERGPATALEQSWNVQFWPDKK-------------- 114

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                             N     +S ++              +    G   +E+LL+  
Sbjct: 115 ------------------NTTGRKMSALTKADKVWTVEEISTQSVTVQGLGALEWLLYDD 156

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
                                 T             +++ L    + +  +W  +   + 
Sbjct: 157 AS--------------------TLNTNSNVCASGVAIAENLHDKAQIIANSWAENPWKSL 196

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGL---ILHDPEQEIDCFSDNTYASYLND 299
              +  +  ++ +   +      E + ++++  L       P       S+ + ++   +
Sbjct: 197 QKTEWESEYISLLSNQL------EYSMKKLSRPLAKIGHPRPYFSESWRSETSLSNLKAN 250

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR-NLAQEINDKFSNTMKDFHILKDRAE 358
           +  +   Y            +G  +  L+    +  LA  +  +F   ++ +   K    
Sbjct: 251 LESLHQLYFA----------NGKGLDALLRAQGKTQLADRVAYQFDMALETWPEDKSLFS 300

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLIEP-NRVIGN 410
            ++S D         G ++V    N L      +  ++ I L ++   N   G+
Sbjct: 301 ALQSVD---------GYRLVLAQYNKLEQLKYLIHEEVAIELGVVIGFNATDGD 345


>gi|126738826|ref|ZP_01754522.1| hypothetical protein RSK20926_02879 [Roseobacter sp. SK209-2-6]
 gi|126720007|gb|EBA16714.1| hypothetical protein RSK20926_02879 [Roseobacter sp. SK209-2-6]
          Length = 312

 Score =  109 bits (272), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 39/373 (10%), Positives = 100/373 (26%), Gaps = 86/373 (23%)

Query: 37  AHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT 96
                +     +  L +A E +        +   R  + +A   + +    RFG   V+ 
Sbjct: 10  ILPDMQTLAESSAHLANAAEQMCR----PGVSPLREAYAQAFDAWIRVSHLRFGPSEVEN 65

Query: 97  WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR 156
               +  WP   G I                          +  + ++ D +++S     
Sbjct: 66  RAFALAFWPDSRGKI-----------------------PKTLAAHLRKADPALLSDAKFA 102

Query: 157 KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYL 216
           +   A         G++ +EF  +  +                                 
Sbjct: 103 QSSIAG-------RGFYALEFFYFSPEDIGAEPS-------------------EFTCGLT 136

Query: 217 KVVSKILVSDLEEMMKAWGPDGQA----TKDLMKDINAGLNSIITGMTSLSYNELAGERM 272
           + +++ +  + E + + W           +    + +     +   + +     L+  R+
Sbjct: 137 RAIARDIAKNSEAIYQDWLSGYATQMREAQGRYANESEVKQELYKALNTG-LQVLSDMRL 195

Query: 273 NLGLIL---HDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLIS 329
              L       P++     S  +    L  +  +                        +S
Sbjct: 196 GRPLGAFDKPRPKRAEAWRSGRSLHHILLSLDALKQLALS------------------LS 237

Query: 330 HNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQT 389
             +  LA+ +   F   +     L D      +             + ++  +NDL T  
Sbjct: 238 AKDPALAERLEQGFDRVLARAEALDDPRLEGVA-----DPQKRFRIEALQQQVNDLRTLI 292

Query: 390 ESLRKIRIALDLI 402
           E+  ++  +L ++
Sbjct: 293 EA--ELGPSLGVL 303


>gi|255067469|ref|ZP_05319324.1| protein YcdO [Neisseria sicca ATCC 29256]
 gi|255048264|gb|EET43728.1| protein YcdO [Neisseria sicca ATCC 29256]
          Length = 393

 Score =  109 bits (272), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 55/380 (14%), Positives = 113/380 (29%), Gaps = 130/380 (34%)

Query: 22  PNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPY 81
               LEK+ +  A      Y      A+ L +  +         ++E A+  +  AR  Y
Sbjct: 143 NEADLEKLAKPLADY--KVYVQ--GEAKELVAKTKAFTDAVKAGDIEKAKSLFAAARTHY 198

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
           ++ E                   P+ E F +   +   +E++                  
Sbjct: 199 ERIE-------------------PIAELFNELDPAIDAREDDFK---------------- 223

Query: 142 EKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
                               +  +    TG+H IE  LW +                   
Sbjct: 224 --------------------DKTEDAAFTGFHRIEHALWVK------------------- 244

Query: 202 GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTS 261
                    + V  +K ++  L+ D+E + K           +             G  +
Sbjct: 245 ---------KDVSGVKDIADKLMKDVESLQKEIDALSFPPNKV------------VGGAA 283

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           +   E+AG +++          E D +S    + +  ++ G                   
Sbjct: 284 VLIEEVAGSKISG---------EEDRYSHTDLSDFQANIEGAQKIVEL------------ 322

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
                +I+  N+ L ++++  F          K + +  E++D++    + E  K ++  
Sbjct: 323 --FRPMIAEKNKALLEKVDANFKQVTDILAKYKTK-DGFETYDKL----SDEDRKTLQAP 375

Query: 382 INDLITQTESLRKIRIALDL 401
           IN L    E L ++R  L L
Sbjct: 376 INAL---AEDLSQLRGTLGL 392


>gi|89053861|ref|YP_509312.1| hypothetical protein Jann_1370 [Jannaschia sp. CCS1]
 gi|88863410|gb|ABD54287.1| hypothetical protein Jann_1370 [Jannaschia sp. CCS1]
          Length = 338

 Score =  109 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/410 (11%), Positives = 110/410 (26%), Gaps = 91/410 (22%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M  + ++     +P+  L++      E V          +Y   +  A TL    +    
Sbjct: 1   MLRMLMVCCALAMPTAGLAL---PIPEVVADAVEGHILPRYGQLVQDADTLAQVAQDAC- 56

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P    L  A   +  A   +       FG   VD     +  WP   G           
Sbjct: 57  GPTDTVLIAA---FHDAFDAWISVSHITFGPAEVDGRAFALAFWPDTRGM---------- 103

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
                    + +IAN   +V +     ++                +    G+H ++FLL+
Sbjct: 104 ----TGRSLSGLIANEDPVVGDPADYATV----------------SVAARGFHALDFLLF 143

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD--- 237
              +                      G    R   ++ ++  +      + + W      
Sbjct: 144 DPQV-------------------SVAGDGAYRCALVQAITTDIAQMARAIQEDWTEGFAN 184

Query: 238 ---GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDN 291
                 + +  +       ++ + +T+      A  R+   +       P +     S  
Sbjct: 185 LMRTAGSNERFQSPEEAARALFSALTTG-LEFTADLRIGRPMGSFDAPRPNRAEARRSGR 243

Query: 292 TYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH 351
           +       +  +                  A +  ++S +   L  ++ D+F   +    
Sbjct: 244 SLRHVELSLEAL------------------ADLARILSQDYPELQAQLTDQFDTALDRAR 285

Query: 352 ILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
            L D      +       +     ++++  I D      +   +   L +
Sbjct: 286 TLDDPVFAGVA-----DPSGRLRIEVLQQRIRDARALAAT--DLGPTLGV 328


>gi|329934895|ref|ZP_08284936.1| lipoprotein [Streptomyces griseoaurantiacus M045]
 gi|329305717|gb|EGG49573.1| lipoprotein [Streptomyces griseoaurantiacus M045]
          Length = 379

 Score =  109 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 53/387 (13%), Positives = 102/387 (26%), Gaps = 133/387 (34%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           T+     +   +  L+K +  Y   A          A     A+ T V      +L+ AR
Sbjct: 122 TVTGGGKAAERDPKLDKAVAAYREYAQ-------EQADATLPAVRTFVKAVKDGDLDAAR 174

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +  +RI ++++E                   P+ E F D       + +         
Sbjct: 175 KAYAPSRIGWERTE-------------------PVAESFGDIDPKVDVRAD--------- 206

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                                            +    TG+H +E  LW           
Sbjct: 207 ------------------------------GLEEGQKWTGWHRLEKALWQDKKIGATE-- 234

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                                    K ++  LV+DL +  K  G        +       
Sbjct: 235 -------------------------KSLADRLVTDLTDWQKRVGKAEITPTSMANGAKEL 269

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L            +E+A  ++           E + +S      +  +V G   SY    
Sbjct: 270 L------------DEVATGKVTG---------EEERYSHTDLVDFKANVEGAQKSYEL-- 306

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE--SFDQMISE 369
                       +  +   N+  L  E++ +F    K     +   ++ E  S+D++   
Sbjct: 307 ------------LKPVAEKNDATLTAELDKQFGALDKLLDKYRPSKDSYEFTSYDKV--- 351

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIR 396
              +  K + + +N L      L    
Sbjct: 352 -GKDDRKELSDAVNALAEPLSKLAAAV 377


>gi|254453548|ref|ZP_05066985.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198267954|gb|EDY92224.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 339

 Score =  109 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/409 (10%), Positives = 111/409 (27%), Gaps = 92/409 (22%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTT 61
           + +T++     + ++A + + +  ++            +++     +  L +        
Sbjct: 4   FLLTVVLAAAPVITNAQTSIIDNIVDA-------HILPRFQTLADTSAHLATTARNDCAV 56

Query: 62  PNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKE 121
            ++      +  +  A   + ++   RFG    D     +  WP   G            
Sbjct: 57  TSQ----ALQSAYSDAFDAWVRASHLRFGPTEADDRAFALAFWPDSRGA----------- 101

Query: 122 NEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWG 181
                           +     + D  I SPD   ++       +    G++ +EFL++ 
Sbjct: 102 ------------TPRSLTALLTDQDPVIASPDAYAQV-------SIAARGFYAMEFLMYD 142

Query: 182 QDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT 241
           + L     E                     R   ++ V+K + +    +++ W  D  A 
Sbjct: 143 ETLSNMGDED----------------DEDDRCTLVQTVTKDIATTSAAILEGWQTDYAAR 186

Query: 242 ------KDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDNT 292
                     +     L  +   + +      +  R+   L       P +     S  +
Sbjct: 187 LKSPDTSSTYRSDEEVLQELFKALVTG-LQFTSETRLGRPLGTFERPRPTRAEAWRSGRS 245

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHI 352
                  +  +                    +   +S +N  L++ I   F         
Sbjct: 246 ARHVELSLAALND------------------LALRLSSDNAKLSERIETSFDVAATLLSK 287

Query: 353 LKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
             D                    ++++  I+D+  +     ++   L +
Sbjct: 288 FDDPIFAGVG-----DPQTRFKIEVLQRSIDDIRARVR--DELGPTLGV 329


>gi|156974990|ref|YP_001445897.1| hypothetical protein VIBHAR_02712 [Vibrio harveyi ATCC BAA-1116]
 gi|156526584|gb|ABU71670.1| hypothetical protein VIBHAR_02712 [Vibrio harveyi ATCC BAA-1116]
          Length = 345

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/405 (10%), Positives = 115/405 (28%), Gaps = 83/405 (20%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
             + +S+V    +   +     S   + QN   +     +  L     L+ +      + 
Sbjct: 10  IASALSLVGCQSTTGTTPTKPESTSHISQNVYEVEFNAAQAFLAQTGELEQSFADYCASE 69

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
            K++    + QW +  + +   +    G          V  WP  +              
Sbjct: 70  TKED-TQLKQQWHQTMLAWMALQGQERGPATALEQSWNVQFWPDKK-------------- 114

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                             N     +S ++              +    G   +E+LL+ Q
Sbjct: 115 ------------------NTTGRKMSALTKSAQTCSAEDISTQSVTVQGLGALEWLLYDQ 156

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
                                 T             +++ L +  + +  +W  +   + 
Sbjct: 157 AS--------------------TLSSNSNTCATGVAIAENLDNKAQIIADSWAENPWKSL 196

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGL---ILHDPEQEIDCFSDNTYASYLND 299
           ++ +  +  ++ +   +      E + ++++  L       P       S+ + ++   +
Sbjct: 197 EMTEWESEYISLLSNQL------EYSMKKLSRPLAKIGKPRPYFSESWRSETSLSNLKAN 250

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHN-NRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  + + Y             G  +  L+    + +LA  +  +F         L    E
Sbjct: 251 LTAMEALYFA----------DGNGLDALLREQGHADLADRVVHQFEMA------LDTWPE 294

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI 402
           +   F    +    EG ++V    N L      +  ++ I L ++
Sbjct: 295 DKSLF---AALKTKEGYRMVLAQYNKLEQLKYLIHEEVAIELGVV 336


>gi|288575972|ref|ZP_05977942.2| protein YcdO [Neisseria mucosa ATCC 25996]
 gi|288566666|gb|EFC88226.1| protein YcdO [Neisseria mucosa ATCC 25996]
          Length = 396

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 53/380 (13%), Positives = 112/380 (29%), Gaps = 130/380 (34%)

Query: 22  PNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPY 81
               LEK+ +  A      Y      A+ L +  +         ++E A+  +   R  Y
Sbjct: 146 NEADLEKLAKPLADY--KVYVQ--GEAKELVAKTKAFTDAVKAGDIEKAKSLFAATRTHY 201

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
           ++ E                   P+ E F +   +   +E++                  
Sbjct: 202 ERIE-------------------PIAELFNELDPAIDAREDDFK---------------- 226

Query: 142 EKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
                               +  +    TG+H IE  LW +                   
Sbjct: 227 --------------------DKTEDAAFTGFHRIEHALWVK------------------- 247

Query: 202 GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTS 261
                    + V  +K ++  L+ D+E + K           +             G  +
Sbjct: 248 ---------KDVSGVKDIADKLMKDVESLQKEIDALSFPPNKV------------VGGAA 286

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           +   E+AG +++          E D +S    + +  ++ G                   
Sbjct: 287 VLIEEVAGSKISG---------EEDRYSHTDLSDFQANIEGAQKIVEL------------ 325

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
                +I+  N+ L ++++  F   +      K + +  E++D++    +    K ++  
Sbjct: 326 --FRPMIAEKNKALLEKVDANFKQVIDILAKYKTK-DGFETYDKL----SDADRKTLQAP 378

Query: 382 INDLITQTESLRKIRIALDL 401
           IN L    E L ++R  L L
Sbjct: 379 INAL---AEDLSQLRGTLGL 395


>gi|302560966|ref|ZP_07313308.1| lipoprotein [Streptomyces griseoflavus Tu4000]
 gi|302478584|gb|EFL41677.1| lipoprotein [Streptomyces griseoflavus Tu4000]
          Length = 383

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/385 (11%), Positives = 101/385 (26%), Gaps = 129/385 (33%)

Query: 14  PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ 73
            +   ++  +  L++ +  Y      + ++ L  A     A++         ++E AR  
Sbjct: 124 ATGGKAVKRDPRLDEAVAAYRAYVQTQADETLPKAEAFAKAVQ-------DGDVEAARKA 176

Query: 74  WIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
           +  +RI ++++E                   P+ E F D       +E+           
Sbjct: 177 YAPSRIGWERTE-------------------PVAESFGDIDPKVDVREDGL--------- 208

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN 193
                                               TG+H +E  LW      +      
Sbjct: 209 --------------------------EDGQDPATDWTGWHRLEKALWQDGKIGDRE---- 238

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
                                  K ++  L++DL +  K  G        +       L 
Sbjct: 239 -----------------------KELAGRLITDLTDWQKRVGTADITPTSMANGAKELL- 274

Query: 254 SIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR 313
                      +E+A  ++           E + +S      +  +V G   SY      
Sbjct: 275 -----------DEVATGKVTG---------EEERYSHTDLVDFKANVEGAEKSY------ 308

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL--KDRAENIESFDQMISENN 371
                   A +  +   N+  L + ++ +F+              +     +D++     
Sbjct: 309 --------ALLKPVARENDPALTRNLDKQFAALDALLDEYRPDTTSYEFTPYDKV----G 356

Query: 372 PEGNKIVRNLINDLITQTESLRKIR 396
               K + + +N L      L    
Sbjct: 357 KADRKELSDAVNALAEPLSRLAAAV 381


>gi|298370515|ref|ZP_06981831.1| hypothetical protein HMPREF9016_01853 [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298281975|gb|EFI23464.1| hypothetical protein HMPREF9016_01853 [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 387

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 56/380 (14%), Positives = 114/380 (30%), Gaps = 130/380 (34%)

Query: 22  PNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPY 81
               LEK+ +  A      Y      A+ L +  +         ++E A+ Q+  AR  Y
Sbjct: 137 NEADLEKLAKPLADY--KVYVQ--GEAKELVAKTKAFTDAVKAGDIEKAKSQFASARTHY 192

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
           ++ E                   P+ E F +   +   +E++                  
Sbjct: 193 ERIE-------------------PIAELFNELDPAIDAREDDFK---------------- 217

Query: 142 EKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDI 201
                               +  +    TG+H IE  LW +                   
Sbjct: 218 --------------------DKTEDAAFTGFHRIEHALWVK------------------- 238

Query: 202 GNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTS 261
                    + V  +K ++  L+ D+E + K           +             G  +
Sbjct: 239 ---------KDVSGVKDIADKLMKDVESLQKEIDALSFPPNKV------------VGGAA 277

Query: 262 LSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
           +   E+AG +++          E D +S    + +  ++ G                   
Sbjct: 278 VLIEEVAGSKISG---------EEDRYSHTDLSDFQANIEGAQKIVEL------------ 316

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
                +I+  N+ L ++++  F          K + +  E++D++    + E  K ++  
Sbjct: 317 --FRPMIAEKNKALLEKVDANFKQVTDILTKYKTK-DGFETYDKL----SDEDRKTLQAP 369

Query: 382 INDLITQTESLRKIRIALDL 401
           IN L    E L ++R  L L
Sbjct: 370 INAL---AEDLSQLRGTLGL 386


>gi|153835594|ref|ZP_01988261.1| putative lipoprotein [Vibrio harveyi HY01]
 gi|148867811|gb|EDL67051.1| putative lipoprotein [Vibrio harveyi HY01]
          Length = 345

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/405 (11%), Positives = 115/405 (28%), Gaps = 83/405 (20%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
             + +S+V    +   +     S   + QN   +     +  L     L+ +        
Sbjct: 10  IASALSLVGCQSTTGTTPAKPESTSHISQNVYKVEFNAAQAFLAQTGKLEQSFADYCALE 69

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
            K++    + QW +  + +   +    G          V  WP  +              
Sbjct: 70  TKED-TQVKQQWHQTMLAWMALQGQERGPATALEQSWNVQFWPDKK-------------- 114

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                             N     +S ++         A    +    G   +E+LL+ Q
Sbjct: 115 ------------------NTTGRKMSALTKSAQTWSAEAISTQSVTVQGLGALEWLLYDQ 156

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
                                 T             +++ L +  + +  +W  +   + 
Sbjct: 157 AS--------------------TLSSNSNTCATGVAIAENLDNKAQIIADSWAENPWKSL 196

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGL---ILHDPEQEIDCFSDNTYASYLND 299
           ++ +  +  ++ +   +      E + ++++  L       P       S+ + ++   +
Sbjct: 197 EMTEWESEYISLLSNQL------EYSMKKLSRPLAKIGKPRPYFSESWRSETSLSNLKAN 250

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHN-NRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  + + Y             G  +  L+    + +LA  +  +F         L    E
Sbjct: 251 LTAMEALYLA----------DGNGLDALLREQGHADLADRVVHQFEMA------LDTWPE 294

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI 402
           +   F    +    EG ++V    N L      +  ++ I L ++
Sbjct: 295 DKSLF---AALQTKEGYRMVLAQYNKLEQLKYLIHEEVAIELGVV 336


>gi|313676507|ref|YP_004054503.1| peptidase m75, imelysin [Marivirga tractuosa DSM 4126]
 gi|312943205|gb|ADR22395.1| Peptidase M75, Imelysin [Marivirga tractuosa DSM 4126]
          Length = 371

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 48/395 (12%), Positives = 118/395 (29%), Gaps = 63/395 (15%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
              + + S   N   E  L+N A  +     E     A  L +A  +  T  + ++L   
Sbjct: 18  ACDNDSGSEKVNFDREAFLENMADHVIQPSIEKFASNAEGLSAATNSFSTNISIESLNVL 77

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           R +     + YQ       G         +VN +P +   ID                  
Sbjct: 78  RSELKETWLSYQHLAFVHVGPVSSVNLRDRVNIFPTNTDLID------------------ 119

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
             I +   ++                              G+  +++LL+G         
Sbjct: 120 ENINSQNYVLGSAA---------------------NVAAKGFPALDYLLFGTGSTE---- 154

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGP-DGQATKDLMKDIN 249
                  +             R++YL  + + + +    + + W        ++   D+ 
Sbjct: 155 ------EEVLAYFGNPDLGENRLQYLIDLVEDIQTTSNLISEGWPDYRSTFVENTGTDVG 208

Query: 250 AGLNSIITGMTSLSYNELAGERMNLGLILH-------DPEQEIDCFSDNTYASYLNDVIG 302
           +G + ++          +   ++      +        P+     FS  +       V  
Sbjct: 209 SGTSLLVNEYNFQFDIRIKNAKIGFPSGGNPRTGGVVSPQNVEGYFSGWSGELAQKAVNS 268

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRN---LAQEINDKFSNTMKDFHILKDRAEN 359
            I+ + G++   + + +      D +   +RN   L+  I +K +  +++   +      
Sbjct: 269 SIAVFKGQHFNSSEDGLGLDDYLDALDARDRNDQLLSLAIINKSTAALEEMEKINAPYSE 328

Query: 360 IESFD--QMISENNPEGNKIVRNLINDLITQTESL 392
           + + +  Q+++  N     I    ++     + S+
Sbjct: 329 VATTEGSQLVNVYNALQAVIPLIKVDMTSALSVSI 363


>gi|325003184|ref|ZP_08124296.1| hypothetical protein PseP1_30655 [Pseudonocardia sp. P1]
          Length = 379

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 46/391 (11%), Positives = 95/391 (24%), Gaps = 132/391 (33%)

Query: 8   SIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNL 67
           +      S A S   +  L +    Y+                L    +         ++
Sbjct: 121 APFTVTGSVARSTDSDARLAEATAGYSRYV-------ASQVGALVPKTQEFADAVKAGDV 173

Query: 68  ENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNL 127
           E A+  +  AR  +++ E                   P+ E F D      G+E++E   
Sbjct: 174 EKAKALYPVARTYWERIE-------------------PVAESFGDIDPRIDGREDDER-- 212

Query: 128 YTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
                                                     TGYH +E  LW   L+ +
Sbjct: 213 ------------------------------------DPGVGFTGYHRLEKDLWVTGLQPD 236

Query: 188 VREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKD 247
                                          V+  L +D+ ++             L   
Sbjct: 237 SP----------------------------AVADQLTADVGDLATRTTTVVLTPVQLANG 268

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSY 307
               L            +E+A  ++           E D +S      +  +V G  ++ 
Sbjct: 269 AKELL------------DEVATGKITG---------EEDRYSHTDLWDFQANVEGSQAAV 307

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMI 367
                         A++  +I   +  L   ++++F          +   +    +  + 
Sbjct: 308 --------------AALRPVIDAKDPALGPVLDERFQAVDTLLQGYR-SGDGYVLYTAL- 351

Query: 368 SENNPEGNKIVRNLINDLITQTESLRKIRIA 398
               PE  K +   ++ L      +      
Sbjct: 352 ---TPEDIKKMSAAVDALSEPVSKVAGTVTT 379


>gi|227536191|ref|ZP_03966240.1| possible iron-regulated protein A [Sphingobacterium spiritivorum
           ATCC 33300]
 gi|227244088|gb|EEI94103.1| possible iron-regulated protein A [Sphingobacterium spiritivorum
           ATCC 33300]
          Length = 328

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 59/406 (14%), Positives = 119/406 (29%), Gaps = 95/406 (23%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
           F+ ++ +   +   A     N  ++ +    + I    ++        L  AI+  +   
Sbjct: 5   FLGLVILPVLVSCSAGQDKINTQIKIIDNIESHIIIPTHQLLCERVIDLQGAIQR-IEIG 63

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVN--AWPLDEGFIDYVDSSYGK 120
           N  +L  AR  W+  R  ++Q+E Y      + +  ++++   + L +   D ++     
Sbjct: 64  NDISLLQARDAWLETRELWEQAEGYAIEESKIVSIRQRMDEGTYALSQQQPDRINKGE-- 121

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
                                                              +  IE++LW
Sbjct: 122 ---------------------------------------------------FQQIEYILW 130

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           G D        G R   D    +            L  +S  +V    +++         
Sbjct: 131 GSD--------GMRMAADLTETDLAS---------LMTISDSMVVQTTQLLAFTKETAWT 173

Query: 241 TKDLMKDINAGLNSI-------ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTY 293
              L        + I         G       ++   ++          Q  + +SDNT 
Sbjct: 174 KAKLKAKNEEQRSQICQQRMKDYVGGMIGVTQQILETKITEPDAPISAVQIEEPYSDNTK 233

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
           +  LN++I I + YTG           GA I  ++   ++ L + +     ++ K  + L
Sbjct: 234 SDILNNIIAIENLYTGRLD-----LHKGAGIAAVVDRQDKVLDETLRKSIEDSKKAINAL 288

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL 399
            +      S D             V      L T  E L+   + L
Sbjct: 289 PESYSMALSND----------RDAVLVAKVKLQTLQELLKDRLLPL 324


>gi|241207257|ref|YP_002978353.1| hypothetical protein Rleg_4576 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861147|gb|ACS58814.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 366

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 45/381 (11%), Positives = 106/381 (27%), Gaps = 77/381 (20%)

Query: 5   TIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK 64
              S V    +    +  +     + +    +    Y +    A  L +A++ L     +
Sbjct: 15  LATSAVAQTATPPAGLNEDAVPAVMQRAVDEVIRPGYRNMQQSAARLTTAMKDLCADGTQ 74

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
           + L+ A+  +      +   E+ + G  I D   + +  +P  +G               
Sbjct: 75  QTLDKAKSTFDDTIRYWSIIEIVQTGPVIQDNLFEHILFYPDRKG--------------- 119

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
                          V  K++   I   D       A    +    G   +E++L+G   
Sbjct: 120 ---------------VGLKQVQALIAKADPKDATVDAIAGKSVALQGLTALEYVLYGNGS 164

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
              V + G+                  R  Y + V+  +  +  E++ AW          
Sbjct: 165 DDLVGQKGSF-----------------RCLYGEAVAGNIQREAGEVVAAWEKPDGVQASW 207

Query: 245 MKDINAGLNSI--------ITGMTSLSYNELAGERMNLGLI----LHDPEQEIDCFSDNT 292
                   + +        + G+       +  +R+            P   I   S NT
Sbjct: 208 KHPGPQSNDFMDNKEAVTALLGILVHGAENVRDQRLEQFYKGKDTAPRPRMAIYWRSKNT 267

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGA----------SIHDLISHNNRNLA------ 336
           + S   ++ G+ + +    +                    S+ D +   N ++       
Sbjct: 268 WKSMAANLEGLRTLWQKAGMAELLPPDKQPIAAAIDEDFKSLLDSVPKLNPDIDVATSDA 327

Query: 337 --QEINDKFSNTMKDFHILKD 355
              +++   + +      + D
Sbjct: 328 EKAKLDTLLAESRDLITRISD 348


>gi|311893762|dbj|BAJ26170.1| hypothetical protein KSE_03220 [Kitasatospora setae KM-6054]
          Length = 385

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 46/386 (11%), Positives = 100/386 (25%), Gaps = 128/386 (33%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
           +   A S  P  + +++ +  A      Y  A   A      +E         ++E A+ 
Sbjct: 127 ITVTAGSSAPAKADDRLTRAVADY--RTY--AQEQADATIPVVEQFAAAVTAGDVEKAKS 182

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            +  +R+ ++++E                   P+ E F D    +               
Sbjct: 183 LFAASRVGWERTE-------------------PVAESFGDVDPKTDT------------- 210

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
                                           +    TG+H IE  LW      +     
Sbjct: 211 --------------------------REDALGEGQSWTGWHRIEKSLWVDGKIGDEE--- 241

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGL 252
                                   K ++  LV+DL++  K           +       L
Sbjct: 242 ------------------------KALAAQLVTDLKDWQKRIPEAEITPTGMANGAKELL 277

Query: 253 NSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYI 312
                       +E++  ++           E D +S    + +  +V G   +Y     
Sbjct: 278 ------------DEVSKNKITG---------EEDRYSHTDLSDFAANVEGARQAYEL--- 313

Query: 313 RMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNP 372
                      +  + + N   L++ ++ +F          +       S+D++      
Sbjct: 314 -----------LKPVAAENEPGLSKTLDAEFEKITGLLGKYRAADGTYTSYDKV----TE 358

Query: 373 EGNKIVRNLINDLITQTESLRKIRIA 398
           +  K   + +N L      L    + 
Sbjct: 359 DERKTFSDAVNSLGEPLSKLAAAVVV 384


>gi|333027539|ref|ZP_08455603.1| putative lipoprotein [Streptomyces sp. Tu6071]
 gi|332747391|gb|EGJ77832.1| putative lipoprotein [Streptomyces sp. Tu6071]
          Length = 382

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 44/389 (11%), Positives = 98/389 (25%), Gaps = 133/389 (34%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           T+     +   +  L+  +  Y   A          A      +           L+ A+
Sbjct: 124 TVSGKGSAAERDPRLDAAVSAYRDYAQ-------DQADQTLPKVMVFTDAIRAGELDAAK 176

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +  +RI ++++E                   P+ E F D    +  + +         
Sbjct: 177 KAYAPSRIGWERTE-------------------PVAESFGDIDPKTDTRAD--------- 208

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                                                 TG+H +E  L+           
Sbjct: 209 ------------------------------GLEKGQKWTGWHRLEKALFEDGKIGAEE-- 236

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                                    K ++  L  DL++  +  G        +       
Sbjct: 237 -------------------------KTLATRLDKDLKDWQRRVGRAVITPTSMANGAKDL 271

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L            +E+A  ++           E + +S      +  +V G   +YT   
Sbjct: 272 L------------DEVATGKVTG---------EEERYSHTDLVDFKANVEGAEKAYTL-- 308

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE--SFDQMISE 369
                       +  +   N+ +L   ++ +F+   K     +   ++ E  S+D++   
Sbjct: 309 ------------LRAVAKTNDPDLVARLDTRFAALDKQLDAYRPSPDSYEFTSYDKV--- 353

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIRIA 398
                 K + + +N L      L    + 
Sbjct: 354 -GEARRKKLSDGVNALAEPLSKLAAAVVG 381


>gi|296392947|ref|YP_003657831.1| peptidase M75 [Segniliparus rotundus DSM 44985]
 gi|296180094|gb|ADG97000.1| Peptidase M75, Imelysin [Segniliparus rotundus DSM 44985]
          Length = 384

 Score =  106 bits (264), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 53/388 (13%), Positives = 107/388 (27%), Gaps = 125/388 (32%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
           FT+   +++       + +L N A+  + +Y   +     L  A           ++  A
Sbjct: 122 FTVTGPSVA---QADPKGLLANAASE-YKRY--VVSQIDALKQATAEFADKIKAGDVAGA 175

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           +  +  AR+ Y++ E                   P+ E F D                  
Sbjct: 176 KAVYPVARLYYERIE-------------------PIAESFQD------------------ 198

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
                               + DL   +   +     + TG+H +E  LW          
Sbjct: 199 -----------------PKNNLDLKIDMRIDDAKSGIVFTGFHRLEQDLWEGVKPDTN-- 239

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
                                       ++  LV+D+ E+       G     L      
Sbjct: 240 ---------------------------QIADQLVADVGELDAKVKDPGFTFTGL------ 266

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
               I  G   L  +E+A  ++           E D +S      +  ++ G   +    
Sbjct: 267 ---DIAHGAQQL-LDEVAATKITG---------EEDRYSHTDLWDFQANIEGSQHAI--- 310

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
                      A++  +I      L  +I+  F+   ++   L+     +   DQ     
Sbjct: 311 -----------AALRQVIDERKPGLGPQIDAAFAKVQQELDALRQGDGFVFYTDQ---TV 356

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRIA 398
           +P+  K   + I+ L  Q   +  +   
Sbjct: 357 SPQKRKAFSDSIDALSKQVSQVEAVVAG 384


>gi|29832469|ref|NP_827103.1| lipoprotein [Streptomyces avermitilis MA-4680]
 gi|29609588|dbj|BAC73638.1| putative lipoprotein [Streptomyces avermitilis MA-4680]
          Length = 382

 Score =  106 bits (264), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 48/379 (12%), Positives = 100/379 (26%), Gaps = 129/379 (34%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
              +  L+K +  Y   A  + ++ L  A                 ++E A+ ++  +R+
Sbjct: 129 AKRDPRLDKAVAAYREYAQEQADETLPKAE-------AFAKAVKAGDIEAAKKEFATSRL 181

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKII 139
            ++++E                   P+ E F D       +E+                 
Sbjct: 182 GWERTE-------------------PVAESFGDIDPKVDVREDGL--------------- 207

Query: 140 VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
                                         TG+H +E  LW      +            
Sbjct: 208 --------------------EDGQDPATDWTGWHRLEKSLWQDKKIGDRE---------- 237

Query: 200 DIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGM 259
                            K ++  LV+DL +  K  G        +       L       
Sbjct: 238 -----------------KKLADQLVTDLTDWQKRVGKAEITPSSMANGAKELL------- 273

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
                +E+A  ++           E D +S    + +  +V G   +Y            
Sbjct: 274 -----DEVATGKVTG---------EEDRYSHTDLSDFKGNVEGAQKAYEL---------- 309

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI--ESFDQMISENNPEGNKI 377
               +  +   N+  LA E++ +F+         +    +    S+D++         K 
Sbjct: 310 ----LKPVAKENDAALATELDKQFTALNTLLDKYRTDKTSYDFTSYDKV----GKADRKE 361

Query: 378 VRNLINDLITQTESLRKIR 396
           + + +N L      L    
Sbjct: 362 LSDAVNALAEPLSKLAAAV 380


>gi|259416954|ref|ZP_05740874.1| imelysin superfamily protein [Silicibacter sp. TrichCH4B]
 gi|259348393|gb|EEW60170.1| imelysin superfamily protein [Silicibacter sp. TrichCH4B]
          Length = 338

 Score =  106 bits (263), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 50/409 (12%), Positives = 103/409 (25%), Gaps = 93/409 (22%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M  ++ ++           +    +L   + +        Y           +  E    
Sbjct: 1   MSVLSRLASTACALVALTELARADALTDAVID--QHILPTYARLATETAEFATLTENDC- 57

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
           TP     E  R  W  A   +  +   RFG    D     +  WP               
Sbjct: 58  TPTS---EAVRTAWGEAFDAWVAASHLRFGPSEADNRAFAIAFWPDSRSK---------- 104

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
                                 K +   ++  D +          +    G++ +E+L +
Sbjct: 105 --------------------TPKALRSLLLDSDPVVNTPEDFATASVAVRGFYALEYLFY 144

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ- 239
                          Y D                ++K V++ L  +   ++  W  D   
Sbjct: 145 DP------------AYADLT-------SPDYACAFVKAVAQDLSRNSTAILTEWQEDYAD 185

Query: 240 ---ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLI---LHDPEQEIDCFSDNTY 293
                 D  +        ++  +T+     LA  R+   L       P +     S  + 
Sbjct: 186 KLRHPDDRYRSDEEAHQELLKALTTGLEI-LADMRLGRPLGTFDTPRPNRAEARRSGRSL 244

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
                 +  +                    +  L+S  ++ L+Q +   F    +    L
Sbjct: 245 RHVQIQLDSLRQ------------------LAQLLSEGDQELSQHLTQLFDKADRHAANL 286

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
            D        D   +  +    + +      L      +++I  ALDL 
Sbjct: 287 VD--------DPSFAGVSDPQKRFLLET---LQQDVREIKEIA-ALDLG 323


>gi|269967083|ref|ZP_06181151.1| hypothetical protein VMC_25810 [Vibrio alginolyticus 40B]
 gi|269828342|gb|EEZ82608.1| hypothetical protein VMC_25810 [Vibrio alginolyticus 40B]
          Length = 345

 Score =  106 bits (263), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 44/405 (10%), Positives = 118/405 (29%), Gaps = 83/405 (20%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
               +S+V    +   S     S   + Q+   +     +  L     L+        + 
Sbjct: 10  IAATLSLVGCQSTVGSSSAKPESTSHISQSVYEVEFQSAQTFLAQTTELEQRFADYCASE 69

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +K +    + QW +  + +   +    G  +       V  WP  +              
Sbjct: 70  SKDD-AQVKQQWHQTMLAWMALQGQERGPAMALEQSWNVQFWPDKK-------------- 114

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                             N     +S+++              +    G   +E+LL+ +
Sbjct: 115 ------------------NTTGRKMSVLTKSDQAWSAEDISTQSVTVQGLGALEWLLYDK 156

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
                                 T             +++ L +  + +  +W  +   + 
Sbjct: 157 AS--------------------TLSSNNNTCATGVSIAENLDNKAQIIADSWAENPWKSL 196

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGL---ILHDPEQEIDCFSDNTYASYLND 299
           ++ +  +  ++ +   +      E + ++++  L       P       S+ + ++   +
Sbjct: 197 EMTEWESEYISLLSNQL------EYSMKKLSRPLAKIGKPRPYFSESWRSETSLSNLKAN 250

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHN-NRNLAQEINDKFSNTMKDFHILKDRAE 358
           + G+ + Y            +G  +  L+    + +LA  +  +F         L+   E
Sbjct: 251 LQGMEALYFA----------NGNGLDALLREQGHEDLADRVVHQFEMA------LETWPE 294

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI 402
           +   F    +    EG ++V    N L      +  ++ I L ++
Sbjct: 295 DKSLF---AALQTKEGYRMVLAQYNKLEQLKYLIHEEVAIELGVV 336


>gi|290960983|ref|YP_003492165.1| lipoprotein [Streptomyces scabiei 87.22]
 gi|260650509|emb|CBG73625.1| putative lipoprotein [Streptomyces scabiei 87.22]
          Length = 383

 Score =  106 bits (263), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 45/386 (11%), Positives = 97/386 (25%), Gaps = 129/386 (33%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
                     +  L++ + +Y              A      ++         ++E A+ 
Sbjct: 123 ATGGGKVAARDPRLDEAVASYRKYVQ-------TQADETIPLVKVFADAVKDGDVEAAKK 175

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            +  +RI ++++E                   P+ E F D       +E+          
Sbjct: 176 AYAPSRIGWERTE-------------------PVAESFGDIDPKVDVREDGL-------- 208

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
                                                TG+H +E  LW     T      
Sbjct: 209 ---------------------------EEGQDPEKDWTGWHRLERSLWKDGKLTARD--- 238

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGL 252
                                     ++  LV+DL++  +  G        +       L
Sbjct: 239 ------------------------SELADRLVTDLDDWRERVGKAEITPTSMANGAKELL 274

Query: 253 NSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYI 312
                       +E+A  ++           E + +S      +  +V G   SY     
Sbjct: 275 ------------DEVATGKVTG---------EEERYSHTDLVDFKANVEGAEKSY----- 308

Query: 313 RMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL--KDRAENIESFDQMISEN 370
                    A +  + + N+  L +E++ +F+                +  S+D++    
Sbjct: 309 ---------ALLKSVAAENDPELTKELDQQFAALNTLLDKYRKDKTGYDFVSYDKV---- 355

Query: 371 NPEGNKIVRNLINDLITQTESLRKIR 396
                K + + +N L      L    
Sbjct: 356 GKAEQKELSDAVNALAEPLSQLAAAV 381


>gi|91227201|ref|ZP_01261660.1| hypothetical protein V12G01_16442 [Vibrio alginolyticus 12G01]
 gi|91188729|gb|EAS75017.1| hypothetical protein V12G01_16442 [Vibrio alginolyticus 12G01]
          Length = 345

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/405 (10%), Positives = 116/405 (28%), Gaps = 83/405 (20%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
               +S+V    +   S     S   + Q+   +     +  L     L+        + 
Sbjct: 10  IAATLSLVGCQSTIGSSSAKPESTSHISQSVYEVEFQSAQTFLAQTTELEQRFADYCASE 69

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +K +    + QW +  + +   +    G          V  WP  +              
Sbjct: 70  SKDD-AQVKQQWHQTMLAWMALQGQERGPATALEQSWNVQFWPDKK-------------- 114

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                             N     +S+++              +    G   +E+LL+ +
Sbjct: 115 ------------------NTTGRKMSVLTKSDQAWSAEGISTQSVTVQGLGALEWLLYDK 156

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
                                 T             +++ L +  + +  +W  +     
Sbjct: 157 AS--------------------TLSSNSNTCVTGVAIAENLDNKAQIIADSWAENPWKAL 196

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGL---ILHDPEQEIDCFSDNTYASYLND 299
           ++ +  +  ++ +   +      E + ++++  L       P       S+ + ++   +
Sbjct: 197 EMTEWESEYISLLSNQL------EYSMKKLSRPLAKIGKPRPYFSESWRSETSLSNLKAN 250

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHN-NRNLAQEINDKFSNTMKDFHILKDRAE 358
           + G+ + Y            +G  +  L+    + +LA  +  +F         L+   E
Sbjct: 251 LQGMEALYFA----------NGNGLDALLREQGHADLADRVVHQFEMA------LETWPE 294

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI 402
           +   F    +    EG ++V    N L      +  ++ I L ++
Sbjct: 295 DKSLF---AALQTKEGYRMVLAQYNKLEQLKYLIHEEVAIELGVV 336


>gi|330998011|ref|ZP_08321842.1| hypothetical protein HMPREF9442_02945 [Paraprevotella xylaniphila
           YIT 11841]
 gi|329569312|gb|EGG51092.1| hypothetical protein HMPREF9442_02945 [Paraprevotella xylaniphila
           YIT 11841]
          Length = 397

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/179 (17%), Positives = 62/179 (34%), Gaps = 30/179 (16%)

Query: 14  PSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
            ++A   + +  ++ V+  +   +    Y+D       L +A++     P+    E A  
Sbjct: 248 AAYANGTITDAEMDSVVNGFVNKVVLPTYKDLKEKNTALCAAVQNFYNNPSDATFETACD 307

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            W+ AR P++QSE + FG   +   D  +++WPLD+  I  +  S   ++          
Sbjct: 308 AWLVARTPWEQSEAFLFGPVDILGLDPNMDSWPLDQVAIVNILESGNFDDLNWEDGDT-- 365

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                                            +    G+H +EFLL+       V   
Sbjct: 366 ---------------------------EEEITASQEVRGFHTLEFLLFKDGNPRTVAAQ 397



 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 59/199 (29%), Gaps = 26/199 (13%)

Query: 184 LKTNVREPGNRPYTDFDIG---NCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
              +    G +P   FD     N T  +      Y   V+K+L  D   +  +W    Q 
Sbjct: 26  SDDDGNNGGPKPDEKFDAAANLNYTPENAASWRNYSLQVAKLLQKDATTLYDSWETSFQG 85

Query: 241 TKDLMKD-----------INAGLNSIITGMTSLSYNELAGERMNLGLI-------LHDPE 282
            +   K              + +  II        +E+   ++                 
Sbjct: 86  GEAFKKTFIEHNGGTYTSALSCIEQIIDKCVE-ITDEVGNSKIGDPYNKWTAGQQTEALY 144

Query: 283 QEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDK 342
                +S ++   Y N++  I +     Y       +   S+++L+   N  L  +I ++
Sbjct: 145 AVESWYSFHSRDDYSNNIRSIRN----SYFNSMDSTVSQYSLYNLVQKINPALNTKIANE 200

Query: 343 FSNTMKDFHILKDRAENIE 361
             +T      +     N  
Sbjct: 201 IESTKNAILAIPQPFRNNI 219


>gi|318062267|ref|ZP_07980988.1| lipoprotein [Streptomyces sp. SA3_actG]
 gi|318077848|ref|ZP_07985180.1| lipoprotein [Streptomyces sp. SA3_actF]
          Length = 382

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/389 (11%), Positives = 99/389 (25%), Gaps = 133/389 (34%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           T+         +  L+  +  Y   A          A      ++          L+ A+
Sbjct: 124 TVSGKESGAKRDPRLDAAVSAYRDYAQ-------DQADQTLPKVKVFTDAIRAGELDAAK 176

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +  +RI ++++E                   P+ E F D    +  + +         
Sbjct: 177 KAYAPSRIGWERTE-------------------PVAESFGDIDPKTDTRAD--------- 208

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                                                 TG+H +E  L+           
Sbjct: 209 ------------------------------GLEKGQKWTGWHRLEKALFEDGKIGAEE-- 236

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                                    K ++  L +DL++  +  G        +       
Sbjct: 237 -------------------------KTLATRLDTDLKDWQRRVGRAVITPTSMANGAKDL 271

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L            +E+A  ++           E + +S      +  +V G   +YT   
Sbjct: 272 L------------DEVATGKVTG---------EEERYSHTDLVDFKANVEGAEKAYTL-- 308

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE--SFDQMISE 369
                       +  +   N+ +L   ++ +F+   K     +   ++ E  S+D++   
Sbjct: 309 ------------LRAVAKTNDPDLVARLDTRFAALDKQLDAYRPSPDSYEFTSYDKV--- 353

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIRIA 398
                 K + + +N L      L    + 
Sbjct: 354 -GEARRKKLSDGVNALAEPLSKLAAAVVG 381


>gi|302545933|ref|ZP_07298275.1| lipoprotein [Streptomyces hygroscopicus ATCC 53653]
 gi|302463551|gb|EFL26644.1| lipoprotein [Streptomyces himastatinicus ATCC 53653]
          Length = 377

 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/386 (11%), Positives = 100/386 (25%), Gaps = 132/386 (34%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
            +      +   +  L+K +  Y   A  + ++ L  A+              K +L  A
Sbjct: 121 VSATGKGAAAERDPRLDKAVAAYRAYAQKQADETLPKAQ-------AFADAVKKDDLAAA 173

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           +  +  +R+ ++++E                   P+ E F D                  
Sbjct: 174 KKAYAPSRVGWERTE-------------------PVAESFGDIDPK-------------- 200

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
                                      +           TG+H +E  LW          
Sbjct: 201 -------------------------VDVREDGLEKGQKWTGWHRLEKSLW---------- 225

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
                         T             ++  L+ DL++  K  G        +      
Sbjct: 226 ---------QTKKITKADHD--------LADQLIKDLKDWQKRVGTAEITPTSMANGAKE 268

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
            L            +E+   ++           E + +S      +  +V G  +SY   
Sbjct: 269 LL------------DEVQTGKVTG---------EEERYSHTDLVDFEGNVEGARTSYQL- 306

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
                        +  +   N+  LA++++ +F+   K     ++  +   S+D      
Sbjct: 307 -------------LKPVAGKNDPALAKDLDKQFAAVEKQLDQYRE-GDGFVSYD----TV 348

Query: 371 NPEGNKIVRNLINDLITQTESLRKIR 396
           +    K + + +N L      L    
Sbjct: 349 SEGKRKELSDAVNALAEPLSKLAAAV 374


>gi|170782553|ref|YP_001710886.1| putative lipoprotein [Clavibacter michiganensis subsp. sepedonicus]
 gi|169157122|emb|CAQ02301.1| putative lipoprotein [Clavibacter michiganensis subsp. sepedonicus]
          Length = 405

 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 52/385 (13%), Positives = 111/385 (28%), Gaps = 116/385 (30%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
           FT+    +++  +   +      A +A+ K          L  A +         + + A
Sbjct: 134 FTVTGDQVALAGDAEQQGQDAAAAYLAYVK-----DQVGRLLPATQEFADAYLASDDDRA 188

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           R  +  AR  Y++ E                   P+ E F D                  
Sbjct: 189 RSLYPTARAYYERVE-------------------PVAESFGDLDPEI------------- 216

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
                                         A+       TG+H IE  LW    + +   
Sbjct: 217 --------------------------DFREADVEPGTEWTGWHRIEKDLW----QPSPDA 246

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
            G   YT     +                ++ L +D +E+  A   DG +          
Sbjct: 247 NGGDVYTPLGTADRAHF------------AQELTADTQELYDAVHADGFSVD-------- 286

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
            ++++  G   L  +E+A  ++           E + +S      +  ++ G   +Y G 
Sbjct: 287 -ISTVSNGAVGLM-DEVASGKITG---------EEEIWSHTDLWDFQANLEGARVAYEG- 334

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
                        + D+++  +  L   ++ +F++   +        +   ++D++    
Sbjct: 335 -------------VRDIVAPKDPQLVATLDAQFASLETELAAYGTLDKGFTTYDRL---- 377

Query: 371 NPEGNKIVRNLINDLITQTESLRKI 395
             E  K + + +N L      L   
Sbjct: 378 TTEQVKGLADGVNALAEPLSKLTGA 402


>gi|99082043|ref|YP_614197.1| hypothetical protein TM1040_2203 [Ruegeria sp. TM1040]
 gi|99038323|gb|ABF64935.1| hypothetical protein TM1040_2203 [Ruegeria sp. TM1040]
          Length = 342

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/362 (11%), Positives = 84/362 (23%), Gaps = 80/362 (22%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +Y +T  +        ALS                     Y      +    +  ++   
Sbjct: 4   LYRLTATACTVACTVLALSSAARADALAEAV-IDQHILPTYAQLASESAEFATLAQSDCA 62

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
             +    E  R  W  A   +  +   RFG   VD     +  WP               
Sbjct: 63  PTS----EAVRNAWGAAFDAWVAASHLRFGPSEVDNRAFAIAFWPDSRSK---------- 108

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
                                 K +   + +   +          +    G++ +E+L +
Sbjct: 109 --------------------TPKALRSLLTNRSPVVDTPEDFATASVAVRGFYALEYLFF 148

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ- 239
                                     G       +++ V++ L  +   ++  W  D   
Sbjct: 149 D-------------------PAYADLGDPDYACAFVQAVARDLARNSAAILDDWEQDYAD 189

Query: 240 ---ATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDNTY 293
                    +        +   +T+     LA  R+   L       P +     S  + 
Sbjct: 190 QLRTPAARYRSETEAHQELFKALTTGLEI-LADMRIGRPLGTFDAPKPNRAEARRSGRSL 248

Query: 294 ASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL 353
                 +  +                    +  L+S N+  L + +   F    +    L
Sbjct: 249 RHIEIQLQSLRE------------------LALLLSANDGALTEHLTQVFDKADRHADQL 290

Query: 354 KD 355
            D
Sbjct: 291 SD 292


>gi|83944205|ref|ZP_00956661.1| hypothetical protein EE36_02698 [Sulfitobacter sp. EE-36]
 gi|83845072|gb|EAP82953.1| hypothetical protein EE36_02698 [Sulfitobacter sp. EE-36]
          Length = 338

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/399 (10%), Positives = 105/399 (26%), Gaps = 87/399 (21%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M  + +   +F  P  A + V +  L  V+ ++      +Y        +L +  +    
Sbjct: 1   MKKLVLALGLFCAPLGAAAEVGSAVLRDVVDHH---ILPRYTTLAERTDSLATVAQQNCA 57

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P+       R  +  A   +      RFG    D     +  WP   G           
Sbjct: 58  -PDDA---ALRTAYHDAFDAWIAVSHLRFGPSETDNRAFALAFWPDSRG----------- 102

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
                                 K +   I   D + +  +A    +    G++ +EFLL+
Sbjct: 103 -------------------ATPKTLAGLITDADPVGRDPQAYADVSIAGRGFYALEFLLY 143

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
              +                    T G    R   ++ V+  + +  + ++  W      
Sbjct: 144 DDQI-------------------STMGDAGYRCALVQTVTADIATQSQAILDGWTSGYAE 184

Query: 241 TKDLMKDI-----NAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDNT 292
                 +             +    +L     A  R+   +       P +     S  +
Sbjct: 185 AVATPAEAGPYRSTEEAAQELFKALNLGLEFTADTRIGRPMGSFDRPRPNRAETRRSGRS 244

Query: 293 YASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHI 352
             + +  +  +                    + + ++ ++  +    +D+F   +     
Sbjct: 245 LRNVVVALTSLQD------------------LAERLAADDVAVVAAFDDRFDEALAIAAD 286

Query: 353 LKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTES 391
           L D      +        +    ++++  +  +      
Sbjct: 287 LDDPVFAGTA-----KPQSRLRVEVLQQSVTAIRDVARQ 320


>gi|86355959|ref|YP_467851.1| hypothetical protein RHE_CH00302 [Rhizobium etli CFN 42]
 gi|86280061|gb|ABC89124.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 366

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/351 (12%), Positives = 106/351 (30%), Gaps = 77/351 (21%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +    Y +    A  L +A++ L +   ++ L+ A+  +      +   E+ + G  I 
Sbjct: 45  EVIRPGYRNMQQSAARLTTAMKDLCSDGTQQTLDKAKSAFDDTIRYWSIIEIVQTGPVIQ 104

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D   + +  +P  +G                              V  K++   I   D 
Sbjct: 105 DNLFEHILFYPDRKG------------------------------VGLKQVQALIAKADP 134

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
                 A    +    G   +E++L+G   +  V++ G                   R  
Sbjct: 135 KDATVDAIADKSVALQGLTALEYVLYGSGSEDLVKQKGGF-----------------RCL 177

Query: 215 YLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI--------ITGMTSLSYNE 266
           Y + V+  +  +  E++ AW                  + +        + G+       
Sbjct: 178 YGQAVAGNIQREAGEVVAAWEKPDGVQASWKHPGPQSNDFMDNREAVTALLGILVHGAEN 237

Query: 267 LAGERMNLGLI----LHDPEQEIDCFSDNTYASYLNDVIGIISSYT----GEYIRMNGEK 318
           +  +R+            P   I   S NT+ S   ++ G+ + +      E +  +   
Sbjct: 238 VRDQRLEQFYKGKDTAPRPRMAIYWRSKNTWKSMAANLEGLRTLWQKAGMAELLPADKRS 297

Query: 319 IHG------ASIHDLISHNNRNLA--------QEINDKFSNTMKDFHILKD 355
           +         S+ D +   N ++          +++   +++ +    + D
Sbjct: 298 VEASIDADFKSLLDSVPKLNPDIDVAVSDAEKAKLDALLADSRQLITRISD 348


>gi|163803519|ref|ZP_02197389.1| hypothetical protein 1103602000424_AND4_00403 [Vibrio sp. AND4]
 gi|159172695|gb|EDP57546.1| hypothetical protein AND4_00403 [Vibrio sp. AND4]
          Length = 345

 Score =  104 bits (259), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 44/405 (10%), Positives = 116/405 (28%), Gaps = 83/405 (20%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
             T +S++    +   S     S   + QN   I     +  L     L+ +        
Sbjct: 10  IATTLSLLGCQSTTGSSPAKPESTSHISQNAYEIEFNAAQAFLAQTSELEQSFVAYCALE 69

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
            K++    + QW +  + +   +    G          +  WP  +              
Sbjct: 70  TKED-TQIKRQWHQTMLAWMALQGQERGPATALEQSWNIQFWPDKK-------------- 114

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                             N     +S ++        +     +    G   +E+LL+ Q
Sbjct: 115 ------------------NTTGRKMSALTKSDQTWHAKDISTQSVTVQGLGALEWLLYDQ 156

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
               +                               +++ L +  + +  +W  +   + 
Sbjct: 157 SSTLSSNSN--------------------TCATGVAIAENLDNKAQIIADSWAENPWKSL 196

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGL---ILHDPEQEIDCFSDNTYASYLND 299
           ++ +  +  ++ +   +      E + ++++  L       P       S+ + ++   +
Sbjct: 197 EITEWESEYISLLSNQL------EYSMKKLSRPLAKIGKPRPYFSESWRSETSLSNLKAN 250

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHN-NRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  + + Y            +G  +  L+    + +LA  +  +F         L    E
Sbjct: 251 LTAMEALYFA----------NGNGLDALLREQGHADLADRVVHQFEMA------LDTWPE 294

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI 402
           +   F    +    EG ++V    N L      +  ++ I L ++
Sbjct: 295 DKSLF---AALQTKEGYRMVLAQYNKLEQLKYLIHEEVAIELGVV 336


>gi|254427539|ref|ZP_05041246.1| hypothetical protein ADG881_769 [Alcanivorax sp. DG881]
 gi|196193708|gb|EDX88667.1| hypothetical protein ADG881_769 [Alcanivorax sp. DG881]
          Length = 344

 Score =  104 bits (259), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 44/399 (11%), Positives = 109/399 (27%), Gaps = 85/399 (21%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           +   N   E  +Q    +    ++        L  A+E   T P + ++ +    + +A+
Sbjct: 17  TACSNPRQEVTVQLANDVLLPAHQQWRDSNAALVDAVEAYCTAP-QASVGDLETAFYQAQ 75

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
             +   +    G         +V  WP     +     S   E +               
Sbjct: 76  SRWSHLQPLMVGPLSEGNRSWQVQFWPDKRNMVVRQTESLLDETDSLTG----------- 124

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
                                      + +  G    E++L+ Q                
Sbjct: 125 ---------------------EQLEKASVVVQGLTAFEYVLFDQ---------------- 147

Query: 199 FDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITG 258
                       R    L  +++  ++  E ++  W   G     L    N    +   G
Sbjct: 148 ---SVALAEKHDRYCPLLTGIARHQLALSESVLALWNEPGGMLAQLRDFPNERYATADEG 204

Query: 259 MTSLSYNELAG-----ERMNLGLI-----LHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
           + ++   ++ G     +++   +      +  P Q     S  +  +    + G  + + 
Sbjct: 205 LAAILRTQITGVDVLKKKLGTPMGRLNQGVAQPYQAEAWRSRQSIENLQASLQGAQAVWE 264

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
                          +  L+S  +  L ++I+  +++       L      +       +
Sbjct: 265 --------------RVRSLVS--DAALVKDIDQAYADVANQLAALPAPLMELVQ-----A 303

Query: 369 ENNPEGNKIVRNLINDL--ITQTESLRKIRIALDLIEPN 405
             + E    +   +++L    QTE  R + I +     +
Sbjct: 304 PQHSETLTTLYAALDNLENRQQTELARNLNIQIGFNAND 342


>gi|145222541|ref|YP_001133219.1| hypothetical protein Mflv_1951 [Mycobacterium gilvum PYR-GCK]
 gi|145215027|gb|ABP44431.1| protein of unknown function DUF451 [Mycobacterium gilvum PYR-GCK]
          Length = 378

 Score =  104 bits (259), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/387 (10%), Positives = 99/387 (25%), Gaps = 130/387 (33%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
           FT+    +++      ++   +Y    +            L  A+E  V      ++E A
Sbjct: 120 FTVTGDEVAVDTEGKFKEAADSYKRYVN-------SQVEALVPAVEAFVAAIKSGDIEGA 172

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           + Q                              +P    + + ++               
Sbjct: 173 KAQ------------------------------YPTSRTYFERIEPVAESFPN------- 195

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
                                 D    L  A+       TGYH +E  LW    + +   
Sbjct: 196 --------------------DLDPRIDLREADLEPGQKWTGYHRLEKDLWVTGPQPDTN- 234

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
                                       ++  LV+D++E+         +          
Sbjct: 235 ---------------------------AIADQLVADVKELQAGVSAPDFSVDSTQ----- 262

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
                I G      +E+A  +++          E D FS      +  ++ G        
Sbjct: 263 -----IAGGAQGLLDEIATSKISG---------EEDIFSHTDLWDFSANLQGSQ------ 302

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
                      AS+  ++   N +L   ++ +F          ++  +   ++D++    
Sbjct: 303 --------TAVASVRPILDERNPDLGTRVDQRFEEVEALLQRYRE-GDGFVTYDKV---- 349

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRI 397
                + +   I+ L  +   ++ +  
Sbjct: 350 TEPERQELSRAIDALSKEVSQVQGVIA 376


>gi|261879091|ref|ZP_06005518.1| iron-regulated protein A [Prevotella bergensis DSM 17361]
 gi|270334271|gb|EFA45057.1| iron-regulated protein A [Prevotella bergensis DSM 17361]
          Length = 424

 Score =  104 bits (259), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 59/162 (36%), Gaps = 11/162 (6%)

Query: 26  LEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQS 84
           L+ ++ +    +    Y D     + L   I      P+ +  +     WI+AR P++ S
Sbjct: 270 LDPIVSHVVDEVIVPTYSDLKKYNKELYQKILAFQAKPSNEGFKACCEAWIKARQPWESS 329

Query: 85  EVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKE 144
           E Y FG       D  ++ WPLD   ID +++    E+     ++ + + + +      +
Sbjct: 330 EAYLFGPVADKGLDPNMDTWPLD---IDGIENILKSEDWNKLNWSGDFVEDEEGDNGSSQ 386

Query: 145 IDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
           +                         GYH IEFL++      
Sbjct: 387 LSPEEKKKAEAISS-------AQSLRGYHTIEFLIFKNGKPR 421



 Score = 95.4 bits (235), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 59/179 (32%), Gaps = 28/179 (15%)

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM-------------KDINAGLNS 254
           + +    Y+ VV K+LV D   +   W       K                      L  
Sbjct: 54  NQKAWGNYMAVVGKLLVDDANALYDDWTKSYNGGKSYAELFKEHKSEALKLNSAYDCLAL 113

Query: 255 IITGMTSLSYNELAGERMNLGLILHDPE------------QEIDCFSDNTYASYLNDVIG 302
           ++T M     +E+  E++      +  +                 +S ++   Y+N+++ 
Sbjct: 114 LVTYM-DHIADEVGSEKIGSPYRKYTEKWPNKANMKAGLYAVESWYSWHSRLDYMNNILS 172

Query: 303 IISSYTGEYIRMNG--EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
           I + Y G Y +      K H  S++  +  N+  L +++       +K    +     N
Sbjct: 173 IRNGYYGVYDKSFSKLSKAHANSLYAYVEKNDPALNKKVAQAIDKAIKAIDNIPQPFRN 231


>gi|110632998|ref|YP_673206.1| hypothetical protein Meso_0641 [Mesorhizobium sp. BNC1]
 gi|110283982|gb|ABG62041.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 358

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 55/416 (13%), Positives = 115/416 (27%), Gaps = 87/416 (20%)

Query: 3   FITIISIVFTLPSHAL--SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
            +  + +V   P+ A   + VP     +V++ Y                 L+  I  L  
Sbjct: 5   IVIGLGVVCCTPAMAQDAAHVPADIGSRVVKQY---VEPGLAAFTKATAELEDKITALCA 61

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
            P +  L +AR  +      +    + RFG    ++  + +  WP               
Sbjct: 62  APAEPALRDARSAFAETIGAWGPVSILRFGPLTQESRFEHIFFWPDIRS----------- 110

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
                       +   ++     + D    +P  LR+        +    G   +EFLL+
Sbjct: 111 ------------VTLRQVQGLLAQRDEQAATPMELRE-------KSVAVQGLPALEFLLY 151

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG-- 238
           G   +    + G                   R  Y   ++  L     E+  AW  D   
Sbjct: 152 GAGSEELALKGG-----------------DYRCRYAGAIAANLAQLAGEIAAAWDQDSPF 194

Query: 239 -------QATKDLMKDINAGLNSIITGMTSLSYNELAGE----RMNLGLILHDPEQEIDC 287
                   A   L +  +   + I+  + + S            +   +   +  +    
Sbjct: 195 NAAFTRPSADSALYRSPSEVASEIVKALGT-SLQFTRDAELLPALGDSMEKANGRRAPFW 253

Query: 288 FSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTM 347
            S+ T+A     + G+             E +  A   + +  + R +   +     +  
Sbjct: 254 RSNLTFALLDAQLEGM------------IELLGAAGFDEELDDDGRAILDTMLFDLKHAR 301

Query: 348 KDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI 402
                +   AE         +    E    +      L     +L  ++  A+ L 
Sbjct: 302 NALAEVNAPAEA--------AFGGEETRGSIAYAAVALQGANRTLGEQLSAAIGLT 349


>gi|254475631|ref|ZP_05089017.1| conserved hypothetical protein [Ruegeria sp. R11]
 gi|214029874|gb|EEB70709.1| conserved hypothetical protein [Ruegeria sp. R11]
          Length = 365

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/401 (10%), Positives = 96/401 (23%), Gaps = 86/401 (21%)

Query: 11  FTLPSHALSIVPNVSLEKVLQ-NYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
             LP    +  P++  ++ ++   +      ++     +  L    +T    P    L  
Sbjct: 33  AELPEQMQTSAPDLHPDQQVEWILSGHILPGFDALAGRSADLAEVAKTHCA-PTDARL-- 89

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
            R  +  A   +      RFG          +  WP     I          + +     
Sbjct: 90  -RSAFGSAFDAWVAVSHLRFGPSETANRAFALAFWPDSRNKIPGTLRRALLADGDTTANW 148

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
           AN                                  +    G++ +E LL+  +L     
Sbjct: 149 AN---------------------------AEEFAKQSIALRGFYALEQLLYDPELM---- 177

Query: 190 EPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQ----ATKDLM 245
                          +     +    ++ ++  +      +   W            D  
Sbjct: 178 ---------------SLATPPQTCALVQAITTDMARTTAAISTDWHASYADELRTPSDRY 222

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDNTYASYLNDVIG 302
           +        +   +T+     L   R+   L       PE+     S  +       +  
Sbjct: 223 RTTAEVRQELFKSLTTG-LQILGDMRLGRPLGSFDAPRPERAEARRSARSLRHIRLTLAA 281

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
           +                    +   ++  + +LA+ +   F         L D A     
Sbjct: 282 ME------------------PLAQALAAGDTDLARAVTAAFDKARSRADQLDDPALAGV- 322

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLI 402
                   +P     +  L  D+    + +  ++   L + 
Sbjct: 323 -------GDPARRFRLETLQQDVTNIRDLVTSQLGPRLGVT 356


>gi|24216170|ref|NP_713651.1| hypothetical protein LA_3471 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45656609|ref|YP_000695.1| cytoplasmic membrane protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|24197418|gb|AAN50669.1| predicted periplasmic lipoprotein [Leptospira interrogans serovar
           Lai str. 56601]
 gi|45599844|gb|AAS69332.1| cytoplasmic membrane protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 404

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 49/354 (13%), Positives = 108/354 (30%), Gaps = 61/354 (17%)

Query: 18  LSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           +++  N S  + L   A  +A  +++  L     L ++        N   L + + +W+ 
Sbjct: 50  VALFANASTGEFLNYTANQVAIPQFKRLLSATDELKTSASAYQANQNDNTLSDLQSKWLV 109

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR  ++QSE++                         Y++ SY   N  + L     I N 
Sbjct: 110 ARKLFKQSEIF-------------------------YINRSYFPSNYFHRLD--GYILNE 142

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
                  ++ ++  +   +  +            G+  +E+ ++                
Sbjct: 143 NSRPTPNDLTVAAATNPSISTVDSY----PLTRKGFAALEYFIFDDGNG----------V 188

Query: 197 TDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSII 256
                 N   G+  R   Y+  ++ ++  D + ++ +W P      + +         I 
Sbjct: 189 HTLAAINVANGNAGR-RAYIVSLANVIQLDAQRLLNSWSPSSGNFAEELASGQGSFGGIK 247

Query: 257 TGMTSLSYNEL------AGERMNLGLI------LHDPEQEIDCFSDNTYASYLNDVIGII 304
             + S     +         R+ +            P +    +S+  Y   L+ + G+ 
Sbjct: 248 DAIDSFINGLVQLEYTNQDVRVGVPAGLTVSGTTQYPTKLESVYSNTAYQDLLSSLEGLE 307

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH-ILKDRA 357
             Y G     N       S+  L+   N  L   +  K S         +   A
Sbjct: 308 LVYFG-----NPGDREAKSLSYLVQFQNSALDARVKTKISTLKSLIQGRIDASA 356


>gi|190889969|ref|YP_001976511.1| hypothetical protein RHECIAT_CH0000339 [Rhizobium etli CIAT 652]
 gi|190695248|gb|ACE89333.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 366

 Score =  104 bits (258), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 46/351 (13%), Positives = 102/351 (29%), Gaps = 77/351 (21%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +    Y +    A  L +A++ L     ++ L+ A+  +      +   E+ + G  I 
Sbjct: 45  EVIRPGYRNMQQSAARLTTAMKDLCEAGTQQTLDKAKSAFDDTIRYWSIIEIVQTGPVIQ 104

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D   + +  +P  +G                              V  K++   I   D 
Sbjct: 105 DNLFEHILFYPDRKG------------------------------VGLKQVQALIAKADP 134

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
                 A    +    G   +E++L+G   +  V + G                   R  
Sbjct: 135 KDATVDAIAGKSVALQGLTALEYVLYGNGSENLVGQKGGF-----------------RCL 177

Query: 215 YLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI--------ITGMTSLSYNE 266
           Y   V+  +  +  E++ AW                  + +        + G+       
Sbjct: 178 YGAAVAGNIQREAGEVVAAWEKPDGVQASWKHPGPQSNDFMDNKEAVTALLGILGHGAEN 237

Query: 267 LAGERMNLGL----ILHDPEQEIDCFSDNTYASYLNDVIGIISSYT--GEYIRMNGEKIH 320
           +  +R+            P   I   S NT+ S   ++ G+ + +   G    +  +K  
Sbjct: 238 VRDQRLEQFYKGKDNAPRPRMAIYWRSRNTWKSIAANLEGLRTLWQKAGMAELLPPDKRS 297

Query: 321 GA--------SIHDLISHNNRNLA--------QEINDKFSNTMKDFHILKD 355
            A        S+ D +   N ++          +++   + +      + D
Sbjct: 298 IAASIDEDFKSLLDSVPKLNPDIDAATSDAEKAKLDTLLAESRDLITRISD 348


>gi|241760662|ref|ZP_04758754.1| 47 kDa lipoprotein [Neisseria flavescens SK114]
 gi|241318843|gb|EER55369.1| 47 kDa lipoprotein [Neisseria flavescens SK114]
          Length = 388

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 58/381 (15%), Positives = 111/381 (29%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y  A   A+ L +  +         ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLAQPLADY--KAYVQA--EAKELVAKTKAFTEAVKAGDIEKAKSLFAATRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +   +   +E++                 
Sbjct: 193 YERIE-------------------PIAELFNELDPAIDAREDDFK--------------- 218

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                +G +    TG+H IE  LW +   ++             
Sbjct: 219 ---------------------DGANDAAFTGFHRIEHALWVKKDVSD------------- 244

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                          +K ++  L  D+E + K           +             G  
Sbjct: 245 ---------------VKEIADKLFKDVESLQKEIDALSFPPSKV------------VGGA 277

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
           ++   E+AG +++          E D +S    + +  +V G                  
Sbjct: 278 AVLIEEVAGSKISG---------EEDRYSHTDLSDFQANVEGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   ++ L ++ +  F          K + +  E +D++    + E  K ++ 
Sbjct: 318 ---FRPLIEAKDKALLEKTDANFKQVEDILAKYKKQ-DGFELYDKL----SEEDRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L K+R  L L
Sbjct: 370 PINAL---AEDLAKLRGILGL 387


>gi|328474743|gb|EGF45548.1| hypothetical protein VP10329_18610 [Vibrio parahaemolyticus 10329]
          Length = 345

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/405 (10%), Positives = 112/405 (27%), Gaps = 83/405 (20%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
               +S+V    + + S         + Q    +     +  L  A  L+ +     + P
Sbjct: 10  VAATLSLVGCQSTTSSSDAQPEQTSHISQAVYEVEFHAAQSFLSQASQLEQSFADFCSAP 69

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
              ++E+ + QW    + +   +    G          V  W   +              
Sbjct: 70  K-NDVESVQQQWHSTMLAWMALQGQERGPATALEQSWNVQFWLDKK-------------- 114

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                             N     +S ++              +    G   +E+LL+  
Sbjct: 115 ------------------NTTGRKMSALTKADKVWTVEEISTQSVTVQGLGALEWLLYDD 156

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
                                 T        E    +++ L    + +  +W  +   + 
Sbjct: 157 AS--------------------TLNTNSNVCESGVAIAENLHDKAQIIANSWAENPWKSL 196

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGL---ILHDPEQEIDCFSDNTYASYLND 299
              +  +  ++ +   +      E + ++++  L       P       S+ + ++   +
Sbjct: 197 QKTEWESEYISLLSNQL------EYSMKKLSRPLAKIGYPRPYFSESWRSETSLSNLKAN 250

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR-NLAQEINDKFSNTMKDFHILKDRAE 358
           +  +   Y            +G  +  L+    +  LA  +  +F   ++ +   K    
Sbjct: 251 LESLHQLYFA----------NGKGLDALLRAQGKTQLADRVAYQFDMALETWPEDKSLFS 300

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI 402
            ++S D         G ++V    N L      +  ++ I L ++
Sbjct: 301 ALQSVD---------GYRLVLAQYNKLEQLKYLIHEEVAIELGVV 336


>gi|319638729|ref|ZP_07993488.1| hypothetical protein HMPREF0604_01112 [Neisseria mucosa C102]
 gi|317399970|gb|EFV80632.1| hypothetical protein HMPREF0604_01112 [Neisseria mucosa C102]
          Length = 388

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 60/381 (15%), Positives = 111/381 (29%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y  A   A+ L +  +         ++E A+  +   RI 
Sbjct: 137 ANEADLEKLAQPLADY--KAYVQA--EAKELVAKTKAFTEAVKAGDIEKAKSLFAATRIH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +   +   +E++                 
Sbjct: 193 YERIE-------------------PIAELFNELDPAIDAREDDFK--------------- 218

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                +G +    TG+H IE  LW +                  
Sbjct: 219 ---------------------DGANDAAFTGFHRIEHALWVK------------------ 239

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K  +  L+ D+E + K           +             G  
Sbjct: 240 ----------KDVSGVKETADKLMKDVESLQKEIDALSFPPSKV------------VGGA 277

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
           ++   E+AG +++          E D +S    + +  +V G                  
Sbjct: 278 AVLIEEVAGSKISG---------EEDRYSHTDLSDFQANVEGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   ++ L ++ +  F          K + +  E +D++    + E  K ++ 
Sbjct: 318 ---FRPLIEAKDKALLEKTDANFKQVEDILAKYKKQ-DGFELYDKL----SEEDRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L K+R  L L
Sbjct: 370 PINAL---AEDLAKLRGILGL 387


>gi|319943611|ref|ZP_08017892.1| PbrT family lead (Pb2+) uptake porter [Lautropia mirabilis ATCC
           51599]
 gi|319742844|gb|EFV95250.1| PbrT family lead (Pb2+) uptake porter [Lautropia mirabilis ATCC
           51599]
          Length = 301

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 44/386 (11%), Positives = 96/386 (24%), Gaps = 124/386 (32%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMC-ARTLDSAIETLVTTP 62
           I  + +       A+S    V   +++        A+Y+  +      L    +  V   
Sbjct: 32  IISVLVAHAAAFGAISAQAAVEPSELVGP-----IAEYKLFVDKNVSALVKDTKAFVAAV 86

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
               +E A+  +   R  Y++ E                   P+ E F D   +   + +
Sbjct: 87  KAGQIEKAKKLFAPVRTHYERVE-------------------PVAELFSDIDVAIDSRAD 127

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           +                                         +     G+H IE+ LW Q
Sbjct: 128 DHEKR------------------------------------EEDPGFGGFHRIEYALWHQ 151

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
                                            +   ++ L +D+EE+ K         +
Sbjct: 152 KDTKG----------------------------VVKYAEKLQADVEELHKRLTDLTFPPE 183

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
            +             G  ++   E+A  +++          E D +S      +  +  G
Sbjct: 184 KV------------VGGAAVLMEEVAATKISG---------EEDRYSHTDLWDFQANFEG 222

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
                                   LI+  ++    +    F          + +     +
Sbjct: 223 AYKIVEL--------------FKPLIAREDKAFLDKTEKNFETVFNTLKKYRTKDGGFVT 268

Query: 363 FDQMISENNPEGNKIVRNLINDLITQ 388
           +D++   +    +  V  L  DL   
Sbjct: 269 YDKLTEGDRKILSARVNTLAEDLSKL 294


>gi|302518687|ref|ZP_07271029.1| lipoprotein [Streptomyces sp. SPB78]
 gi|302427582|gb|EFK99397.1| lipoprotein [Streptomyces sp. SPB78]
          Length = 382

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 43/389 (11%), Positives = 98/389 (25%), Gaps = 133/389 (34%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           T+         +  L+  +  Y   A          A      ++          L+ A+
Sbjct: 124 TVSGKESGAKRDPRLDAAVSAYRDYAQ-------DQADRTLPKVKVFTDAIRAGELDAAK 176

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +  +RI ++++E                   P+ E F D    +  + +         
Sbjct: 177 KAYAPSRIGWERTE-------------------PVAESFGDIDPKTDTRAD--------- 208

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                                                 TG+H +E  L+           
Sbjct: 209 ------------------------------GLEKGQKWTGWHRLEKALFEDGKIGAEE-- 236

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                                    K ++  L  DL++  +  G        +       
Sbjct: 237 -------------------------KTLATRLDKDLKDWQQRVGRAVITPTSMANGAKDL 271

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L            +E+A  ++           E + +S      +  +V G   +YT   
Sbjct: 272 L------------DEVATGKVTG---------EEERYSHTDLVDFKANVEGAEKAYTL-- 308

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI--ESFDQMISE 369
                       +  +   N+ +L  +++ +F+   K     +   ++    S+D++   
Sbjct: 309 ------------LRAVAKTNDPDLVAQLDTRFAALDKQLDAYRPSPDSYAFTSYDKV--- 353

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIRIA 398
                 K + + +N L      L    + 
Sbjct: 354 -GEARRKKLSDGVNALAEPLSKLAAAVVG 381


>gi|260432798|ref|ZP_05786769.1| imelysin superfamily protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416626|gb|EEX09885.1| imelysin superfamily protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 336

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/407 (11%), Positives = 111/407 (27%), Gaps = 90/407 (22%)

Query: 4   ITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPN 63
           +  + +   +P  A++   +  L  V Q +      +++  +        A       P 
Sbjct: 3   LIAVILSALMPLCAVAQSRDAILTDVTQAH---ILPRFDHLVEATAA-LDAAARADCAPG 58

Query: 64  KKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENE 123
             +L   R  +  A   +  +   RFG   V      +  WP  +GF             
Sbjct: 59  SADL---RAAYHAAFDAWISASHLRFGPTEVGDRAFALAFWPDRKGF------------- 102

Query: 124 ENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQD 183
                         +       D +I  PD   +   A         G+  +E +L+   
Sbjct: 103 ----------TPKALSAMIAAEDPAIADPDAFAETSIAG-------RGFLALEMMLYDPA 145

Query: 184 LKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG----- 238
                                  G    R   ++ ++  +      + + W         
Sbjct: 146 FAD-------------------QGDAAYRCGLIRAIAADIHRTARAIDRDWHGYARILTQ 186

Query: 239 QATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDNTYAS 295
                  +  +  L  +   +T+      A  R+   +       P +     S  +   
Sbjct: 187 PGPDSPYRSADEALQELYKALTTG-LEFTADTRLGRPMGSFDRPRPNRAEARRSLRSLRH 245

Query: 296 YLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKD 355
               ++ +                    +   ++ ++  +A  ++D F+ ++     L D
Sbjct: 246 VELSLVALRD------------------LATRLAADHPQIAASLDDAFARSIARAQALDD 287

Query: 356 RAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
            A    +  Q          + ++  IND+ +   +  ++   L + 
Sbjct: 288 PALAGVATPQ-----GRLRVEALQQSINDIRSLAAA--QLGPTLGIS 327


>gi|148273360|ref|YP_001222921.1| secreted lipoprotein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147831290|emb|CAN02246.1| conserved secreted lipoprotein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 405

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 51/385 (13%), Positives = 112/385 (29%), Gaps = 116/385 (30%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
           FT+    +++  +   +      A +A+ K          L  A +         + + A
Sbjct: 134 FTVTGDQVALAGDAEQQGQDAAAAYLAYVK-----DQVGRLLPATQEFADAYLAGDDDRA 188

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           R  +  AR  Y++ E                   P+ E F D                  
Sbjct: 189 RALYPTARAYYERVE-------------------PVAESFGDLDPEI------------- 216

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
                                         A+       TG+H IE  LW    + +   
Sbjct: 217 --------------------------DFREADVEPGTEWTGWHRIEKDLW----QPSPDA 246

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
            G   YT     +                ++ L +D +++  A   DG +          
Sbjct: 247 NGGDVYTPLGAADRAHF------------AQELTADTQKLYDAVHADGFSVD-------- 286

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
            ++++  G   L  +E+A  ++           E + +S      +  ++ G   +Y G 
Sbjct: 287 -ISTVSNGAVGLM-DEVASGKITG---------EEEIWSHTDLWDFQANLEGARVAYEG- 334

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
                        + D+++  +  L   ++ +F++  K+        +   ++D++    
Sbjct: 335 -------------VRDIVAPKDPQLVATLDAQFASLEKELAAYGSLEKGFTTYDRL---- 377

Query: 371 NPEGNKIVRNLINDLITQTESLRKI 395
             +  K + + +N L      L   
Sbjct: 378 TTDQVKGLADGVNALAEPLSKLTGA 402


>gi|295839287|ref|ZP_06826220.1| imelysin superfamily protein [Streptomyces sp. SPB74]
 gi|197696902|gb|EDY43835.1| imelysin superfamily protein [Streptomyces sp. SPB74]
          Length = 382

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 43/389 (11%), Positives = 100/389 (25%), Gaps = 133/389 (34%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           T+         +  L+  +  Y   A          A      ++         +L+ A+
Sbjct: 124 TVSGKESGAKRDPRLDAAVSAYRDYAQ-------DQADRTLPKVKVFTDAIRAGDLDAAK 176

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +  +RI ++++E                   P+ E F D    +  + +         
Sbjct: 177 KAYAPSRIGWERTE-------------------PVAESFGDIDPKTDTRAD--------- 208

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                                                 TG+H +E  L+           
Sbjct: 209 ------------------------------GLEKGQKWTGWHRLEKALFEDGRIGAEE-- 236

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                                    K ++  L +DL++  +  G        +       
Sbjct: 237 -------------------------KTLATRLDTDLKDWQRRVGRAVITPTSMANGAKDL 271

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L            +E+A  ++           E + +S      +  +V G   +YT   
Sbjct: 272 L------------DEVATGKVTG---------EEERYSHTDLVDFKANVEGAEKAYTL-- 308

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI--ESFDQMISE 369
                       +  +   N+ +L  +++ +F+   K     +   ++    S+D++   
Sbjct: 309 ------------LRPVAKTNDPDLVAQLDTRFAALDKQLDAYRPGKDSYDFTSYDKV--- 353

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIRIA 398
                 K + + +N L      L    + 
Sbjct: 354 -KEAERKKLSDGVNALAEPLSKLAAAVVG 381


>gi|327404754|ref|YP_004345592.1| peptidase M75, Imelysin [Fluviicola taffensis DSM 16823]
 gi|327320262|gb|AEA44754.1| Peptidase M75, Imelysin [Fluviicola taffensis DSM 16823]
          Length = 355

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 42/349 (12%), Positives = 93/349 (26%), Gaps = 72/349 (20%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNK 64
           I  +V            +     ++ N A       Y D       L+S+    +    +
Sbjct: 11  IALLVIAACKKKKDENTDFDKGPIMVNMADNYIIPGYVDLKTKIFDLESSWNDFLADKTQ 70

Query: 65  KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEE 124
             L+ ++  W  A I +Q  + + FG  +          +P D   I+    S   +   
Sbjct: 71  TKLDISKQAWADANISFQHVKGFDFGPAMTANLVLTFGTFPTDTAQINSNVQSGSYDLST 130

Query: 125 NNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDL 184
                A                                       +G+  +++LL+ Q  
Sbjct: 131 TQNLDA---------------------------------------SGFDALDYLLYKQ-- 149

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDL 244
                        D      T         Y+  V   + +++  ++  W  D      +
Sbjct: 150 -------------DALTKFQTISSA---CSYVTNVIAKMKAEITLVVSGW--DTYRATFV 191

Query: 245 MKDINAGLNSIITGMTSLSYNEL--AGERMNLG-----LILHDPEQEIDCFSDNTYASYL 297
               N   +     + +   +       ++        L +  P       S       +
Sbjct: 192 AGTSNESTSPFALLINNFCKDFELCKTTKLGFPIGNHTLGIQQPNYLEARRSGIGRTLLI 251

Query: 298 NDVIGIISSYTGEYIRMNGEKIHGASIHDLISH--NNRNLAQEINDKFS 344
            ++    + + G  +  N    +G    D ++   N  +L+  I  +F 
Sbjct: 252 ENIRASRAIFYGLNLSGN---TNGTGFDDYLNALENKASLSNTIASRFD 297


>gi|331694758|ref|YP_004330997.1| peptidase M75, Imelysin [Pseudonocardia dioxanivorans CB1190]
 gi|326949447|gb|AEA23144.1| Peptidase M75, Imelysin [Pseudonocardia dioxanivorans CB1190]
          Length = 379

 Score =  103 bits (256), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 43/389 (11%), Positives = 102/389 (26%), Gaps = 135/389 (34%)

Query: 10  VFTLPSHAL-SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLE 68
            FT+  +A  S+  N  L +    Y    +            L    +         ++ 
Sbjct: 124 AFTVTGNAQRSVDQNTRLAEATAGYKRYVN-------SQIDALVPKTQEFADAVKAGDVA 176

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
            A+  +  +R  +++ E                   P+ E F D      G+        
Sbjct: 177 KAKALFPVSRTYWERIE-------------------PVAESFSDIDPKVDGR-------- 209

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
                                            +G      TGYH +E  LW   L+ + 
Sbjct: 210 --------------------------------DDGEPGVPFTGYHRLEKDLWESGLQPDS 237

Query: 189 REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDI 248
                                         ++  LV+D++++             L    
Sbjct: 238 A----------------------------AMADALVADMKDLQARVATLELTPVQLANGA 269

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
              L            +E+A  ++           E D +S      +  +V G  ++  
Sbjct: 270 KELL------------DEVATGKITG---------EEDRYSHTDLWDFKANVEGSQAAV- 307

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
                        A++  +I   ++ L  +++++F+         +   +    + ++  
Sbjct: 308 -------------AALRPVIDEKDKALGPQLDERFAAVDALLEQYR-AGDGFTLYTEL-- 351

Query: 369 ENNPEGNKIVRNLINDLITQTESLRKIRI 397
               +  K + + ++ L      +  +  
Sbjct: 352 --TEDDKKKMTDAVDALSEPISQVAAVVT 378


>gi|329120809|ref|ZP_08249469.1| PbrT family lead (Pb2+) uptake porter [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327459681|gb|EGF06022.1| PbrT family lead (Pb2+) uptake porter [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 397

 Score =  103 bits (256), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 52/383 (13%), Positives = 100/383 (26%), Gaps = 129/383 (33%)

Query: 19  SIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
           +      + K+ Q  A      Y      A+ L    E  V       ++ A+  +   R
Sbjct: 143 AQPAQADMNKLAQPLANY--KTYVQ--GEAKQLVEKTEKFVAAVKAGKVDEAKALFADTR 198

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
           + Y++ E                   P+ E F +   +   +E++               
Sbjct: 199 VHYERIE-------------------PIAELFNELDPAIDSREDDYKEKAKD-------- 231

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
                                       +  TG+H IE  LW      +           
Sbjct: 232 ----------------------------DAFTGFHRIEHALWIDGKIDDK---------- 253

Query: 199 FDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITG 258
                            +K  +  L  D++ +             +             G
Sbjct: 254 -----------------VKATADKLDKDVKTLKAEIDVLSFPPGKV------------VG 284

Query: 259 MTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEK 318
             +    E+AG ++           E D +S    + +  ++ G                
Sbjct: 285 GAADLIEEVAGTKITG---------EEDRYSHTDLSDFQANIDGSKKIVDL--------- 326

Query: 319 IHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIV 378
                    I+  N+ L   +++ F          K   +  E +D++    + E  K +
Sbjct: 327 -----FRPAIAEKNQALLDTVDENFKKINDILAKYKK-GDGFEPYDKL----SEEDRKQL 376

Query: 379 RNLINDLITQTESLRKIRIALDL 401
           +  IN L    E L K+R  L L
Sbjct: 377 KAPINTL---AEELGKLRGVLGL 396


>gi|320011110|gb|ADW05960.1| Peptidase M75, Imelysin [Streptomyces flavogriseus ATCC 33331]
          Length = 378

 Score =  103 bits (256), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 45/383 (11%), Positives = 97/383 (25%), Gaps = 133/383 (34%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
             +   +  ++K +  Y T   A+ +  L         ++         ++E A+  +  
Sbjct: 126 GTAAARSPEMDKAVAGYRTYVQAQADGTLPK-------VKVFTDAVAAGDVEAAKKAYAA 178

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           +RI ++++E                   P+ E F D                        
Sbjct: 179 SRIGWERTE-------------------PVAESFGDIDPK-------------------- 199

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
                                +      D    TG+H +E  LW                
Sbjct: 200 -------------------VDVREDGLEDGQEWTGWHRLEKALWQDGKLGAEE------- 233

Query: 197 TDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSII 256
                               K ++  L  DL++  K  G    +   +       L    
Sbjct: 234 --------------------KALAPTLYKDLQDWQKRVGRADISPTSMANGAKELL---- 269

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
                   +E+A  ++           E + +S      +  +V G   SY         
Sbjct: 270 --------DEVATGKVTG---------EEERYSHTDLVDFKANVEGAERSYEL------- 305

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI--ESFDQMISENNPEG 374
                  +  + + N+  L   ++ +F+         +    +    S+D++        
Sbjct: 306 -------LKPIAAKNDAALTASLDKQFAALDALLDRYRADRTSYDFTSYDKV----GKAD 354

Query: 375 NKIVRNLINDLITQTESLRKIRI 397
            K + + +N L      L     
Sbjct: 355 RKELSDAVNALAEPLSKLAAAVT 377


>gi|163761544|ref|ZP_02168616.1| hypothetical protein HPDFL43_21372 [Hoeflea phototrophica DFL-43]
 gi|162281258|gb|EDQ31557.1| hypothetical protein HPDFL43_21372 [Hoeflea phototrophica DFL-43]
          Length = 335

 Score =  103 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 48/343 (13%), Positives = 105/343 (30%), Gaps = 72/343 (20%)

Query: 29  VLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYR 88
           +     +     Y+        L+ A   L   P++  L  AR+ + ++ + + + E +R
Sbjct: 8   LADTLNSYIRPSYDALASGFEALEQATAALCREPSEMALAEARIAFRKSMLTWSRIEWFR 67

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLS 148
            G  +     +++  +P  +                            ++       +  
Sbjct: 68  TGPAMASNRLERILFYPDRKS-----------------------TGLKQVQRALAREEAD 104

Query: 149 IISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGH 208
           ++SPDLL          +    G    EFL++G+              TD          
Sbjct: 105 VVSPDLLA-------GKSVAMQGLGAYEFLVFGKG--------SEALATDQAPF------ 143

Query: 209 CRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKD---------LMKDINAGLNSIITGM 259
              R  +   V+  L + + E+ + W     A            L +D    LN ++  M
Sbjct: 144 ---RCAFADSVASNLFTIVGELQQGWEAGTPAATFFVKPGADNPLFRDDTEALNLVLGTM 200

Query: 260 TSLSYNELAGERMNLGL---ILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
                  +   R+   L       P   +   +  T  S    + G+   +         
Sbjct: 201 IHGLEA-IRDIRIGGFLREPGSDRPRSAVYRRAGLTMDSISAGLQGLEDLFN-------- 251

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
                + I  ++   +R+LA ++  +F  +++    L    E+
Sbjct: 252 ----DSGIEQVLPEQDRDLADQVRFEFDQSIRTAEGLDGPLED 290


>gi|111022738|ref|YP_705710.1| hypothetical protein RHA1_ro05774 [Rhodococcus jostii RHA1]
 gi|110822268|gb|ABG97552.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 379

 Score =  103 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/389 (11%), Positives = 98/389 (25%), Gaps = 132/389 (33%)

Query: 11  FTLPSHALSIVPN-VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
           FT+   ++S       L +    Y                 L    +  V      N+E 
Sbjct: 121 FTVTGDSMSASDESGQLAEAADGYRRYIR-------SQVVALQDTTQQFVDAVKVGNVEQ 173

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           A+  +  +R  Y++ E                   P  E F +                 
Sbjct: 174 AKALFPASRTYYERIE-------------------PEAESFGELDPKL------------ 202

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
                                       L  A+       TG+H +E  LW    + +  
Sbjct: 203 ---------------------------DLREADLEPGQEWTGFHRLEKDLWVTGPQPDTN 235

Query: 190 EPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDIN 249
                                        ++  LV D++ +      +            
Sbjct: 236 ----------------------------AIADQLVVDVQYLADQVNAEDYTIDPTK---- 263

Query: 250 AGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTG 309
                 I G      +E++  ++           E D FS      +  +V         
Sbjct: 264 ------IAGDAQGLLDEISTSKITG---------EEDIFSHTDLWDFQANV--------- 299

Query: 310 EYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISE 369
                +G +   A++  +I   N  L+  I  +F++   +    + + +    +D     
Sbjct: 300 -----DGSQAAVAALQPIIDERNPELSANITQRFADLDAELAQYR-QGDGFVFYD----T 349

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIRIA 398
            N +  + +   I+ L  +   ++ +   
Sbjct: 350 VNEQQRQELSRKIDALSAEVSQVQGVVAG 378


>gi|327192004|gb|EGE58985.1| hypothetical protein RHECNPAF_2530061 [Rhizobium etli CNPAF512]
          Length = 366

 Score =  103 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/351 (13%), Positives = 102/351 (29%), Gaps = 77/351 (21%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +    Y +    A  L +A++ L     ++ L+ A+  +      +   E+ + G  I 
Sbjct: 45  EVIRPGYRNMQQSAARLTTAMKDLCEAGTQQTLDKAKSAFDDTIRYWSIIEIVQTGPVIQ 104

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D   + +  +P  +G                              V  K++   I   D 
Sbjct: 105 DNLFEHILFYPDRKG------------------------------VGLKQVQALIAKADP 134

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
                 A    +    G   +E++L+G   +  V + G                   R  
Sbjct: 135 KDATVDAIAGKSVALQGLTALEYVLYGNGSENLVGQKGGF-----------------RCL 177

Query: 215 YLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI--------ITGMTSLSYNE 266
           Y   V+  +  +  E++ AW                  + +        + G+       
Sbjct: 178 YGAAVAGNIQREAGEVVAAWEKPDGVQASWKHPGPQSNDFMDNKEAVTALLGILVHGAEN 237

Query: 267 LAGERMNLGL----ILHDPEQEIDCFSDNTYASYLNDVIGIISSYT--GEYIRMNGEKIH 320
           +  +R+            P   I   S NT+ S   ++ G+ + +   G    +  +K  
Sbjct: 238 VRDQRLEQFYKGKDNAPRPRMAIYWRSKNTWKSMAANLEGLRTLWQKAGMAELLPPDKRS 297

Query: 321 GA--------SIHDLISHNNRNLA--------QEINDKFSNTMKDFHILKD 355
            A        S+ D +   N ++          +++   + +      + D
Sbjct: 298 IAASIDEDFKSLLDSVPKLNPDIDAATSEAEKAKLDTLLAESRDLITRISD 348


>gi|218680690|ref|ZP_03528587.1| hypothetical protein RetlC8_18209 [Rhizobium etli CIAT 894]
          Length = 366

 Score =  103 bits (255), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 43/351 (12%), Positives = 104/351 (29%), Gaps = 77/351 (21%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +    Y +    +  L +A++ L     +++L+ A+  +      +   E+ + G  I 
Sbjct: 45  EVIRPGYRNMQQSSARLTTAMKDLCADGTQQSLDKAKSAFDDTIRYWSIIEIVQTGPVIQ 104

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D   + +  +P  +G                              V  K++   I   D 
Sbjct: 105 DNLFEHILFYPDRKG------------------------------VGLKQVQALIAKADP 134

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
                 A    +    G   +E++L+G      V++ G                   R  
Sbjct: 135 KDATVDAIAGKSVALQGLTALEYVLYGNGSDDLVKQKGGF-----------------RCL 177

Query: 215 YLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI--------ITGMTSLSYNE 266
           Y + V+  +  +  E++ AW                  + +        + G+       
Sbjct: 178 YGQAVAGNIQREAGEIVAAWEKPDGVQASWKHPGPQSNDFMDNKEAVTALLGILVHGAEN 237

Query: 267 LAGERMNLGLI----LHDPEQEIDCFSDNTYASYLNDVIGIISSYT----GEYIRMNGEK 318
           +  +R+            P   I   S NT+ S   ++ G+ + +      E +  + + 
Sbjct: 238 VRDQRLEQFYKGKDTAPRPRMAIYWRSKNTWKSMAANIDGLRTLWQKAGMAELLPPDKQA 297

Query: 319 IHG------ASIHDLISHNNRNLA--------QEINDKFSNTMKDFHILKD 355
           +         S+ D +   N ++          +++   + +      + D
Sbjct: 298 VAASIDEDFKSLLDSVPKLNPDIDAAVSDAEKAKLDTLLAESRDLITRISD 348


>gi|226365247|ref|YP_002783030.1| hypothetical protein ROP_58380 [Rhodococcus opacus B4]
 gi|226243737|dbj|BAH54085.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 379

 Score =  103 bits (255), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 47/389 (12%), Positives = 97/389 (24%), Gaps = 132/389 (33%)

Query: 11  FTLPSHALSIVPN-VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
           FT+   ++S       L +    Y                 L    +  V      N+E 
Sbjct: 121 FTVTGDSMSASDESGQLAEAADGYRRYIR-------SQVVALQDTTQQFVDAVKSGNIEQ 173

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           A+  +  +R  Y++ E                   P  E F +                 
Sbjct: 174 AKALFPVSRTYYERIE-------------------PEAESFGELDPKL------------ 202

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
                                       L  A+       TG+H +E  LW    + +  
Sbjct: 203 ---------------------------DLREADLEPGQEWTGFHRLEKDLWVTGPQPDTN 235

Query: 190 EPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDIN 249
                                        ++  LV D++ +      +            
Sbjct: 236 ----------------------------AIADQLVVDVQYLADQVNAEDYTIDPTK---- 263

Query: 250 AGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTG 309
                 I G      +E++  ++           E D FS      +  +V         
Sbjct: 264 ------IAGDAQGLLDEISTSKITG---------EEDIFSHTDLWDFQANV--------- 299

Query: 310 EYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISE 369
                +G +   A++  +I   N  LA  I  +F++   +    + + +    +D     
Sbjct: 300 -----DGSQAAVAALQPIIEERNPELAANITQRFADLDAELAQYR-QGDGFVFYD----T 349

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIRIA 398
            N +  + +   I+ L      ++ +   
Sbjct: 350 VNEQQRQELSRKIDALSADVSQVQGVVAG 378


>gi|323356787|ref|YP_004223183.1| periplasmic lipoprotein [Microbacterium testaceum StLB037]
 gi|323273158|dbj|BAJ73303.1| predicted periplasmic lipoprotein [Microbacterium testaceum
           StLB037]
          Length = 409

 Score =  102 bits (254), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 53/386 (13%), Positives = 101/386 (26%), Gaps = 104/386 (26%)

Query: 9   IVFTLPSHALSIV--PNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
             F++   A+++        ++ +  YA                L  A++T        +
Sbjct: 120 ASFSVTGDAVAVEGPDAEQKQQAVDLYAAFVK-------DQVGQLLPAVKTFTAAYESGD 172

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
              A+ Q+ R R  Y++ E                   P+ E   D       +E +   
Sbjct: 173 DAAAKEQFPRVRAYYERIE-------------------PIAEALGDLDPRIDYREVDA-- 211

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
                                                 +    TG+H IE  LW      
Sbjct: 212 ------------------------------------VAEGLDWTGFHRIEKDLWVPAQDA 235

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
              +     + D+              E  K     LVSD++E+      D         
Sbjct: 236 LNADGETPAWKDWTPS---------TPEERKTHGDKLVSDVQELYDYVHGDEFTQAL--- 283

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
               G+  I  G  +L  +E+A  +++          E D +S      +  +V G   +
Sbjct: 284 -DTQGVAGISNGAIAL-LDEVASGKISG---------EEDWWSGTDLYDFAANVEGSKMA 332

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
           ++        +   G             L   I+  +++                 + Q+
Sbjct: 333 FSLVRDFAESKGDKG-----------AELVTRIDKGYADLEAALAAHGSADAGFVPYSQL 381

Query: 367 ISENNPEGNKIVRNLINDLITQTESL 392
                    +   +LIN L      L
Sbjct: 382 ----TEADKRQFTDLINALAEPLSQL 403


>gi|209551880|ref|YP_002283797.1| hypothetical protein Rleg2_4313 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537636|gb|ACI57571.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 366

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 47/381 (12%), Positives = 111/381 (29%), Gaps = 81/381 (21%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +    Y +    A  L +A++ L     ++ L+ A+  +      +   E+ + G  I 
Sbjct: 45  EVIRPGYRNMQQSAARLTTAMKDLCDGGTQQTLDKAKSAFDDTIRYWSIIEIVQTGPVIQ 104

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D   + +  +P  +G                              V  K++   I   D 
Sbjct: 105 DNLFEHILFYPDRKG------------------------------VGLKQVQALIAKADP 134

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
                 A    +    G   +E++L+G      +++ G                   R  
Sbjct: 135 KDATVDAIAGKSVALQGLTALEYVLYGNGSDDLIKQKGGF-----------------RCL 177

Query: 215 YLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI--------ITGMTSLSYNE 266
           Y   V+  +  +  E++ AW                  + +        + G+       
Sbjct: 178 YGAAVAGNIQREAGEVVAAWEKPDGVQASWKHPGPQSNDFMDNKEAVTALLGILVHGAEN 237

Query: 267 LAGERMNLGLI----LHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGA 322
           +  +R+            P   I   S NT+ S   ++ G+ + +              A
Sbjct: 238 VRDQRLEQFYKGKDTAPRPRMAIYWRSKNTWKSMTANIDGLRTLW------------QKA 285

Query: 323 SIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
            + +L+  + + +A  I++ F + +     L    +         +  +      +  L+
Sbjct: 286 GMAELLPPDKQAIAASIDEDFKSLLDSVPKLNPDID---------AAVSDAEKAKLDTLL 336

Query: 383 NDLITQTESL-RKIRIALDLI 402
            +       +  +   A+ L 
Sbjct: 337 AESRDLITRISDEYGAAIGLS 357


>gi|116250088|ref|YP_765926.1| hypothetical protein RL0320 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254736|emb|CAK05810.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 367

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 46/351 (13%), Positives = 104/351 (29%), Gaps = 77/351 (21%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +    Y +    A  L +A++ L +   ++ L+ A+  +      +   E+ + G  I 
Sbjct: 46  EVIRPGYRNMQQSAARLTTAMKDLCSDGTQQTLDKAKSTFDDTIRYWSIIEIVQTGPVIQ 105

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D   + +  +P  +G                              V  K++   I   D 
Sbjct: 106 DNLFEHILFYPDRKG------------------------------VGLKQVQALIAKADP 135

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
                 A    +    G   +E++L+G      V + G+                  R  
Sbjct: 136 NDATVDAIAGKSVALQGLTALEYVLYGNGSDDLVGQKGSF-----------------RCL 178

Query: 215 YLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI--------ITGMTSLSYNE 266
           Y + V+  +  +  E++ AW                  + +        + G+       
Sbjct: 179 YGEAVAGNIQREAGEVVAAWEKPDGVQASWKHPGPQSNDFMDNKEAVTALLGILVHGAEN 238

Query: 267 LAGERMNLGLI----LHDPEQEIDCFSDNTYASYLNDVIGIISSYT--GEYIRMNGEKIH 320
           +  +R+            P   I   S NT+ S   ++ G+ + +   G    +  +K  
Sbjct: 239 VRDQRLEQFYKGKDTAPRPRMAIYWRSKNTWKSMAANLEGLRTLWQKAGMAELLPPDKQS 298

Query: 321 GA--------SIHDLISHNNRNLA--------QEINDKFSNTMKDFHILKD 355
            A        S+ D +   N ++          +++   + +      + D
Sbjct: 299 IAASIDEDFKSLLDSVPKLNPDIDVAISDAEKAKLDTLLAESRDLITRISD 349


>gi|325291720|ref|YP_004277584.1| hypothetical protein AGROH133_03408 [Agrobacterium sp. H13-3]
 gi|325059573|gb|ADY63264.1| hypothetical protein AGROH133_03408 [Agrobacterium sp. H13-3]
          Length = 373

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 52/391 (13%), Positives = 118/391 (30%), Gaps = 83/391 (21%)

Query: 3   FITIISIVFTLPSHALSIV-------PNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSA 54
            I+++ ++   P+ A  +          V +  V++          Y+     A  L+ +
Sbjct: 11  LISVLLLLGMRPAMAQDVELMPPPPLDPVQVRGVMEKAVNGFIRPGYDHFRQSAEKLEGS 70

Query: 55  IETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYV 114
           ++     P+K   E A+  +      +   E+ R G  I     ++V  +P  +G     
Sbjct: 71  MKAFCAAPSKTTDEAAKAAFADTVSSWSTIEIVRVGPVIEHNRFERVLYYPDKKGL---- 126

Query: 115 DSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHV 174
                                       K++   +   D       +    +    G   
Sbjct: 127 --------------------------GLKQVQRYLAEKDESVTSAESLKGKSVAAQGLGA 160

Query: 175 IEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW 234
           +EF+L+G D                  G+        R  Y   ++  + +   E+  +W
Sbjct: 161 LEFVLYGTD-----------------AGDLFDKKGDFRCRYGAAIAGNVANVAAELSDSW 203

Query: 235 ---------GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHD----P 281
                         A   + +D    L +++ G+       +  +R+       D    P
Sbjct: 204 NAPDGAQKNWTQPGADNPVFRDEREALVALL-GILVHGAEAIRDQRIETFYKGPDKAKFP 262

Query: 282 EQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEIND 341
              I   S  T+ S   ++  +               +H A + +L+  + R++   I+ 
Sbjct: 263 RTAIYWRSGLTWKSIAANIKAVQ------------TLLHTADMVELVPPDQRSIVNSIDF 310

Query: 342 KFSNTMKDFH-ILKDRAENIESFDQMISENN 371
             + +M      +    E     DQ  ++ +
Sbjct: 311 -IAKSMIRIAGTIDTNVEKALDDDQQRAKVD 340


>gi|332881676|ref|ZP_08449324.1| hypothetical protein HMPREF9074_05114 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332680315|gb|EGJ53264.1| hypothetical protein HMPREF9074_05114 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 410

 Score =  102 bits (254), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/183 (19%), Positives = 64/183 (34%), Gaps = 30/183 (16%)

Query: 10  VFTLPSHALSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLE 68
                ++    + +  ++ V+  +   +    Y+D       L +A+E    TP+    E
Sbjct: 257 AAIQNAYNNGTITDAEMDLVVSGFVNNVVLPTYKDLKEKNTALLAAVEDFYNTPSDDTFE 316

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
            A   W+ AR+P++QSE + FG   +   D  +++WPLD+  I                 
Sbjct: 317 AACEAWLVARMPWEQSEAFLFGPVDILGLDPNMDSWPLDQVAI----------------- 359

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
             NI+ +        E                     +    G+H +EFLL+       V
Sbjct: 360 -VNILNSGNFDDLNWE-----------DGDSEDEITASQEVRGFHTLEFLLFKNGNPRTV 407

Query: 189 REP 191
              
Sbjct: 408 SAQ 410



 Score = 80.7 bits (197), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/213 (12%), Positives = 59/213 (27%), Gaps = 33/213 (15%)

Query: 199 FDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKD----------- 247
               +    +      Y + V+ +L  D   +  +W    Q  +   K            
Sbjct: 57  AANLDYNTENAASWRNYSRQVAILLKKDATTLYDSWETSFQGGEAFKKTFTEHNGGTYTS 116

Query: 248 INAGLNSIITGMTSLSYNELAGERMNLGLI-------LHDPEQEIDCFSDNTYASYLNDV 300
             + +  II        +E+   ++                      +S ++   Y N++
Sbjct: 117 ALSCIEQIIDKCVE-ITDEVGNSKIGDPYDKWTAGQQTEALYAVESWYSFHSRDDYSNNI 175

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
             I +     Y       I   S++ L+   +  L  +I ++  +T      +     N 
Sbjct: 176 RSIRN----SYFNSLDSTISNNSLYKLVEKIDPALNTKIANEIESTKNAILAIPQPFRNN 231

Query: 361 ESFDQMISEN----------NPEGNKIVRNLIN 383
               Q+              + E    ++N  N
Sbjct: 232 IGDAQVPVAQSACVALGVTLDQELKAAIQNAYN 264


>gi|261379657|ref|ZP_05984230.1| protein YcdO [Neisseria subflava NJ9703]
 gi|284798142|gb|EFC53489.1| protein YcdO [Neisseria subflava NJ9703]
          Length = 388

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 56/381 (14%), Positives = 106/381 (27%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLAQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFAATRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE  LW                    
Sbjct: 227 -----------------------------TGFHRIEHALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVEGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   ++ L ++ +  F          K      E +D++    + E  K ++ 
Sbjct: 318 ---FRPLIEAKDKALLEKTDANFKQVEDILAKYKTP-NGFELYDKL----SEEDRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L K+R  L L
Sbjct: 370 PINAL---AEDLAKLRGILGL 387


>gi|88860483|ref|ZP_01135121.1| predicted periplasmic lipoprotein [Pseudoalteromonas tunicata D2]
 gi|88817681|gb|EAR27498.1| predicted periplasmic lipoprotein [Pseudoalteromonas tunicata D2]
          Length = 424

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 49/426 (11%), Positives = 123/426 (28%), Gaps = 87/426 (20%)

Query: 22  PNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVT--------TPNKKNLE---- 68
                + +L+N    +    + +  +   +    I T             ++   +    
Sbjct: 47  TTFDEKALLKNLVDNVITPTFVEFSVQTSSAVEKITTYCALEQQLTDFQTSQNQRDTAYI 106

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWDKK--VNAWPLDEGFIDYVDSSYGKENEENN 126
           +A   W    + +QQ+E+ + G  + +    +  + AWP     I  +D       +   
Sbjct: 107 DATNAWKSMAVVWQQAELMKLGPLLENEGQLRNVIYAWPSKS--ICGIDQDVAYFEDG-- 162

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
               N+ AN    + ++  +                        G   +E LL+  +L  
Sbjct: 163 --VINLDANKPYNIKDRTANR----------------------RGLVSLEHLLFSDNLAH 198

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRR---RVEYLKVVSKILVSDLEEMMKAWGPDGQATKD 243
           +          D            R   R ++   V+K L  + ++++  W  +      
Sbjct: 199 SCSLAN-----DAIADWNVRPEQERKVARCQFAVEVAKDLDDNAKQLVTVWTAENGYANA 253

Query: 244 LMKDINAG--------LNSIITGMTSLSYNELAGERMNLGLILHD--------PEQEIDC 287
           L      G          + I+        E+  +++   L L          P+     
Sbjct: 254 LKTAGEEGSIFTSPHAAVNAISDALFYLTEEVKDQKLATPLGLFTNSCGLDICPQDVESV 313

Query: 288 FSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNN-RNLAQEINDKFSNT 346
            ++++  +   ++      + G+         +G    D +   N  ++ Q + D  +  
Sbjct: 314 IANHSLENIKANLAAFEKLFLGQGN------ENGLGFDDFLDEENGSDIKQLMLDGLAEA 367

Query: 347 MKDFHILKDRAEN--IESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEP 404
                 ++   +    +  D++   +           +  +  Q +        L L  P
Sbjct: 368 NLAADAIEGDLQTALQQETDKVTDTHTK---------VKAVTDQLK--HDFINKLALELP 416

Query: 405 NRVIGN 410
               G+
Sbjct: 417 KSSAGD 422


>gi|269961717|ref|ZP_06176078.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269833582|gb|EEZ87680.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 345

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 44/405 (10%), Positives = 118/405 (29%), Gaps = 83/405 (20%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
               +S+V    +   S     S   + Q+   +     +  L     L+        + 
Sbjct: 10  IAATLSLVGCQSTVGSSSAKPESTSHISQSVYEVEFQSAQTFLAQTTELEQRFADYCASE 69

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
           +K +    + QW +  + +   +    G          V  WP  +              
Sbjct: 70  SKDD-APIKQQWHQTMLAWMALQGQERGPATALEQSWNVQFWPDKK-------------- 114

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                             N     +S+++              +    G   +E+LL+ +
Sbjct: 115 ------------------NTTGRKMSVLTKSDQAWSAEDISTQSVTVQGLGALEWLLYDK 156

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
                                 T             +++ L +  + +  +W  +   + 
Sbjct: 157 AS--------------------TLSSNSNTCATSVSIAENLDNKAQIIADSWAENPWKSL 196

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGL---ILHDPEQEIDCFSDNTYASYLND 299
           ++ +  +  ++ +   +      E + ++++  L       P       S+ + ++   +
Sbjct: 197 EMTEWESEYISLLSNQL------EYSMKKLSRPLAKIGKPRPYFSESWRSETSLSNLKAN 250

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHN-NRNLAQEINDKFSNTMKDFHILKDRAE 358
           + G+ + Y            +G  +  L+    + +LA  +  +F         L+   E
Sbjct: 251 LQGMEALYFA----------NGNGLDALLREQGHADLADRVVHQFEMA------LETWPE 294

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI 402
           +   F  + +    EG ++V    N L      +  ++ I L ++
Sbjct: 295 DKSLFAALQA---KEGYRMVLAQYNKLEQLKYLIHEEVAIELGVV 336


>gi|323492411|ref|ZP_08097559.1| iron-regulated protein A precursor [Vibrio brasiliensis LMG 20546]
 gi|323313198|gb|EGA66314.1| iron-regulated protein A precursor [Vibrio brasiliensis LMG 20546]
          Length = 343

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 50/419 (11%), Positives = 125/419 (29%), Gaps = 90/419 (21%)

Query: 2   YFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHA----KYEDALMCARTLDSAIET 57
             +   ++  +L     S   +V+  +  ++++   +       +     A  L + IE 
Sbjct: 5   KLVLASAMAISLLGC-QSTGNDVAKPEQTRHFSQGVYQVEFMSAQAFKTQADNLTTVIEN 63

Query: 58  LVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSS 117
              + +  NL+  + QW +  + +   +    G +        V  WP  +         
Sbjct: 64  YCQSTS--NLDAVKSQWNQTMLSWMALQGQERGPEAALAQSWNVQFWPDKK--------- 112

Query: 118 YGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEF 177
                                  N     +S +         +A  + +    G   +E+
Sbjct: 113 -----------------------NTTGRKMSSLIKQPQAWSQQAIALQSVTVQGLGSVEW 149

Query: 178 LLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD 237
           LL+              P +D      T        +    + + L  +  ++  AW  +
Sbjct: 150 LLFD-------------PASDLTGNPQT-------CQTATAIGENLAVNAGKIADAWAKN 189

Query: 238 GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGL---ILHDPEQEIDCFSDNTYA 294
                   +  +  +  +   +      E + ++M   L       P       S+ +  
Sbjct: 190 PWVELTEQQWESEYIALLSNQL------EYSMKKMTRPLANFGKPRPYFSESWRSETSMQ 243

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNN-RNLAQEINDKFSNTMKDFHIL 353
           +   +++ +   Y  +          G  +  ++   +   LA  I ++F+ T      +
Sbjct: 244 NLYANIVAMEKLYFAQ----------GKGLDAILRDADKAALADRIANQFAMT------I 287

Query: 354 KDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALD-LIEPNRVIGN 410
           +   +    FD +      +G +   +  N L      +  ++ I L  +I  N   G+
Sbjct: 288 ETWPKGASLFDML---QTKQGYRNAYSQYNKLEQLKYLIHEEVAIELGVIIGFNATDGD 343


>gi|226307773|ref|YP_002767733.1| hypothetical protein RER_42860 [Rhodococcus erythropolis PR4]
 gi|226186890|dbj|BAH34994.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
          Length = 376

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/389 (11%), Positives = 97/389 (24%), Gaps = 132/389 (33%)

Query: 11  FTLPSHALSIVPN-VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
           F +   + +       L +    Y                 L       V      N++ 
Sbjct: 118 FVVTGDSQAATDESGQLAEAADGYRRYIR-------SQIVALQDTAAQFVAAVQSGNVDQ 170

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           A+  +  AR  Y++ E                   P  E F +                 
Sbjct: 171 AKALFPIARTYYERIE-------------------PEAESFGELDPKL------------ 199

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
                                       L  A+     + TG+H +E  LW   L+ +  
Sbjct: 200 ---------------------------DLREADLEPGQVWTGFHRLEKDLWVTGLQPDTN 232

Query: 190 EPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDIN 249
                                        V+  L+ D++ +      +            
Sbjct: 233 ----------------------------AVADQLLEDIQYLADQVNAEDYTIDPTK---- 260

Query: 250 AGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTG 309
                 I G      +E++  ++           E D FS      +  +V         
Sbjct: 261 ------IAGDAQGLLDEISTSKITG---------EEDIFSHTDLWDFQANV--------- 296

Query: 310 EYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISE 369
                +G +   A+++ ++   N  LAQ I D+F++        +   +    +D     
Sbjct: 297 -----DGSQAAIAALNPILQERNPELAQRIADRFADLDAALAQFRV-GDGFVYYD----T 346

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIRIA 398
                 + +   I+ L  +   ++++   
Sbjct: 347 VTEAQRQELSRKIDALSAEVSQVQEVVAG 375


>gi|307327863|ref|ZP_07607046.1| Peptidase M75, Imelysin [Streptomyces violaceusniger Tu 4113]
 gi|306886575|gb|EFN17578.1| Peptidase M75, Imelysin [Streptomyces violaceusniger Tu 4113]
          Length = 377

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 49/388 (12%), Positives = 101/388 (26%), Gaps = 132/388 (34%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
            +          +  L+K +  Y      + ++ L  A+              K +LE A
Sbjct: 121 VSATGKGAVAKRDPRLDKAVAAYRAYVQQQADETLPVAQK-------FADAVKKDDLEGA 173

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           +  +  +R+ ++++E                   P+ E F D                  
Sbjct: 174 KKLYAPSRVGWERTE-------------------PVAESFGDIDPK-------------- 200

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
                                      +           TG+H +E  LW          
Sbjct: 201 -------------------------VDVREDGLEKGQKWTGWHRLEKSLW---------- 225

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
                         T             ++  L+ DL++  K  G        +      
Sbjct: 226 ---------QTKKITAADHD--------LADQLIKDLKDWQKRVGTADITPTGMANGAKE 268

Query: 251 GLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGE 310
            L            +E+   ++           E + +S      +  +V G  +SY   
Sbjct: 269 LL------------DEVQTGKVTG---------EEERYSHTDLLDFEGNVEGAETSYKL- 306

Query: 311 YIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISEN 370
                        +  + S N+  LA+E++ +F+  +K     ++  E   S+D      
Sbjct: 307 -------------LKPVASTNDPELAKELDKQFAAVVKLLDKYRE-GEGFVSYD----TV 348

Query: 371 NPEGNKIVRNLINDLITQTESLRKIRIA 398
                K + + +N L      L    + 
Sbjct: 349 TETQRKELSDAVNALAEPLSRLAAAVVT 376


>gi|328882003|emb|CCA55242.1| Ferrous iron transport periplasmic protein EfeO,contains
           peptidase-M75 domain and (frequently) cupredoxin domain
           [Streptomyces venezuelae ATCC 10712]
          Length = 384

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/386 (11%), Positives = 94/386 (24%), Gaps = 129/386 (33%)

Query: 13  LPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARL 72
               A     +  ++  +  Y     A        A      ++         ++E A+ 
Sbjct: 124 ATGGAAGAKRSPEMDAAVAAYRQYVQA-------QADATLPKVKVFTDAVRAGDVEAAKK 176

Query: 73  QWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANI 132
            +  +RI ++++E                   P+ E F D       +E+          
Sbjct: 177 AYAASRIGWERTE-------------------PVAESFGDIDPKVDVREDGL-------- 209

Query: 133 IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
                                       A        TG+H +E  LW      +     
Sbjct: 210 ---------------------------EAGQDPAKDWTGWHRLEKALWQDKKIGDRE--- 239

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGL 252
                                   K ++  L  DL +  K  G        +       L
Sbjct: 240 ------------------------KQLADTLDKDLADWAKRVGKAEITPTSMANGAKELL 275

Query: 253 NSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYI 312
                       +E+A  ++           E + +S      +  +V G   S+     
Sbjct: 276 ------------DEVATGKVTG---------EEERYSRTDLVDFKANVEGAQKSFDL--- 311

Query: 313 RMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL--KDRAENIESFDQMISEN 370
                      +  + + N+  L  E++ +F+                +  S+D++    
Sbjct: 312 -----------LKPVATKNDPKLVAELDKQFAALNTLLDKYRADKTGYDFTSYDKV---- 356

Query: 371 NPEGNKIVRNLINDLITQTESLRKIR 396
                K + + +N L      L    
Sbjct: 357 GKPERKELSDGVNALAEPLSKLAAAV 382


>gi|94501567|ref|ZP_01308084.1| predicted periplasmic lipoprotein [Oceanobacter sp. RED65]
 gi|94426250|gb|EAT11241.1| predicted periplasmic lipoprotein [Oceanobacter sp. RED65]
          Length = 402

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 53/360 (14%), Positives = 114/360 (31%), Gaps = 65/360 (18%)

Query: 34  ATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGN-K 92
           A        +       LD+A++        K L  A+  W  A +P Q+ +   FG   
Sbjct: 50  AEGVQPLATEFKTELLELDTAVDAYCDASGTKEL--AQTAWSNAMVPLQKMQAMNFGPNA 107

Query: 93  IVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISP 152
             D        W     F + V+      N   N    + I N K ++            
Sbjct: 108 DADNGLLSFYDW----QFANAVNIDAAIANNAENASGLSGINNRKDLI------------ 151

Query: 153 DLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN---VREPGNRPYTDFD-IGNCTGGH 208
                                 +E++L+  D            N+   D    G  T   
Sbjct: 152 ---------------------AVEYVLFTDDGTYTYELATGDENKTVVDTWVEGESTAKL 190

Query: 209 CRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELA 268
              R +Y +++++ L +    +  AW  +      +     A  N +  G    +  ++ 
Sbjct: 191 QADRCDYAQLITEDLKTRAVTLESAW--NSYDLASVANSKQAAANEVTQGF-FYADKQIK 247

Query: 269 GERMNLGL-----ILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGAS 323
             ++   L      + D  +    F+  +    +N++ G+   +T           +G  
Sbjct: 248 DAKVGGALPIKDDNVFDATKLESQFAKTSKEHLINNLHGLKHIFTAG---------NGVG 298

Query: 324 IHDLISHNNRN-LAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLI 382
           I D +       L+ E+ +   N + +   +   + ++    ++I   +PE  ++ +N +
Sbjct: 299 IDDYLVEVGEESLSNEMINNIDNAIANLEYIDTSSTSLF---EIIDSASPEQEELCKNAV 355


>gi|229494988|ref|ZP_04388737.1| lipoprotein [Rhodococcus erythropolis SK121]
 gi|229318082|gb|EEN83954.1| lipoprotein [Rhodococcus erythropolis SK121]
          Length = 376

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/389 (11%), Positives = 97/389 (24%), Gaps = 132/389 (33%)

Query: 11  FTLPSHALSIVPN-VSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
           F +   + +       L +    Y                 L       V      N++ 
Sbjct: 118 FVVTGDSQAATDESGQLAEAADGYRRYIR-------SQIVALQDTAAQFVAAVQSGNVDQ 170

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           A+  +  AR  Y++ E                   P  E F +                 
Sbjct: 171 AKALFPIARTYYERIE-------------------PEAESFGELDPKL------------ 199

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
                                       L  A+     + TG+H +E  LW   L+ +  
Sbjct: 200 ---------------------------DLREADLEPGQVWTGFHRLEKDLWVTGLQPDTN 232

Query: 190 EPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDIN 249
                                        V+  L+ D++ +      +            
Sbjct: 233 ----------------------------AVADQLLEDIQYLADQLNAEDYTIDPTK---- 260

Query: 250 AGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTG 309
                 I G      +E++  ++           E D FS      +  +V         
Sbjct: 261 ------IAGDAQGLLDEISTSKITG---------EEDIFSHTDLWDFQANV--------- 296

Query: 310 EYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISE 369
                +G +   A+++ ++   N  LAQ I D+F++        +   +    +D     
Sbjct: 297 -----DGSQAAIAALNPILQERNPELAQRIADRFADLDAALAQFRV-GDGFVYYD----T 346

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIRIA 398
                 + +   I+ L  +   ++++   
Sbjct: 347 VTEAQRQELSRKIDALSAEVSQVQEVVAG 375


>gi|256378328|ref|YP_003101988.1| hypothetical protein Amir_4288 [Actinosynnema mirum DSM 43827]
 gi|255922631|gb|ACU38142.1| conserved hypothetical protein [Actinosynnema mirum DSM 43827]
          Length = 373

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/383 (12%), Positives = 102/383 (26%), Gaps = 127/383 (33%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALM-CARTLDSAIETLVTTPNKKNLENARLQW 74
            A  +  + + +         A A Y+  +   A +L +              E+A+  +
Sbjct: 115 SAFVVKGDATRQADADTRLGEATAGYQRYVNSQADSLLAKTTEFTAAVKDGEAEDAKALY 174

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
             AR  +++ E                   P+ E F D      G               
Sbjct: 175 PVARTYWERIE-------------------PVAESFGDLDPKIDG--------------- 200

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNR 194
                                     A+  +    TG+H +E  LW   L+ +       
Sbjct: 201 ------------------------READLEEGQEFTGFHRLEKDLWTGGLQGDSA----- 231

Query: 195 PYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNS 254
                                   ++  L++D+ E++        A   L       L  
Sbjct: 232 -----------------------AIADRLLADVTEIVGKAKTVELAPLQLANGAKELL-- 266

Query: 255 IITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRM 314
                     +E+A  ++           E D FS      +  +V G  ++        
Sbjct: 267 ----------DEVATGKITG---------EEDVFSHTDLWDFAANVEGSRAAV------- 300

Query: 315 NGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEG 374
                  A++  ++   +  LA  ++ KF+   +     +D  +  + +  +      E 
Sbjct: 301 -------AALRPVVRERDAELASTVDAKFAAVEELLGAQRD-GDGYKLYTDL----TQEQ 348

Query: 375 NKIVRNLINDLITQTESLRKIRI 397
            K     ++ L      + ++  
Sbjct: 349 VKAFAAAVDALGEPVSKVAEVVA 371


>gi|154493920|ref|ZP_02033240.1| hypothetical protein PARMER_03264 [Parabacteroides merdae ATCC
           43184]
 gi|154086180|gb|EDN85225.1| hypothetical protein PARMER_03264 [Parabacteroides merdae ATCC
           43184]
          Length = 421

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/171 (19%), Positives = 61/171 (35%), Gaps = 28/171 (16%)

Query: 23  NVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPY 81
           +  L+ + + +   +    Y+D     + L  A+      P+  N E A   WI AR P+
Sbjct: 278 DDDLDAIAEQFVDAVVLPTYKDLQEKNKLLLDAVNQFRQNPSNDNFEKACNLWITAREPW 337

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
           ++SE +  G       D  +++WPLD+  I  V +S   ++ E          +      
Sbjct: 338 EKSEAFLIGPVANLGLDPNMDSWPLDQNGIVQVLNSQNWDDLEW---------SGNFDEE 388

Query: 142 EKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           ++ I                         GYH +E+LL+       V    
Sbjct: 389 DEAI------------------GAAQSVRGYHTLEYLLFKDGQPRTVDGAK 421



 Score = 80.7 bits (197), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 35/250 (14%), Positives = 75/250 (30%), Gaps = 46/250 (18%)

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD----- 237
           D      + G +   D    + +  +      Y+  V+ +L  D   +  +W  D     
Sbjct: 25  DNNDPNPDGGGK---DPVNLDYSSENASAWGNYMYNVAMLLNDDATMLYNSWVTDYVDEQ 81

Query: 238 ----------GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQ---- 283
                        T    +   + +  +I        NE+   ++      +        
Sbjct: 82  GSHGPYATIFKDQTAGAYQSPLSCIEEMIESGMWNIANEVGDAKIKDPYTKYTSGDKEGG 141

Query: 284 ---EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG------------------- 321
                  +S ++   Y N++  I ++Y G     +  K+ G                   
Sbjct: 142 LYAVESWYSWHSRDDYTNNIFSIRNTYYGRIDDNDVSKVDGNLSAFNSYKDFDDEGDIAE 201

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNP--EGNKIVR 379
            S+  LI+  N  L +EI      + K    +     N    ++ ++  N   E   ++ 
Sbjct: 202 HSLSKLIASTNPALDEEIKTLIFASAKAIQAIPQPFRNNIDSEESVAAMNTCMELANLLL 261

Query: 380 NLINDLITQT 389
           N +   + QT
Sbjct: 262 NEVKPYVNQT 271


>gi|90423463|ref|YP_531833.1| hypothetical protein RPC_1957 [Rhodopseudomonas palustris BisB18]
 gi|90105477|gb|ABD87514.1| protein of unknown function DUF451 [Rhodopseudomonas palustris
           BisB18]
          Length = 275

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 53/401 (13%), Positives = 106/401 (26%), Gaps = 132/401 (32%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +  I I S+     +HA + +    L   +  Y                 L S  +    
Sbjct: 6   LPLIMIASVAVATLAHAATKIAPGELVTPISEYKIWV-------GEEVEALVSTSKAFTD 58

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
                +L  A+  +  AR+ Y++ E                   P+ E F D   +   +
Sbjct: 59  AVRAGDLAKAQALYAPARVHYERIE-------------------PIAELFSDLDKAIDVR 99

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
            ++                                              TG+H IE+ L+
Sbjct: 100 ADDFAKKEADPKF------------------------------------TGFHRIEYGLF 123

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
                                        ++ V+ L  ++  L +D++E+          
Sbjct: 124 ----------------------------AKKSVDGLAPLADKLDADIKELQSRIKGLTVP 155

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
            + +             G  ++   E+A  +++          E D +S      + ++V
Sbjct: 156 PEKV------------VGGAAVLLEEVAKTKISG---------EEDRYSRTDLWDFNSNV 194

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
            G    +                +  L    N  L   I+  F                 
Sbjct: 195 EGAKKIHDL--------------LRPLTEKANPKLVTRIDANFVKVETVLAKYAVPGGGY 240

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
           +S+D++      +    VR  +  L    E L ++R  L L
Sbjct: 241 KSYDEL----TKKDRNTVRGPVTAL---AEDLSRLRGELGL 274


>gi|218258041|ref|ZP_03474474.1| hypothetical protein PRABACTJOHN_00127 [Parabacteroides johnsonii
           DSM 18315]
 gi|218225805|gb|EEC98455.1| hypothetical protein PRABACTJOHN_00127 [Parabacteroides johnsonii
           DSM 18315]
          Length = 421

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/171 (19%), Positives = 61/171 (35%), Gaps = 28/171 (16%)

Query: 23  NVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPY 81
           +  L+ + + +   +    Y+D     + L  A+      P+  N E A   WI AR P+
Sbjct: 278 DDDLDAIAEQFVDAVVLPTYKDLQEKNKLLLDAVNQFRQNPSNDNFEKACNLWITAREPW 337

Query: 82  QQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVN 141
           ++SE +  G       D  +++WPLD+  I  V +S   ++ E          +      
Sbjct: 338 EKSEAFLIGPVANLGLDPNMDSWPLDQNGIVQVLNSQNWDDLEW---------SGNFDEE 388

Query: 142 EKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG 192
           ++ I                         GYH +E+LL+       V    
Sbjct: 389 DEAI------------------GAAQSVRGYHTLEYLLFKDGQPRTVDGAK 421



 Score = 80.7 bits (197), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/251 (13%), Positives = 76/251 (30%), Gaps = 47/251 (18%)

Query: 182 QDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPD---- 237
            +        G  P +     + +  +      Y+  V+ +L +D   +  +W  D    
Sbjct: 25  DNDDPTPDGGGKDPVS----LDYSSENAVAWGNYMYNVAMLLNNDATTLYNSWVTDYVDE 80

Query: 238 -----------GQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQ--- 283
                         T    +   + +  +I        NE+   ++      +       
Sbjct: 81  QGSHGPYATIFKDQTAGAYQSPLSCIEEMIESGMWNIANEVGDAKIKDPYTKYTSGDKEG 140

Query: 284 ----EIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG------------------ 321
                   +S ++   Y N++  I ++Y G     +  K+ G                  
Sbjct: 141 GLYAVESWYSWHSRDDYTNNIFSIRNTYYGRIDDNDVSKVDGNLSAFNSYKDFDDEGDIA 200

Query: 322 -ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNP--EGNKIV 378
             S+  LI+  N +L +EI      + K    +     N    ++ ++  N   E   ++
Sbjct: 201 EHSLSKLIASTNPDLDEEIKTLIFASAKAIQAIPQPFRNNIDSEEAVAAMNTCMELANLL 260

Query: 379 RNLINDLITQT 389
            N +   + QT
Sbjct: 261 LNEVKPYVNQT 271


>gi|116331854|ref|YP_801572.1| hypothetical protein LBJ_2346 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116125543|gb|ABJ76814.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 404

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/354 (12%), Positives = 102/354 (28%), Gaps = 61/354 (17%)

Query: 18  LSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           +++  N S  + L   A  +A  +    L     L ++  +     N   L + + +W+ 
Sbjct: 50  VALFANASTGEFLNYTANRVAVPQLARLLTATDELKTSAASYQANQNAATLTDLQTKWLA 109

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR  ++QSE +                         Y++ SY   N  + L     I   
Sbjct: 110 ARRIFKQSETF-------------------------YINRSYLPSNFFHKLD--GYILGE 142

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
                  +++L+  +      +            G+  +E+ ++                
Sbjct: 143 NNRPTANDLNLAAATNPNTSTVDSY----PLTRKGFAALEYFIFDDGNG----------- 187

Query: 197 TDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSII 256
           T              R  Y+  ++ ++  D + ++ +W        + +         I 
Sbjct: 188 THTVAAINAANANAGRRTYIVSLANVIQLDAQRLLGSWNSSSGNFAEELASGKGSFGGIK 247

Query: 257 TGMTSLSYNEL------AGERMNLGLI------LHDPEQEIDCFSDNTYASYLNDVIGII 304
             + S     +         R+ +            P +    +SD  Y   L+ + G+ 
Sbjct: 248 DAIDSFINGLVQLEYTNQDIRVGVPAGLTVAGTTQYPTKLESIYSDTAYQDLLSSIEGLE 307

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH-ILKDRA 357
             Y G       +     S+  L+   N  L   +  K +         +   A
Sbjct: 308 LVYYGNPGDNEAK-----SLSYLVQFQNSALDARVKTKIAALKSLIQERINASA 356


>gi|160891081|ref|ZP_02072084.1| hypothetical protein BACUNI_03528 [Bacteroides uniformis ATCC 8492]
 gi|317480991|ref|ZP_07940071.1| iron-regulated protein A [Bacteroides sp. 4_1_36]
 gi|156859302|gb|EDO52733.1| hypothetical protein BACUNI_03528 [Bacteroides uniformis ATCC 8492]
 gi|316902884|gb|EFV24758.1| iron-regulated protein A [Bacteroides sp. 4_1_36]
          Length = 383

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 62/173 (35%), Gaps = 30/173 (17%)

Query: 16  HALSIVPNVSLEKVLQNYATIA-HAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
              +I  N +L+ +++NY  +     Y+D      TL  A+  L   P+    E A   W
Sbjct: 238 DNSTINSNEALDPIVENYVNVVVLPTYKDLKEKNSTLYDAVVALANNPSNSAFETACNAW 297

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           I AR P+++SE + FG       D  +++WPLD+  I  + +S    +            
Sbjct: 298 ITAREPWEESEAFLFGPVDELGLDPNMDSWPLDQNAIVQILNSQKWGDL----------- 346

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
                             +       A         G+H +EFLL+       
Sbjct: 347 ------------------EWSEGDDDAKVESAQNVRGFHTLEFLLFKDGKPRT 381



 Score = 76.1 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/217 (11%), Positives = 66/217 (30%), Gaps = 24/217 (11%)

Query: 172 YHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMM 231
           ++    +L      T   +  +    +         +      Y++ V+ +L +D   + 
Sbjct: 6   FYAAALVLGLAFTATACSDDDDNSTVNPADIEYNSENAASWHNYMRNVAALLKADATNLY 65

Query: 232 KAWGPDGQATKDLM------------KDINAGLNSIITGMTSLSYNELAGERMNLGLILH 279
            +W    +                        +  +I G   +S NE+   ++      +
Sbjct: 66  DSWNTSYKGGASFATSFKAHNGAYNFSSAWNCIEQVIDGCVEIS-NEVGETKIGDPYNKY 124

Query: 280 DPEQE-------IDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNN 332
                          +S ++   Y N++  I ++Y G        K+   SI  L++  N
Sbjct: 125 MANNVTEALYAVESWYSWHSRDDYTNNIYSIRNAYYGSLDG----KVSDKSISKLVAGVN 180

Query: 333 RNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISE 369
             L  +++   +        +     N  +  + ++ 
Sbjct: 181 AELDMKVSAAITTAASAIQAIPQPFRNNINSQETVAA 217


>gi|218512605|ref|ZP_03509445.1| hypothetical protein Retl8_02396 [Rhizobium etli 8C-3]
          Length = 333

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 46/351 (13%), Positives = 102/351 (29%), Gaps = 77/351 (21%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
            +    Y +    A  L +A++ L     ++ L+ A+  +      +   E+ + G  I 
Sbjct: 12  EVIRPGYRNMQQSAARLTTAMKDLCDGGTQQTLDKAKSAFDDTIRYWSIIEIVQTGPVIQ 71

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
           D   + +  +P  +G                              V  K++   I   D 
Sbjct: 72  DNLFEHILFYPDRKG------------------------------VGLKQVQALIAKADP 101

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
                 A    +    G   +E++L+G   +  V + G                   R  
Sbjct: 102 KDATVDAIAGKSVALQGLTALEYVLYGNGSENLVGQKGGF-----------------RCL 144

Query: 215 YLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI--------ITGMTSLSYNE 266
           Y   V+  +  +  E++ AW                  + +        + G+       
Sbjct: 145 YGAAVAGNIQREAGEVVAAWEKPDGVQASWKHPGPQSNDFMDNKEAVTALLGILVHGAEN 204

Query: 267 LAGERMNLGL----ILHDPEQEIDCFSDNTYASYLNDVIGIISSYT--GEYIRMNGEKIH 320
           +  +R+            P   I   S NT+ S   ++ G+ + +   G    +  +K  
Sbjct: 205 VRDQRLEQFYKGKDNAPRPRMAIYWRSRNTWKSMAANLEGLRTLWQKAGMAELLPPDKRS 264

Query: 321 GA--------SIHDLISHNNRNLA--------QEINDKFSNTMKDFHILKD 355
            A        S+ D +   N ++          +++   + +      + D
Sbjct: 265 IAASIDEDFKSLLDSVPKLNPDIDAATSDAEKAKLDTLLAESRDLITRISD 315


>gi|270294384|ref|ZP_06200586.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270275851|gb|EFA21711.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 383

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 62/173 (35%), Gaps = 30/173 (17%)

Query: 16  HALSIVPNVSLEKVLQNYATIA-HAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
              +I  N +L+ +++NY  +     Y+D      TL  A+  L   P+    E A   W
Sbjct: 238 DNSTINSNEALDPIVENYVNVVVLPTYKDLKEKNSTLYDAVVALANNPSNSAFETACNAW 297

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           I AR P+++SE + FG       D  +++WPLD+  I  + +S    +            
Sbjct: 298 ITAREPWEESEAFLFGPVDELGLDPNMDSWPLDQNAIVQILNSQKWGDL----------- 346

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
                             +       A         G+H +EFLL+       
Sbjct: 347 ------------------EWSEGDDDAKVESAQNVRGFHTLEFLLFKDGKPRT 381



 Score = 76.1 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/217 (11%), Positives = 65/217 (29%), Gaps = 24/217 (11%)

Query: 172 YHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMM 231
           ++     L      T   +  +    +         +      Y++ V+ +L +D   + 
Sbjct: 6   FYATALALGLAFTATACSDDDDNSTVNPADIEYNSENAASWHNYMRNVAALLKTDATNLY 65

Query: 232 KAWGPDGQATKDLM------------KDINAGLNSIITGMTSLSYNELAGERMNLGLILH 279
            +W    +                        +  +I G   +S NE+   ++      +
Sbjct: 66  DSWNTSYKGGASFATSFKAHNGAYNFSSAWNCIEQVIDGCVEIS-NEVGETKIGDPYNKY 124

Query: 280 DPEQE-------IDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNN 332
                          +S ++   Y N++  I ++Y G        K+   SI  L++  N
Sbjct: 125 MANNVTEALYAVESWYSWHSRDDYTNNIYSIRNAYYGSLDG----KVSDKSISKLVAGVN 180

Query: 333 RNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISE 369
             L  +++   +        +     N  +  + ++ 
Sbjct: 181 AELDTKVSAAITTAASAIQAIPQPFRNNINSQETVAA 217


>gi|116327533|ref|YP_797253.1| hypothetical protein LBL_0762 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116120277|gb|ABJ78320.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 404

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 46/354 (12%), Positives = 101/354 (28%), Gaps = 61/354 (17%)

Query: 18  LSIVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           +++  N S  + L   A  +A  +    L     L ++  +     N   L + + +W+ 
Sbjct: 50  VALFANASTGEFLNYTANRVAVPQLARLLTATDELKTSAASYQANQNAATLTDLQTKWLA 109

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
           AR  ++QSE +                         Y++ SY   N  + L     I   
Sbjct: 110 ARRIFKQSETF-------------------------YINRSYLPSNFFHKLD--GYILGE 142

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
                  +++L+  +      +            G+  +E+ ++                
Sbjct: 143 NNRPTANDLNLAAATNPNTSTVDSY----PLTRKGFAALEYFIFDDGNG----------- 187

Query: 197 TDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSII 256
           T              R  Y+  ++ ++  D + ++ +W        + +         I 
Sbjct: 188 THTVAAINAANANAGRRTYIVSLANVIQLDAQRLLGSWNSSSGNFAEELASGKGSFGGIK 247

Query: 257 TGMTSLSYNEL------AGERMNLGLI------LHDPEQEIDCFSDNTYASYLNDVIGII 304
             + S     +         R+ +            P +    +SD  Y   L+ + G+ 
Sbjct: 248 DAIDSFINGLVQLEYTNQDIRVGVPAGLTVAGTTQYPTKLESIYSDTAYQDLLSSIEGLE 307

Query: 305 SSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFH-ILKDRA 357
             Y G             S+  L+   N  L   +  K +         +   A
Sbjct: 308 LVYYGNPGDNEAR-----SLSYLVQFQNSALDARVKTKIAALKSLIQERINASA 356


>gi|294629028|ref|ZP_06707588.1| lipoprotein [Streptomyces sp. e14]
 gi|292832361|gb|EFF90710.1| lipoprotein [Streptomyces sp. e14]
          Length = 379

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 46/388 (11%), Positives = 98/388 (25%), Gaps = 133/388 (34%)

Query: 12  TLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENAR 71
           T+     +   + +L++ +  Y   A          A       +         +LE A+
Sbjct: 122 TVTGANAAAKRDPALDQAVAQYRQYAQ-------DQADETVPLAQKFADAIKAGDLEAAK 174

Query: 72  LQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTAN 131
             +  +RI ++++E                   P+ E F D    +  + +         
Sbjct: 175 KAYAPSRIGWERTE-------------------PVAESFGDIDPKTDTRAD--------- 206

Query: 132 IIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREP 191
                                                 TG+H +E  LW           
Sbjct: 207 ------------------------------GLEQGQKWTGWHRLEKALWQDKKIGAEE-- 234

Query: 192 GNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAG 251
                                    K ++  LV+DL+   +  G        +       
Sbjct: 235 -------------------------KTLADQLVADLKNWQQRVGKAEITPTSMANGAKEL 269

Query: 252 LNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEY 311
           L            +E+A  ++           E D +S      +  +V G   +Y    
Sbjct: 270 L------------DEVATGKVTG---------EEDRYSHTDLVDFKANVEGAQKAYEL-- 306

Query: 312 IRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL--KDRAENIESFDQMISE 369
                       +  +   N+  L  E++ +F+              + +  S+D++   
Sbjct: 307 ------------LKPVAEKNDAALTGELDKQFAALNTVLDKYRTDKASYDFVSYDKV--- 351

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIRI 397
              +  K + + +N L      L     
Sbjct: 352 -GKDQRKELSDAVNALAEPLSKLAAAVA 378


>gi|326381747|ref|ZP_08203440.1| peptidase M75, Imelysin [Gordonia neofelifaecis NRRL B-59395]
 gi|326199173|gb|EGD56354.1| peptidase M75, Imelysin [Gordonia neofelifaecis NRRL B-59395]
          Length = 405

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/346 (12%), Positives = 93/346 (26%), Gaps = 100/346 (28%)

Query: 51  LDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGF 110
           L + ++T        +LE AR  +   R  Y++ E                   P+ E F
Sbjct: 157 LVAQVQTFTGDVKSGDLEAARNGFGLVRTFYERVE-------------------PVAESF 197

Query: 111 IDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITT 170
            D       + ++  +                                           T
Sbjct: 198 PDLDPKIDMRWDDTEDG--------------------------------------KQAFT 219

Query: 171 GYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEM 230
           G+H IE  L+           G     D                 +  V+  L++D+ ++
Sbjct: 220 GFHRIERFLFPPTPADIGEAEGQVAPADAADAKTADTKAN-----IDKVADQLMTDVTQL 274

Query: 231 MKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSD 290
                      +            +         +E+A  ++           E D +S 
Sbjct: 275 RDEVSAPDFEFE----------TQMFVHGPQALIDEIAKTKVGG---------EEDRYSH 315

Query: 291 NTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDF 350
                   ++ G  +                A +  +IS  ++ L  +I  +F++     
Sbjct: 316 TDLWDIAANIDGSETLI--------------AELQPMISQRDQKLMDKITAQFADVRSFI 361

Query: 351 HILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
              ++  +   S+D++    N E  K + + ++ L      +  I 
Sbjct: 362 DQFRE-GDGYVSYDKV----NAEQRKELSDKVDALSATLSQVPGIV 402


>gi|269795836|ref|YP_003315291.1| periplasmic lipoprotein involved in iron transport [Sanguibacter
           keddieii DSM 10542]
 gi|269098021|gb|ACZ22457.1| predicted periplasmic lipoprotein involved in iron transport
           [Sanguibacter keddieii DSM 10542]
          Length = 406

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 47/380 (12%), Positives = 98/380 (25%), Gaps = 117/380 (30%)

Query: 17  ALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIR 76
           A +      +     NY                 L +  +  V      + + AR  +  
Sbjct: 142 APTGALADQITAATTNYVAYVK-------DQTEQLLTGTQDFVDAYTSGDDDTARALYAS 194

Query: 77  ARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANS 136
            R+ +++ E                   P+ E F D                        
Sbjct: 195 TRVHWERIE-------------------PVAESFGDLDPRM------------------- 216

Query: 137 KIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPY 196
                                L  A+  +    TG+H++E  LW    +      G   Y
Sbjct: 217 --------------------DLREADLEEGQEWTGWHLLEKDLW----QPTAEANGGTEY 252

Query: 197 TDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSII 256
                   T              +  L++D  E+         A       I  G   ++
Sbjct: 253 VALTPEQRTQ------------YADQLLADTTELNDRVHTADFAEGIDAASIGNGAKGLL 300

Query: 257 TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
                   +E+A  ++           E + +S      +  +V G   +Y G       
Sbjct: 301 --------DEVATGKVTG---------EEEIWSHTDLWDFQANVDGAKVAYDG------- 336

Query: 317 EKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNK 376
                  + D++   + +LA++++ +F+         +   +    +  +     P   K
Sbjct: 337 -------LRDVVLAQDADLAEDLDTQFAEIQTLLDA-QRSGDGFVLYTDL----TPAQVK 384

Query: 377 IVRNLINDLITQTESLRKIR 396
            + + +N L      L    
Sbjct: 385 ELADSVNALGEPLSRLTAAV 404


>gi|110678253|ref|YP_681260.1| hypothetical protein RD1_0906 [Roseobacter denitrificans OCh 114]
 gi|109454369|gb|ABG30574.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 322

 Score =  100 bits (249), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 46/400 (11%), Positives = 94/400 (23%), Gaps = 92/400 (23%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKK 65
           +  ++  +   A++ V +   + +L  +A +  A  ED    A                 
Sbjct: 3   LALVLACIAVPAVADVSSAITDHILPGHARLVEAT-EDLSATALA-------------DC 48

Query: 66  NLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEEN 125
             +  R  +  A   +      +FG          +  WP  +                 
Sbjct: 49  TPDAVRPAFATAYDAWVSISHIQFGPVEDQGTWLAMAFWPDPKDR--------------- 93

Query: 126 NLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLK 185
                            K +     + D +       G  +    G+  +E LL+     
Sbjct: 94  ---------------TGKALARLFAAQDPIVDDAARFGEVSVAAQGFTALERLLFEPQDD 138

Query: 186 TNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLM 245
                   R          T         Y            E M  A        + + 
Sbjct: 139 PAYACRLTRAIATGLAQKSTALDQA-WPAY-----------AELMQSAGTEGNTRYQSVQ 186

Query: 246 KDINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDNTYASYLNDVIG 302
           +   A   ++ TG+       L  +R+   L       P +     S+      +  +  
Sbjct: 187 ETQRALYTALSTGL-----EFLHDQRLGRPLGSYDRPRPLRAEARRSERALRHIILSLTA 241

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
                                + DL  H       +    F+        L D A    +
Sbjct: 242 ---------------------LEDLAPHVGAADLVQTRSAFAEAHSRADRLDDPALAGVA 280

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
                   +    + ++  +  L  Q   + +I   L + 
Sbjct: 281 -----DPASRFRIEALQQSVRTL--QVAVIDEIGTPLGIS 313


>gi|260776047|ref|ZP_05884942.1| iron-regulated protein A precursor [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607270|gb|EEX33535.1| iron-regulated protein A precursor [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 343

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 42/405 (10%), Positives = 110/405 (27%), Gaps = 84/405 (20%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
               + ++    S + ++          Q    +  A        A  L + +       
Sbjct: 9   LAASMMLLAGCQSTSSTVPVAQKTSHPSQGVYQVEFAAAHTFSNQADKLAAQMAAYCADA 68

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
            +  LE+ + QW +  + +   +    G +        +  WP  +              
Sbjct: 69  TE--LESLKSQWHQTMVAWMALQGQERGPEKALEQSWNIQFWPDKK-------------- 112

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                        +   +          +   + +        +    G   +E+LL+ Q
Sbjct: 113 -----------NTTGRKMTALTGQSKTWTQAQISQQ-------SVTVQGLGSVEWLLYDQ 154

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
               +  +                       +    +++ + ++ E +  AW  +     
Sbjct: 155 ASSLSSSQA--------------------TCQTGIAIAENIAANAETIATAWQTNPWVEL 194

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGL---ILHDPEQEIDCFSDNTYASYLND 299
           D     +  ++ +   +      E + ++M+  L       P       S+ +  +   +
Sbjct: 195 DEKAWTSEYISLLSNQL------EYSMKKMSRPLANFGKPRPYFAESWRSETSMQNLKAN 248

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNR-NLAQEINDKFSNTMKDFHILKDRAE 358
           +  + + Y             G  +  L+    +  LA  I  +F         L+    
Sbjct: 249 IEAMQALYLAG----------GNGLDKLLRERGKVQLADSIAQQFDTA------LETWPT 292

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI 402
           +   FD +      EG +      N L      +  ++ I L ++
Sbjct: 293 DESLFDML---QTKEGYRKAYAQYNKLEQLKYLIHEEVAIELGVV 334


>gi|83950299|ref|ZP_00959032.1| hypothetical protein ISM_04355 [Roseovarius nubinhibens ISM]
 gi|83838198|gb|EAP77494.1| hypothetical protein ISM_04355 [Roseovarius nubinhibens ISM]
          Length = 340

 Score =  100 bits (248), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 42/403 (10%), Positives = 103/403 (25%), Gaps = 90/403 (22%)

Query: 9   IVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLE 68
            VF L     ++     L+  +  +       +         L    +            
Sbjct: 8   AVFCLALPGAALADVADLDGAVDGH---ILPGFRALSQSTGALARTAQDHCA----PEDA 60

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
             R  + +A   + +    RFG    +     +  WP                       
Sbjct: 61  ALRQAYGQAFDDWIKVSHLRFGPSEEEGRAFALAYWPDPRSK------------------ 102

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
                         K +   +   D + +        +    G++ +E+LL+  +   ++
Sbjct: 103 ------------TPKALGQLMAEADPVAENAARYADVSIAARGFYALEYLLYDPEFSGDL 150

Query: 189 REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQAT------K 242
             P                    R + ++ V+  + +    + + W  D  A        
Sbjct: 151 PAP----------------QAGYRCQLIQAVTADMAATAAVIWQGWDGDYAARLRAPGEN 194

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLIL---HDPEQEIDCFSDNTYASYLND 299
           D  +        + T + S      +  R+   +       P++     S  +    +  
Sbjct: 195 DTYRTEAEAAQQLFTAL-SGGLEFTSAMRLGRPMGTFDRPRPQRAEARRSGRSLRHVVLS 253

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAEN 359
           +  +                    +   ++    ++AQ ++  F+  + +   L D    
Sbjct: 254 LEAMRE------------------LTGYLAAGAPDVAQGLDAAFAKALAEAEALDDPIFA 295

Query: 360 IESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDL 401
             +         P+G   V  L   +     SL   +   L +
Sbjct: 296 EVA--------TPQGRLHVEVLQQAVEEIRHSLAEDLGPRLGI 330


>gi|238794033|ref|ZP_04637651.1| hypothetical protein yinte0001_21510 [Yersinia intermedia ATCC
           29909]
 gi|238726665|gb|EEQ18201.1| hypothetical protein yinte0001_21510 [Yersinia intermedia ATCC
           29909]
          Length = 375

 Score =  100 bits (248), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 52/400 (13%), Positives = 106/400 (26%), Gaps = 129/400 (32%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIA--HAKYEDALMC-ARTLDSAIETLVTTP 62
           +   + + P   L++        V  +   +    A+Y+  +      L +  +      
Sbjct: 102 MTCGLLSNPKGKLTVTAAGDQTAVKPDAMALVGPIAEYKVYVTQEVAQLVTQTKAFTDAI 161

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
            K +L  AR  +   R  Y++ E                   P+ E F D   S   +E+
Sbjct: 162 KKGDLALARKLYAPTRQHYERIE-------------------PIAELFSDLDGSIDARED 202

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           +                                              TG+H +E +L+G 
Sbjct: 203 DFEQKAADPKF------------------------------------TGFHRLEKILFGD 226

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           +      +                             +  L  D  E+ +       A  
Sbjct: 227 NTTKGADKF----------------------------ADQLYKDTLELQQRISGLTFAPN 258

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
            +             G  +    E+A  +++          E D +S      +  +V G
Sbjct: 259 KV------------VGGAAGLIEEVAASKISG---------EEDRYSRTDLWDFQANVDG 297

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
                                +  L+   ++ L Q+I+  F          + +A   ES
Sbjct: 298 AQKIVNL--------------LRPLLEKADQPLLQKIDANFKTVDSVLAKYRTKA-GYES 342

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
           ++++           ++  I  L    E L ++R  L L 
Sbjct: 343 YEKL----TDADRNAMKGPITAL---AEDLAQLRGVLGLD 375


>gi|297199244|ref|ZP_06916641.1| lipoprotein [Streptomyces sviceus ATCC 29083]
 gi|197716427|gb|EDY60461.1| lipoprotein [Streptomyces sviceus ATCC 29083]
          Length = 381

 Score =  100 bits (248), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 48/387 (12%), Positives = 95/387 (24%), Gaps = 133/387 (34%)

Query: 14  PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ 73
            +       +  L+  +  Y   A          A       +T        +LE A+  
Sbjct: 123 ATGGSVAKRDPRLDSAVAAYRKYAQ-------EQADATLPLAKTFAAAVKAGDLEAAKKA 175

Query: 74  WIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
           +  +RI ++++E                   P+ E F D       + +           
Sbjct: 176 YAPSRIGWERTE-------------------PVAESFGDIDPKVDVRAD----------- 205

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN 193
                                               TG+H +E  LW     T       
Sbjct: 206 ----------------------------GLEGGQKWTGWHRLEKSLWQDKKITAED---- 233

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
                                  K ++  L++DL +  K  G        +       L 
Sbjct: 234 -----------------------KTLADQLITDLTDWQKRVGKADITPTSMANGAKELL- 269

Query: 254 SIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR 313
                      +E+A  ++           E + +S      +  +V G   SY      
Sbjct: 270 -----------DEVATGKVTG---------EEERYSHTDLVDFKANVEGAEKSYEL---- 305

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHIL--KDRAENIESFDQMISENN 371
                     +  +   NN  L  E++ +F+              + +  S+D++     
Sbjct: 306 ----------LKPVAKENNAALVTELDKQFAAIDTLLDKYRADKSSYDFTSYDKV----G 351

Query: 372 PEGNKIVRNLINDLITQTESLRKIRIA 398
               K + + +N L      L    + 
Sbjct: 352 DADRKQLSDGVNALAEPLSKLAAAVVT 378


>gi|317492442|ref|ZP_07950871.1| imelysin [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919781|gb|EFV41111.1| imelysin [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 374

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 44/357 (12%), Positives = 88/357 (24%), Gaps = 126/357 (35%)

Query: 46  MCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWP 105
              + L    +       K +L  A+  +   R  Y++ E                   P
Sbjct: 144 QEVKQLVEQTKAFTDAVKKGDLATAQKLYAPTRQHYERIE-------------------P 184

Query: 106 LDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGID 165
           + E F D   S   +E++                                          
Sbjct: 185 IAELFSDLDGSIDAREDDYEQKAQDPNF-------------------------------- 212

Query: 166 TNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVS 225
               TG+H +E +L+G                                      +  L+ 
Sbjct: 213 ----TGFHRLEKVLFGDKTTKGADGY----------------------------ADRLMK 240

Query: 226 DLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEI 285
           D+ E+         A   +             G  +    E+A  +++          E 
Sbjct: 241 DVLELQNRVTTLTFAPSKV------------VGGAAGLIEEVAASKISG---------EE 279

Query: 286 DCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSN 345
           D +S      +  +V G                     +  ++   N  L  +I+  F  
Sbjct: 280 DRYSRTDLWDFRANVDGAQKIVNL--------------LRPMLEKANPQLLAKIDANFKT 325

Query: 346 TMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
                   + + +  ES++++           ++  I  L    E L ++R  L L 
Sbjct: 326 VDAILDKYRTK-DGYESYEKL----TAADRNAMKGPITAL---AEDLAQLRGVLGLD 374


>gi|302550974|ref|ZP_07303316.1| lipoprotein [Streptomyces viridochromogenes DSM 40736]
 gi|302468592|gb|EFL31685.1| lipoprotein [Streptomyces viridochromogenes DSM 40736]
          Length = 382

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 44/350 (12%), Positives = 92/350 (26%), Gaps = 123/350 (35%)

Query: 49  RTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDE 108
            TL  A E         ++E A+  +  +RI ++++E                   P+ E
Sbjct: 152 ETLPKA-EAFAKAVKDGDIEAAKKAYAPSRIGWERTE-------------------PVAE 191

Query: 109 GFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNI 168
            F D       +E+                                              
Sbjct: 192 SFGDIDPKVDVREDGL-----------------------------------EDGQDPAKD 216

Query: 169 TTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLE 228
            TG+H +E  LW      +                             K ++  L++DL+
Sbjct: 217 WTGWHRLEKSLWQDKKIGDRE---------------------------KELAGRLITDLK 249

Query: 229 EMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCF 288
           +  +  G        +       L            +E+A  ++           E + +
Sbjct: 250 DWQERVGTAEITPTSMANGAKELL------------DEVATGKVTG---------EEERY 288

Query: 289 SDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMK 348
           S      +  +V G   SY              A +  +   N++ L  E++ +F+    
Sbjct: 289 SHTDLVDFKANVEGAQKSY--------------ALLKPVAQENDKALTTELDKQFAALDA 334

Query: 349 DFHILKDRAENI--ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
                +    +    ++D++         K + + +N L      L    
Sbjct: 335 LLDKYRPNKTSYDFTAYDKV----GKADRKELSDAVNALAEPLSKLAAAV 380


>gi|302865501|ref|YP_003834138.1| peptidase M75, Imelysin [Micromonospora aurantiaca ATCC 27029]
 gi|302568360|gb|ADL44562.1| Peptidase M75, Imelysin [Micromonospora aurantiaca ATCC 27029]
          Length = 376

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 43/388 (11%), Positives = 98/388 (25%), Gaps = 133/388 (34%)

Query: 10  VFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
              +   A ++ P+ +L +  ++Y                 L +  E  V      ++  
Sbjct: 121 ALKVSGTAATVAPDAALTQATESYQRYVR-------SQTAALLTKTEEFVAAVKANDVAK 173

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           A+  +  AR  +++ E                   P+ E F D      G          
Sbjct: 174 AKALYPVARTYWERIE-------------------PVAESFGDLDPKIDG---------- 204

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
                                              +    TG+H IE  LW     +   
Sbjct: 205 -----------------------------REEVVEEGMEFTGFHRIEKDLWTTGDVSKD- 234

Query: 190 EPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDIN 249
                                        ++  L+ D++ ++     +      L     
Sbjct: 235 ---------------------------GPIADRLLVDVKAIVAKADAEKLTPLQLANGAK 267

Query: 250 AGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTG 309
           A L            +E+A  ++           E + +S      +  ++ G       
Sbjct: 268 ALL------------DEVASGKITG---------EEERYSHTDLWDFNANLEG------- 299

Query: 310 EYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISE 369
                   K   A++   +     +L ++++ +F+N        +D  +  +   Q+   
Sbjct: 300 -------SKAAIAALRPALEQRAPDLVKQLDSEFANVEATLGKHRD-GDGWKLHTQL--- 348

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIRI 397
                 K + + +N L      +     
Sbjct: 349 -GKAELKELSDAVNALAEPVSKVAAAVA 375


>gi|254230283|ref|ZP_04923672.1| hypothetical protein VEx25_B0315 [Vibrio sp. Ex25]
 gi|262393896|ref|YP_003285750.1| iron-regulated protein A [Vibrio sp. Ex25]
 gi|151937180|gb|EDN56049.1| hypothetical protein VEx25_B0315 [Vibrio sp. Ex25]
 gi|262337490|gb|ACY51285.1| iron-regulated protein A precursor [Vibrio sp. Ex25]
          Length = 345

 Score = 99.6 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 45/414 (10%), Positives = 117/414 (28%), Gaps = 84/414 (20%)

Query: 3   FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTP 62
               +S+V    +         S   + Q    +     +  L     L+ +     T+ 
Sbjct: 10  VAATLSLVGCQSTVGSRSAKPESTSHISQAVYEVEFQSAQTFLGQTTELEQSFADYCTSE 69

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
            K +    + QW +  + +   +    G          V  WP  +              
Sbjct: 70  TKDD-AQVKQQWHQTMLTWMALQGQERGPATALEQSWNVQFWPDKK-------------- 114

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
                             N     +S+++              +    G   +E+LL+ +
Sbjct: 115 ------------------NTTGRKMSVLTKSDQVWSAEKISTQSVTVQGLGALEWLLYDK 156

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
                                 T             +++ L +  + +  +W  +   + 
Sbjct: 157 AS--------------------TLSSNSNTCATGIAIAENLENKAQIIADSWAQNPWKSL 196

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGL---ILHDPEQEIDCFSDNTYASYLND 299
           ++ +  +  ++ +   +          ++++  L       P       S+ + ++   +
Sbjct: 197 EMTEWKSEYISLLSNQLDYSM------KKLSRPLAKIGKPRPYFSESWRSETSLSNLKAN 250

Query: 300 VIGIISSYTGEYIRMNGEKIHGASIHDLISHN-NRNLAQEINDKFSNTMKDFHILKDRAE 358
           +  + + Y            +G  +  L+    + +LA  I  +F         L+   E
Sbjct: 251 LEAMEALYLA----------NGNGLDALLREQGHVDLADRIVHQFEMA------LETWPE 294

Query: 359 NIESFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLIEP-NRVIGN 410
           +   F    +  + EG ++V    N L      +  ++ I L ++   N   G+
Sbjct: 295 DKSLF---TALQSKEGYRMVLAQYNKLEQLKYLIHEEVAIELGVVIGFNATDGD 345


>gi|300780621|ref|ZP_07090476.1| PbrT family lead (Pb2+) uptake porter [Corynebacterium genitalium
           ATCC 33030]
 gi|300533607|gb|EFK54667.1| PbrT family lead (Pb2+) uptake porter [Corynebacterium genitalium
           ATCC 33030]
          Length = 421

 Score = 99.6 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 42/384 (10%), Positives = 104/384 (27%), Gaps = 94/384 (24%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
                   +   NY                 L   +E         N E A+  +   R+
Sbjct: 128 ASDEKRFNEARDNYVAFVQ-------NEVAELLPKVEEFAEAYASGNDERAKELYPTTRV 180

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKII 139
            Y++ E       ++D               IDY +  Y  E +E               
Sbjct: 181 HYERIEPVAEALGVLDPR-------------IDYREVDYIAEADELAEEDPTFTD----- 222

Query: 140 VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
                                          G+H +E  LW    + +    G+    D+
Sbjct: 223 -----------------------------WLGFHRMEKDLW-PPAEGDKNADGSPAREDW 252

Query: 200 DIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGM 259
           +  +             + ++  L++D+ ++      +     D ++  +  ++++  G 
Sbjct: 253 EPSDPAKR---------REIADALIADIGQL-----SETVNADDFIESNDITVDTVSNGA 298

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
             L   E+A  ++           E + +S      +  ++ G   ++            
Sbjct: 299 MGL-LEEVATTKVTG---------EENWWSHKDLYDFQANIQGSRIAFDMVKDIAAERGE 348

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVR 379
            G           + L  +I +++++  +              +D++    +      + 
Sbjct: 349 EG-----------KELVADIEERYNDVQELLDGYGSLENGYVDYDEV----DAGQQAELT 393

Query: 380 NLINDLITQTESLRKIRIALDLIE 403
             I+ L      L    + L++  
Sbjct: 394 RAIDALREPLAKLTGTVLGLNVES 417


>gi|319409559|emb|CBY89849.1| conserved hypothetical lipoprotein [Neisseria meningitidis WUE
           2594]
          Length = 388

 Score = 99.6 bits (246), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 54/381 (14%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDTGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE+ LW                    
Sbjct: 227 -----------------------------TGFHRIEYALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++         K ++ 
Sbjct: 318 ---FRPLIETKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L ++R  L L
Sbjct: 370 SINAL---AEDLAQLRGILGL 387


>gi|254805886|ref|YP_003084107.1| putative periplasmic iron transporter protein [Neisseria
           meningitidis alpha14]
 gi|254669428|emb|CBA08661.1| putative periplasmic iron transporter protein [Neisseria
           meningitidis alpha14]
          Length = 388

 Score = 99.6 bits (246), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 54/381 (14%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 TNEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE+ LW                    
Sbjct: 227 -----------------------------TGFHRIEYALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++         K ++ 
Sbjct: 318 ---FRPLIEAKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L ++R  L L
Sbjct: 370 SINAL---AEDLAQLRGILGL 387


>gi|225076804|ref|ZP_03720003.1| hypothetical protein NEIFLAOT_01855 [Neisseria flavescens
           NRL30031/H210]
 gi|224951843|gb|EEG33052.1| hypothetical protein NEIFLAOT_01855 [Neisseria flavescens
           NRL30031/H210]
          Length = 388

 Score = 99.6 bits (246), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 53/381 (13%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFAATRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE  LW                    
Sbjct: 227 -----------------------------TGFHRIEHALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++    +    K ++ 
Sbjct: 318 ---FRPLIEAKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----SEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            +N L    E L ++R  L L
Sbjct: 370 PVNAL---AEDLAQLRGILGL 387


>gi|22126334|ref|NP_669757.1| hypothetical protein y2451 [Yersinia pestis KIM 10]
 gi|45441357|ref|NP_992896.1| hypothetical protein YP_1538 [Yersinia pestis biovar Microtus str.
           91001]
 gi|21959315|gb|AAM86008.1|AE013848_8 hypothetical protein y2451 [Yersinia pestis KIM 10]
 gi|45436217|gb|AAS61773.1| Predicted periplasmic lipoprotein involved in iron transport
           [Yersinia pestis biovar Microtus str. 91001]
          Length = 384

 Score = 99.6 bits (246), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 51/396 (12%), Positives = 101/396 (25%), Gaps = 133/396 (33%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           +++       A      ++L   +  Y                 L S  +         +
Sbjct: 122 LTVTVAAGEQAPVKPDAMALVGPIAEYKVYVT-------QEVAQLVSQTKAFTDAVKAGD 174

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  +   R  Y++ E                   P+ E F D   S   +E++   
Sbjct: 175 LALARKLYAPTRQHYERIE-------------------PIAELFSDLDGSIDAREDDFEQ 215

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
                                                      TG+H +E +L+G +   
Sbjct: 216 KSADPKF------------------------------------TGFHRLEKILFGDNTTK 239

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
              +                             + +L  D  E+ K       A   +  
Sbjct: 240 GADKF----------------------------ADLLYQDTLELQKRIAGLTFAPNKV-- 269

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
                      G  +    E+A  +++          E D +S      +  +V G    
Sbjct: 270 ----------VGGAAGLIEEVAASKISG---------EEDRYSRTDLWDFQANVDGAQKI 310

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
                            +  L+   ++ L Q+I+  F+         + + E  ES++++
Sbjct: 311 VNL--------------LRPLLEKADKPLLQKIDANFNTVDSVLAKYRTK-EGYESYEKL 355

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
                      ++  I  L    E L ++R  L L 
Sbjct: 356 ----TDADRNAMKGPITAL---AEDLAQLRGVLGLD 384


>gi|227541176|ref|ZP_03971225.1| PbrT family lead (Pb2+) uptake porter [Corynebacterium
           glucuronolyticum ATCC 51866]
 gi|227183020|gb|EEI63992.1| PbrT family lead (Pb2+) uptake porter [Corynebacterium
           glucuronolyticum ATCC 51866]
          Length = 389

 Score = 99.2 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 49/379 (12%), Positives = 99/379 (26%), Gaps = 125/379 (32%)

Query: 18  LSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA 77
           +S     +++  + NY                 L  A +         + E A+  +  +
Sbjct: 134 VSADEQQAIDDAVTNYTAYVK-------DQTGQLLEATKEFADVYAAGDTEKAKALYAPS 186

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R+ Y++ E                   P  E F D   +   +E                
Sbjct: 187 RMFYERIE-------------------PTAEAFGDIDPALDERE---------------- 211

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYT 197
                                  A+  +    TG+H  E  LW   L    R        
Sbjct: 212 ------------------ADYQEADDTEGREWTGWHKAEKDLWDTPLTAEER-------- 245

Query: 198 DFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIIT 257
                              K  +  LV+D +++      D  +           ++ I  
Sbjct: 246 -------------------KKTADQLVADTQKLYDLVYSDEFSIN---------IDDISN 277

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           G  SL   E+A  ++           E + FS      +  ++ G   +Y          
Sbjct: 278 GAISL-LEEVATTKITG---------EEEAFSHTDLYDFQANLEGAKVAYGN-------- 319

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKI 377
                 +  L    +  LA+ I+ +     ++    K       S+  +    +    + 
Sbjct: 320 ------VESLAKKKDPELAETISARIDALQQNLDKHK-SGNGYVSYTDL----DDAQRRE 368

Query: 378 VRNLINDLITQTESLRKIR 396
           + +L++ L      L +  
Sbjct: 369 LSDLVDALRVPLAKLTEAI 387


>gi|238784705|ref|ZP_04628709.1| hypothetical protein yberc0001_18660 [Yersinia bercovieri ATCC
           43970]
 gi|238714384|gb|EEQ06392.1| hypothetical protein yberc0001_18660 [Yersinia bercovieri ATCC
           43970]
          Length = 375

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 50/396 (12%), Positives = 100/396 (25%), Gaps = 134/396 (33%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           +++       A+       +  + + Y                 L +  +       K +
Sbjct: 114 LTVTAAGAETAVKPDAMALVRPIAE-YKVYVT-------QEVAQLVTQTKAFTDAVKKGD 165

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  +   R  Y++ E                   P+ E F D   S   +E++   
Sbjct: 166 LALARKLYAPTRQHYERIE-------------------PIAELFSDLDGSIDAREDDFEQ 206

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
                                                      TG+H +E +L+G +   
Sbjct: 207 KAADPKF------------------------------------TGFHRLEKILFGDNTTK 230

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
              +                             +  L  D  E+ K       A   +  
Sbjct: 231 GADKF----------------------------ADQLYLDTLELQKRITGLTFAPNKV-- 260

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
                      G  +    E+A  +++          E D +S      +  +V G    
Sbjct: 261 ----------VGGAAGLIEEVAASKISG---------EEDRYSRTDLWDFQANVDGAQKI 301

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
                            +  L+   ++ L Q+I+  F          + + E  ES++++
Sbjct: 302 VNL--------------LRPLLEKADKPLLQKIDANFKTVDSVLAKYRTK-EGYESYEKL 346

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
                      ++  I  L    E L ++R  L L 
Sbjct: 347 ----TDADRNAMKGPITAL---AEDLAQLRGVLGLD 375


>gi|153947462|ref|YP_001401232.1| hypothetical protein YpsIP31758_2263 [Yersinia pseudotuberculosis
           IP 31758]
 gi|152958957|gb|ABS46418.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           31758]
          Length = 376

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 51/396 (12%), Positives = 101/396 (25%), Gaps = 133/396 (33%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           +++       A      ++L   +  Y                 L S  +         +
Sbjct: 114 LTVTVAAGEQAPVKPDAMALVGPITEYKVYVT-------QEVAQLVSQTKAFTDAVKAGD 166

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  +   R  Y++ E                   P+ E F D   S   +E++   
Sbjct: 167 LALARKLYAPTRQHYERIE-------------------PIAELFSDLDGSIDAREDDFEQ 207

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
                                                      TG+H +E +L+G +   
Sbjct: 208 KSADPKF------------------------------------TGFHRLEKILFGDNTTK 231

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
              +                             + +L  D  E+ K       A   +  
Sbjct: 232 GADKF----------------------------ADLLYQDTLELQKRIAGLTFAPNKV-- 261

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
                      G  +    E+A  +++          E D +S      +  +V G    
Sbjct: 262 ----------VGGAAGLIEEVAASKISG---------EEDRYSRTDLWDFQANVDGAQKI 302

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
                            +  L+   ++ L Q+I+  F+         + + E  ES++++
Sbjct: 303 VNL--------------LRPLLEKADKPLLQKIDANFNTVDSVLAKYRTK-EGYESYEKL 347

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
                      ++  I  L    E L ++R  L L 
Sbjct: 348 ----TDADRNAMKGPITAL---AEDLAQLRGVLGLD 376


>gi|315502049|ref|YP_004080936.1| peptidase m75, imelysin [Micromonospora sp. L5]
 gi|315408668|gb|ADU06785.1| Peptidase M75, Imelysin [Micromonospora sp. L5]
          Length = 376

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 43/388 (11%), Positives = 98/388 (25%), Gaps = 133/388 (34%)

Query: 10  VFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLEN 69
              +   A ++ P+ +L +  ++Y                 L +  E  V      ++  
Sbjct: 121 ALKVSGTAATVAPDAALTQATESYQRYVR-------SQTAALLTKTEEFVAAVKANDVAR 173

Query: 70  ARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYT 129
           A+  +  AR  +++ E                   P+ E F D      G          
Sbjct: 174 AKALYPVARTYWERIE-------------------PVAESFGDLDPKIDG---------- 204

Query: 130 ANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVR 189
                                              +    TG+H IE  LW     +   
Sbjct: 205 -----------------------------REEVVEEGMEFTGFHRIEKDLWTTGDVSKD- 234

Query: 190 EPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDIN 249
                                        ++  L+ D++ ++     +      L     
Sbjct: 235 ---------------------------GPIADRLLVDVKAIVAKADAEKLTPLQLANGAK 267

Query: 250 AGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTG 309
           A L            +E+A  ++           E + +S      +  ++ G       
Sbjct: 268 ALL------------DEVASGKITG---------EEERYSHTDLWDFNANLEG------- 299

Query: 310 EYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISE 369
                   K   A++   +     +L ++++ +F+N        +D  +  +   Q+   
Sbjct: 300 -------SKAAIAALRPALEQRAPDLVKQLDSEFANVEATLGKHRD-GDGWKLHTQL--- 348

Query: 370 NNPEGNKIVRNLINDLITQTESLRKIRI 397
                 K + + +N L      +     
Sbjct: 349 -GKAELKELSDAVNALAEPVSKVAAAVA 375


>gi|325203169|gb|ADY98622.1| putative lipoprotein [Neisseria meningitidis M01-240355]
          Length = 388

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 54/381 (14%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE+ LW                    
Sbjct: 227 -----------------------------TGFHRIEYALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++         K ++ 
Sbjct: 318 ---FRPLIEAKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L ++R  L L
Sbjct: 370 SINAL---AEDLAQLRGILGL 387


>gi|238021017|ref|ZP_04601443.1| hypothetical protein GCWU000324_00914 [Kingella oralis ATCC 51147]
 gi|237867997|gb|EEP69003.1| hypothetical protein GCWU000324_00914 [Kingella oralis ATCC 51147]
          Length = 399

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 46/355 (12%), Positives = 96/355 (27%), Gaps = 125/355 (35%)

Query: 47  CARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPL 106
            A+ L +  E  V      ++E A+ Q+   R+ Y++ E                   P+
Sbjct: 169 EAKELVAKTEAFVAAVKAGDIEKAKSQFAATRVHYERVE-------------------PI 209

Query: 107 DEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDT 166
            E F +   +   +E++       +                                   
Sbjct: 210 AELFNELDPAIDAREDDFKMGAKDS----------------------------------- 234

Query: 167 NITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSD 226
              TG+H IE  LW Q    +                            ++  +  L+ D
Sbjct: 235 -AFTGFHRIEHALWVQKDVKD----------------------------VQATADKLLED 265

Query: 227 LEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEID 286
           ++++             +             G  +    E+A  ++           E D
Sbjct: 266 VKKLQAEIDALSFPPGKV------------VGGAAALIEEVASSKITG---------EED 304

Query: 287 CFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNT 346
            +S    + +  +V G                         I+  N+ L  +++  F   
Sbjct: 305 RYSHTDLSDFQANVDGSQKIVEL--------------FRPQIAEKNKALLDKVDANFKTV 350

Query: 347 MKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDL 401
                  K+   +   ++++      E    ++  IN L    E L ++R  L L
Sbjct: 351 NDILAKYKNADGSYADYEKL----TKEDRNALQVPINAL---AEDLAQLRGTLGL 398


>gi|296269888|ref|YP_003652520.1| hypothetical protein Tbis_1915 [Thermobispora bispora DSM 43833]
 gi|296092675|gb|ADG88627.1| conserved hypothetical protein [Thermobispora bispora DSM 43833]
          Length = 375

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 41/376 (10%), Positives = 99/376 (26%), Gaps = 133/376 (35%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
             +  L + + +Y    +         A +L    +         ++  A+  +  AR  
Sbjct: 131 TADAKLAEAVASYKRYVN-------SQAGSLLEKTKEFTDAVKAGDIAKAKELFPIARTY 183

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           +++ E                   P+ E F D   +                        
Sbjct: 184 WERIE-------------------PVAEIFGDLDPAIDA--------------------- 203

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                +  +    TG+H IE  LW   +  +V   G        
Sbjct: 204 ------------------RENDVAEGEEWTGFHRIEKDLW---VTGDVSGDGP------- 235

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                             ++  L++D+  +++       +   L       L        
Sbjct: 236 ------------------IADKLMADVRTLVEKATTVELSPLQLANGAKGLL-------- 269

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
               +E+A  ++           E D +S      +  ++              +G K  
Sbjct: 270 ----DEIATGKITG---------EEDRYSHTDLWDFAANL--------------DGSKAA 302

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
             ++  ++   +  L +EI++ F+   K     +   +  + + ++         K + +
Sbjct: 303 VQALRPVLEERDPELVKEIDEGFAAVEKVLGEHR-SGDGWKLYTEL----GKSDLKALSD 357

Query: 381 LINDLITQTESLRKIR 396
            IN L      +  + 
Sbjct: 358 AINALSESISKIASVV 373


>gi|238758072|ref|ZP_04619252.1| hypothetical protein yaldo0001_12030 [Yersinia aldovae ATCC 35236]
 gi|238703610|gb|EEP96147.1| hypothetical protein yaldo0001_12030 [Yersinia aldovae ATCC 35236]
          Length = 375

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 51/400 (12%), Positives = 104/400 (26%), Gaps = 129/400 (32%)

Query: 6   IISIVFTLPSHALSIVPNVSLEKVLQNYATIA--HAKYEDALMC-ARTLDSAIETLVTTP 62
           +   + + P   L++        V  +   +    A+Y+  +      L +  +      
Sbjct: 102 MTCGLLSNPKGTLTVTAVGDHTAVKPDAMALVGPIAEYKVYVTQEVTQLVTQTKAFTDAI 161

Query: 63  NKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKEN 122
              +L  AR  +   R  Y++ E                   P+ E F D   S   +E+
Sbjct: 162 KNGDLALARKLYAPTRQHYERIE-------------------PIAELFSDLDGSIDARED 202

Query: 123 EENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQ 182
           +                                              TG+H +E +L+G 
Sbjct: 203 DFEQKAADPKF------------------------------------TGFHRLEKILFGD 226

Query: 183 DLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATK 242
           +      +                             +  L  D  E+ K       A  
Sbjct: 227 NTTKGADKF----------------------------ADQLYQDTRELQKRITHLTFAPN 258

Query: 243 DLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIG 302
            +             G  +    E+A  +++          E D +S      +  +V G
Sbjct: 259 KV------------VGGAAGLIEEVAASKISG---------EEDRYSRTDLWDFQANVDG 297

Query: 303 IISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIES 362
                                +  L+   ++ L  +I+  F          + + E  ES
Sbjct: 298 AQKIVNL--------------LWPLLEKADKPLLDKIDANFKTVDSVLAKYRTK-EGYES 342

Query: 363 FDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
           ++++           ++  I  L    E L ++R  L L 
Sbjct: 343 YEKL----TDADRNAMKGPITAL---AEDLAQLRGVLGLD 375


>gi|325265889|ref|ZP_08132575.1| PbrT family lead (Pb2+) uptake porter [Kingella denitrificans ATCC
           33394]
 gi|324982527|gb|EGC18153.1| PbrT family lead (Pb2+) uptake porter [Kingella denitrificans ATCC
           33394]
          Length = 397

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 53/396 (13%), Positives = 109/396 (27%), Gaps = 133/396 (33%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           +++  +    A      + L + L  Y     A        A  L       V       
Sbjct: 135 LTVTDSGFKSAGGEADMLKLAEPLAAYKKYVQA-------EAAELVRKTNEFVAAVKAGK 187

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
            + A+  +   R  Y++ E                   P+ E F +   +   +E++  N
Sbjct: 188 QDEAKAMFADVRSHYERIE-------------------PIAELFNELDPAIDAREDDFKN 228

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
                +                                     TG+H +E+ LW +    
Sbjct: 229 GPKDELF------------------------------------TGFHRLEYALWVEKSVD 252

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
           N                            +  V+  L +D+E++             +  
Sbjct: 253 N----------------------------VGAVADRLKADVEKLKAEIDVLNFPPSKV-- 282

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
                      G  ++   E+AG +++          E D +S    + +  ++ G    
Sbjct: 283 ----------VGGAAVLVEEVAGSKISG---------EEDRYSHTDLSDFQANMDGAQKI 323

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
                               LI+  N+ L  +I+       +     +D  +  +++D++
Sbjct: 324 VDL--------------FRPLIAEKNKALLDKIDTNMKQVHEVLAKYRD-GKGFQTYDKL 368

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
               +    K ++  IN L    E L K+R  L L 
Sbjct: 369 ----SETDRKALQAPINAL---AEDLAKLRGTLGLN 397


>gi|325131181|gb|EGC53897.1| putative lipoprotein [Neisseria meningitidis OX99.30304]
 gi|325135252|gb|EGC57875.1| putative lipoprotein [Neisseria meningitidis M13399]
 gi|325201227|gb|ADY96681.1| putative lipoprotein [Neisseria meningitidis M01-240149]
 gi|325205135|gb|ADZ00588.1| putative lipoprotein [Neisseria meningitidis M04-240196]
          Length = 388

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 54/381 (14%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE+ LW                    
Sbjct: 227 -----------------------------TGFHRIEYALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++         K ++ 
Sbjct: 318 ---FRPLIETKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L ++R  L L
Sbjct: 370 SINAL---AEDLAQLRGILGL 387


>gi|111075643|gb|ABH04992.1| 47 kDa lipoprotein [Neisseria lactamica]
 gi|111075645|gb|ABH04993.1| 47 kDa lipoprotein [Neisseria lactamica]
          Length = 388

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 52/381 (13%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFAATRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE  LW                    
Sbjct: 227 -----------------------------TGFHRIEHALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   ++ L ++ +  F    +     + + +  E++D++    +    K ++ 
Sbjct: 318 ---FRPLIEAKDKALLEKTDANFKQVNEILAKYRTK-DGFETYDKL----SEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            +N L    E L ++R  L L
Sbjct: 370 PVNAL---AEDLAQLRGILGL 387


>gi|111075603|gb|ABH04972.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075605|gb|ABH04973.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075607|gb|ABH04974.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|325143373|gb|EGC65703.1| putative lipoprotein [Neisseria meningitidis 961-5945]
 gi|325197341|gb|ADY92797.1| putative lipoprotein [Neisseria meningitidis G2136]
          Length = 388

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 55/381 (14%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   RI 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRIH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE+ LW                    
Sbjct: 227 -----------------------------TGFHRIEYALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++         K ++ 
Sbjct: 318 ---FRPLIEAKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L ++R  L L
Sbjct: 370 SINAL---AEDLAQLRGILGL 387


>gi|254466696|ref|ZP_05080107.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206687604|gb|EDZ48086.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 334

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 48/374 (12%), Positives = 101/374 (27%), Gaps = 88/374 (23%)

Query: 36  IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVD 95
           +    +E+    +RTL  A +      +       R  +  A   +  +  YRFG    D
Sbjct: 31  LILPAFEELAEDSRTLARAAQADCDPQSAP----LRAAYGEAFDAWIAASQYRFGPTETD 86

Query: 96  TWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLL 155
           +    +  WP                  +     A++I +          D  I  P   
Sbjct: 87  SRAFALAFWPDSRS--------------KTPKALASLIRSE---------DAGIKDPAKF 123

Query: 156 RKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEY 215
                     +  + G++ +EFLL+   L                      G    R   
Sbjct: 124 ASY-------SIASRGFYALEFLLYDPQL-------------------SAAGDVDYRCAL 157

Query: 216 LKVVSKILVSDLEEMMKAWGPDGQA----TKDLMKDINAGLNSIITGMTSLSYNELAGER 271
            + +S  + +  + +   W     A         +  +     +   +T+     + G R
Sbjct: 158 TRAISTDIAATSQAISADWQQSYAAELRAPGSRYQTEDEITQELFKALTTG-LQVVDGMR 216

Query: 272 MNLGLIL---HDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLI 328
           +   L       P +     S  +    L  +  +                    +   +
Sbjct: 217 LGRPLGTYQKPRPNRAEARRSGRSLRHVLISLNALE------------------PLAVAL 258

Query: 329 SHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQ 388
           +  N +L  ++   F+        L D      S        +P G   + +L  ++   
Sbjct: 259 AGGNEDLRDKLTTGFAKARAKAEALDDPVFAGVS--------DPAGRFRIESLQQEIKDL 310

Query: 389 TESL-RKIRIALDL 401
              +   +  AL +
Sbjct: 311 HTLMREDLGPALGV 324


>gi|227487447|ref|ZP_03917763.1| PbrT family lead (Pb2+) uptake porter [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227092671|gb|EEI27983.1| PbrT family lead (Pb2+) uptake porter [Corynebacterium
           glucuronolyticum ATCC 51867]
          Length = 389

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 48/379 (12%), Positives = 100/379 (26%), Gaps = 125/379 (32%)

Query: 18  LSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA 77
           +S     +++  + NY                 L  A +         + E A+  +  +
Sbjct: 134 VSADEQQAIDDAVTNYTAYVK-------DQTGQLLEATKEFAAAYAAGDTEKAKALYAPS 186

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R+ Y++ E                   P  E F D   +   +E                
Sbjct: 187 RMFYERIE-------------------PTAEAFGDIDPALDERE---------------- 211

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYT 197
                                 +++  +    TG+H  E  LW   L    R        
Sbjct: 212 ------------------ADYQKSDDTEGREWTGWHKAEKDLWDTPLTAEER-------- 245

Query: 198 DFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIIT 257
                              K  +  LV+D +++      D  +           ++ I  
Sbjct: 246 -------------------KKTADQLVADTQKLYDLVYSDEFSIN---------IDDISN 277

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           G  SL   E+A  ++           E + FS      +  ++ G   +Y          
Sbjct: 278 GAISL-LEEVATTKITG---------EEEAFSHTDLYDFQANLEGAKVAYGN-------- 319

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKI 377
                 +  L    +  LA+ I+ +     ++    K       S+  +    +    + 
Sbjct: 320 ------VESLAKKKDPELAETISARIDALQQNLDKHK-SGNGYVSYTDL----DDAQRRE 368

Query: 378 VRNLINDLITQTESLRKIR 396
           + +L++ L      L +  
Sbjct: 369 LSDLVDALRVPLAKLTEAI 387


>gi|325145472|gb|EGC67746.1| putative lipoprotein [Neisseria meningitidis M01-240013]
          Length = 388

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 50/365 (13%), Positives = 106/365 (29%), Gaps = 127/365 (34%)

Query: 38  HAKYEDALM-CARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT 96
            A Y+  +    + L +  +T        ++E A+  +   R+ Y++ E           
Sbjct: 149 LADYKAYVQGEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRVHYERIE----------- 197

Query: 97  WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR 156
                   P+ E F +       +E++  +                              
Sbjct: 198 --------PIAELFSELDPVIDAREDDFKDGAKDAGF----------------------- 226

Query: 157 KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYL 216
                        TG+H IE+ LW                              + V  +
Sbjct: 227 -------------TGFHRIEYALWV----------------------------EKDVSGV 245

Query: 217 KVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGL 276
           K ++  L++D+E + K           ++   +  +             E+AG +++   
Sbjct: 246 KEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI------------EEVAGSKISG-- 291

Query: 277 ILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLA 336
                  E D +S    + +  +V G                        LI   N+ L 
Sbjct: 292 -------EEDRYSHTDLSDFQANVDGSKKIVDL--------------FRPLIEAKNKALL 330

Query: 337 QEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
           ++ +  F    +     + + +  E++D++         K ++  IN L    E L ++R
Sbjct: 331 EKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRKALQASINAL---AEDLAQLR 382

Query: 397 IALDL 401
             L L
Sbjct: 383 GILGL 387


>gi|311113273|ref|YP_003984495.1| PbrT family lead (Pb2+) uptake porter [Rothia dentocariosa ATCC
           17931]
 gi|310944767|gb|ADP41061.1| PbrT family lead (Pb2+) uptake porter [Rothia dentocariosa ATCC
           17931]
          Length = 447

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 48/385 (12%), Positives = 106/385 (27%), Gaps = 115/385 (29%)

Query: 14  PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ 73
            +  +S       +  +  Y+                L +  +       +   + A+ +
Sbjct: 135 SAKPISADEQAMRDTAVTQYSAYVK-------DQVEALKTDTDEFAKLYQEGKNDEAKAK 187

Query: 74  WIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
           +  ARI Y++ E          ++ K ++                               
Sbjct: 188 YAAARIHYERIE-----PIAEKSYGKTLD------------------------------- 211

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN 193
               + ++ +E D                  +    TG+H IE  LW Q           
Sbjct: 212 ----LKLDARETD--------------LEEGNVQEWTGWHKIEKDLW-QPKADANDGKEY 252

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
           +P T                E  K +S+ LV D +E+      D                
Sbjct: 253 KPLTT---------------EERKQISEKLVKDTQELYDYVHSDEFKLDAF--------- 288

Query: 254 SIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIR 313
            I  G   L  +E+   ++           E + +S    + +  +V G    Y      
Sbjct: 289 QISNGAKEL-LDEVVNTKLTG---------EEENWSHTDLSDFQGNVDGAKVDYEN---- 334

Query: 314 MNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPE 373
                     +  ++   N  LA+ + +KF    K     K + +  + ++++    + E
Sbjct: 335 ----------LLPILQKKNPELAKTLQEKFDAVQKILDKYK-QDDGFKPYNEL----SKE 379

Query: 374 GNKIVRNLINDLITQTESLRKIRIA 398
             + + + +  L      + +    
Sbjct: 380 EVRELSDAVTALAEPVSQMTETVAG 404


>gi|118579263|ref|YP_900513.1| hypothetical protein Ppro_0825 [Pelobacter propionicus DSM 2379]
 gi|118501973|gb|ABK98455.1| imelysin, Metallo peptidase, MEROPS family M75 [Pelobacter
           propionicus DSM 2379]
          Length = 358

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 58/381 (15%), Positives = 113/381 (29%), Gaps = 57/381 (14%)

Query: 29  VLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           +L++YA  +       A+   R L+ A   L   P   N   A   W  AR  ++++  +
Sbjct: 1   MLEDYADKVVLKTIARAVQDFRLLEQAAVRLRAEPTDGNAAAAAEAWRTARAQWKKTATF 60

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
            FG      +DK+++ +PLD   +D++                      ++      +D 
Sbjct: 61  MFGPAAHYNFDKQLDTFPLDRPLVDHLLG--------------------EMTAGRVAVDE 100

Query: 148 SIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
             +  +LL               G    E+LL+        ++                 
Sbjct: 101 RYLREELLSTQ-----------RGLPAAEYLLFRDGKPRRAKDMTPAELEYLVAATRAMT 149

Query: 208 HCRRRVEYLKVVSKIL--VSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT----- 260
                 E     S  +                     +       G   +   +      
Sbjct: 150 LESMDFEASWAGSSRMPADKAALLKAAGMRTRSSYADEFKHPGAPGSRYLSHSVALQEIF 209

Query: 261 --SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEK 318
             S++  E  G+ +   L   +P      +S N  A  LN +  + ++Y G       E 
Sbjct: 210 QESVAVTEDLGDAIAGELDSANPRGGRTWYSRNGRADLLNILKSVENAYLGG-----AEG 264

Query: 319 IHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIV 378
             G S+ +L++  +  L + I    ++T           E    +      N  E   ++
Sbjct: 265 DRGHSVSELLASRDEVLDRRIRIALADTAFRIT------EAAGPY----GGNGEERELLI 314

Query: 379 RNLINDLITQTESLRKIRIAL 399
           R   +     T  L  +   L
Sbjct: 315 RRAESACHKLTARL-SVAALL 334


>gi|108807229|ref|YP_651145.1| hypothetical protein YPA_1233 [Yersinia pestis Antiqua]
 gi|108812429|ref|YP_648196.1| hypothetical protein YPN_2268 [Yersinia pestis Nepal516]
 gi|145598560|ref|YP_001162636.1| hypothetical protein YPDSF_1270 [Yersinia pestis Pestoides F]
 gi|149366199|ref|ZP_01888234.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|162418186|ref|YP_001606511.1| hypothetical protein YpAngola_A2041 [Yersinia pestis Angola]
 gi|165925994|ref|ZP_02221826.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165938666|ref|ZP_02227221.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166010946|ref|ZP_02231844.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166210740|ref|ZP_02236775.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167400994|ref|ZP_02306497.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420109|ref|ZP_02311862.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425777|ref|ZP_02317530.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167469091|ref|ZP_02333795.1| hypothetical protein YpesF_14644 [Yersinia pestis FV-1]
 gi|218928974|ref|YP_002346849.1| hypothetical protein YPO1855 [Yersinia pestis CO92]
 gi|229896304|ref|ZP_04511474.1| Protein ycdO [Yersinia pestis Pestoides A]
 gi|229897241|ref|ZP_04512397.1| Protein ycdO [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229897968|ref|ZP_04513119.1| Protein ycdO [Yersinia pestis biovar Orientalis str. India 195]
 gi|229902801|ref|ZP_04517918.1| Protein ycdO [Yersinia pestis Nepal516]
 gi|270486590|ref|ZP_06203664.1| imelysin [Yersinia pestis KIM D27]
 gi|294503984|ref|YP_003568046.1| hypothetical protein YPZ3_1874 [Yersinia pestis Z176003]
 gi|122979684|sp|Q1C8M2|YCDO_YERPA RecName: Full=UPF0409 protein ycdO; Flags: Precursor
 gi|123150127|sp|Q0WFT9|YCDO_YERPE RecName: Full=UPF0409 protein ycdO; Flags: Precursor
 gi|123246389|sp|Q1CHD4|YCDO_YERPN RecName: Full=UPF0409 protein ycdO; Flags: Precursor
 gi|108776077|gb|ABG18596.1| hypothetical protein YPN_2268 [Yersinia pestis Nepal516]
 gi|108779142|gb|ABG13200.1| hypothetical protein YPA_1233 [Yersinia pestis Antiqua]
 gi|115347585|emb|CAL20495.1| putative exported protein [Yersinia pestis CO92]
 gi|145210256|gb|ABP39663.1| hypothetical protein YPDSF_1270 [Yersinia pestis Pestoides F]
 gi|149292612|gb|EDM42686.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|162351001|gb|ABX84949.1| conserved hypothetical protein [Yersinia pestis Angola]
 gi|165913280|gb|EDR31902.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165922198|gb|EDR39375.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165990290|gb|EDR42591.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207920|gb|EDR52400.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961804|gb|EDR57825.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167049383|gb|EDR60791.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055176|gb|EDR64973.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229680248|gb|EEO76347.1| Protein ycdO [Yersinia pestis Nepal516]
 gi|229689009|gb|EEO81074.1| Protein ycdO [Yersinia pestis biovar Orientalis str. India 195]
 gi|229693578|gb|EEO83627.1| Protein ycdO [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229701227|gb|EEO89256.1| Protein ycdO [Yersinia pestis Pestoides A]
 gi|262361831|gb|ACY58552.1| hypothetical protein YPD4_1644 [Yersinia pestis D106004]
 gi|262366030|gb|ACY62587.1| hypothetical protein YPD8_1906 [Yersinia pestis D182038]
 gi|270335094|gb|EFA45871.1| imelysin [Yersinia pestis KIM D27]
 gi|294354443|gb|ADE64784.1| hypothetical protein YPZ3_1874 [Yersinia pestis Z176003]
 gi|320015403|gb|ADV98974.1| Protein ycdO [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 376

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 51/396 (12%), Positives = 101/396 (25%), Gaps = 133/396 (33%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           +++       A      ++L   +  Y                 L S  +         +
Sbjct: 114 LTVTVAAGEQAPVKPDAMALVGPIAEYKVYVT-------QEVAQLVSQTKAFTDAVKAGD 166

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  +   R  Y++ E                   P+ E F D   S   +E++   
Sbjct: 167 LALARKLYAPTRQHYERIE-------------------PIAELFSDLDGSIDAREDDFEQ 207

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
                                                      TG+H +E +L+G +   
Sbjct: 208 KSADPKF------------------------------------TGFHRLEKILFGDNTTK 231

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
              +                             + +L  D  E+ K       A   +  
Sbjct: 232 GADKF----------------------------ADLLYQDTLELQKRIAGLTFAPNKV-- 261

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
                      G  +    E+A  +++          E D +S      +  +V G    
Sbjct: 262 ----------VGGAAGLIEEVAASKISG---------EEDRYSRTDLWDFQANVDGAQKI 302

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
                            +  L+   ++ L Q+I+  F+         + + E  ES++++
Sbjct: 303 VNL--------------LRPLLEKADKPLLQKIDANFNTVDSVLAKYRTK-EGYESYEKL 347

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
                      ++  I  L    E L ++R  L L 
Sbjct: 348 ----TDADRNAMKGPITAL---AEDLAQLRGVLGLD 376


>gi|15675975|ref|NP_273101.1| hypothetical protein NMB0035 [Neisseria meningitidis MC58]
 gi|161869053|ref|YP_001598219.1| hypothetical protein NMCC_0036 [Neisseria meningitidis 053442]
 gi|304388835|ref|ZP_07370889.1| PbrT family lead (Pb2+) uptake porter [Neisseria meningitidis ATCC
           13091]
 gi|81785202|sp|Q9K1P6|U409_NEIMB RecName: Full=UPF0409 lipoprotein NMB0035; Flags: Precursor
 gi|7225255|gb|AAF40506.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|111075593|gb|ABH04967.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075601|gb|ABH04971.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075611|gb|ABH04976.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075615|gb|ABH04978.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075617|gb|ABH04979.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075619|gb|ABH04980.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075631|gb|ABH04986.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|161594606|gb|ABX72266.1| lipoprotein [Neisseria meningitidis 053442]
 gi|261391585|emb|CAX49023.1| conserved hypothetical lipoprotein [Neisseria meningitidis 8013]
 gi|304337201|gb|EFM03381.1| PbrT family lead (Pb2+) uptake porter [Neisseria meningitidis ATCC
           13091]
 gi|308388259|gb|ADO30579.1| putative lipoprotein [Neisseria meningitidis alpha710]
 gi|316983605|gb|EFV62587.1| imelysin family protein [Neisseria meningitidis H44/76]
 gi|325139499|gb|EGC62039.1| putative lipoprotein [Neisseria meningitidis CU385]
 gi|325199268|gb|ADY94723.1| putative lipoprotein [Neisseria meningitidis H44/76]
          Length = 388

 Score = 98.8 bits (244), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 54/381 (14%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE+ LW                    
Sbjct: 227 -----------------------------TGFHRIEYALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++         K ++ 
Sbjct: 318 ---FRPLIEAKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L ++R  L L
Sbjct: 370 SINAL---AEDLAQLRGILGL 387


>gi|323497654|ref|ZP_08102671.1| iron-regulated protein A precursor [Vibrio sinaloensis DSM 21326]
 gi|323317403|gb|EGA70397.1| iron-regulated protein A precursor [Vibrio sinaloensis DSM 21326]
          Length = 343

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 50/397 (12%), Positives = 111/397 (27%), Gaps = 84/397 (21%)

Query: 11  FTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENA 70
           F   S +             Q    +     E+    A  L S +        +  L + 
Sbjct: 17  FGCQSTSQYARSAEQTTHASQAVYQVEFDAAENFAQQADRLHSELVGYCAQ--ETELSSV 74

Query: 71  RLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTA 130
           + QW +  + +   +    G +        V  WP  +                     A
Sbjct: 75  KQQWHQTMVSWMALQGQERGPEQALAQSWNVQFWPDKKN--------------TTGRKMA 120

Query: 131 NIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVRE 190
           ++IA  K                  +         +    G   IE+LL+      +   
Sbjct: 121 SLIATDK------------------QWSAEQIAEQSVTVQGLGSIEWLLYDNASTLSQSA 162

Query: 191 PGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINA 250
                                  +    +S+ L ++ E++  AW  +     D    ++ 
Sbjct: 163 G--------------------TCQTASAISQNLTNNAEKIATAWQSNPWKALDDKAWVSE 202

Query: 251 GLNSIITGMTSLSYNELAGERMNLGL---ILHDPEQEIDCFSDNTYASYLNDVIGIISSY 307
            ++ +   +      E   ++M+  L       P       S  +  +   +V  + + Y
Sbjct: 203 YISLLSNQL------EYGMKKMSRPLANFGKPRPYFAESWRSKTSMENLKANVEAMQALY 256

Query: 308 TGEYIRMNGEKIHGASIHDLISHNNRN-LAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
                       +G  + +L+    +  LA  I  +F         ++    +   FD +
Sbjct: 257 LA----------NGQGLDNLLRERGKEQLADSITQQF------VMTIETWPLDQSLFDLL 300

Query: 367 ISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI 402
               + +G +I  +  N L      +  ++ I L ++
Sbjct: 301 ---QSKDGYRIAYSNYNKLEQLKYLIHEEVAIELGVV 334


>gi|186895170|ref|YP_001872282.1| hypothetical protein YPTS_1858 [Yersinia pseudotuberculosis PB1/+]
 gi|186698196|gb|ACC88825.1| conserved hypothetical protein [Yersinia pseudotuberculosis PB1/+]
          Length = 376

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 51/396 (12%), Positives = 101/396 (25%), Gaps = 133/396 (33%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           +++       A      ++L   +  Y                 L S  +         +
Sbjct: 114 LTVTVAAGEQAPVKPDAMALVGPIAEYKVYVT-------QEVAQLVSQTKAFTDAVKAGD 166

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  +   R  Y++ E                   P+ E F D   S   +E++   
Sbjct: 167 LALARKLYAPTRQHYERIE-------------------PIAELFSDLDGSIDAREDDFEQ 207

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
                                                      TG+H +E +L+G +   
Sbjct: 208 KSADPKF------------------------------------TGFHRLEKILFGDNTTK 231

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
              +                             + +L  D  E+ K       A   +  
Sbjct: 232 GADKF----------------------------ADLLYQDTLELQKRIAGLTFAPNKV-- 261

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
                      G  +    E+A  +++          E D +S      +  +V G    
Sbjct: 262 ----------VGGAAGLIEEVAASKISG---------EEDRYSRTDLWDFQANVDGAQKI 302

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
                            +  L+   ++ L Q+I+  F+         + + E  ES++++
Sbjct: 303 VNL--------------LRPLLEKADKPLLQKIDANFNTVDSVLAKYRTK-EGYESYEKL 347

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
                      ++  I  L    E L ++R  L L 
Sbjct: 348 ----TDADRNAMKGPITAL---AEDLAQLRGVLGLD 376


>gi|13474609|ref|NP_106178.1| hypothetical protein mlr5528 [Mesorhizobium loti MAFF303099]
 gi|14025363|dbj|BAB51964.1| mlr5528 [Mesorhizobium loti MAFF303099]
          Length = 359

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/308 (14%), Positives = 90/308 (29%), Gaps = 62/308 (20%)

Query: 20  IVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRAR 78
               V    ++Q          Y D    A  L  A+ TL   P++  L+ AR ++    
Sbjct: 21  ASAAVKASDIIQGAIDGFVRPAYADLHQHAEALTRAMHTLCKAPSQGELDAARAEFSATV 80

Query: 79  IPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKI 138
             +  +E+  FG    +   +++  WP  +                              
Sbjct: 81  YAWSSAEIIGFGPIKENNRLERILYWPDRKS----------------------------- 111

Query: 139 IVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTD 198
            +  K++  ++   D            +    G   +EF+L+G                 
Sbjct: 112 -IGLKQVQAALADKDPTASDPAQLAGKSVAMQGLGALEFVLFGDGADA------------ 158

Query: 199 FDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW---------GPDGQATKDLMKDIN 249
                  G     R  Y   V+  + +   ++  AW           +      L +D N
Sbjct: 159 -----LAGKDDPYRCAYGAAVAGNIETMAGDVSAAWNKPDGFAALWANPGPQNALYRDGN 213

Query: 250 AGLNSIITGMTSLSYNELAGERMNLGLI----LHDPEQEIDCFSDNTYASYLNDVIGIIS 305
             +  ++ G+       +   R+   L        P+Q I   S NT  +   ++ G+ +
Sbjct: 214 EAVTELV-GVFINELEMVRDVRLKGFLGGKADADKPKQAIYWRSQNTANALAGNLSGVDA 272

Query: 306 SYTGEYIR 313
            +    + 
Sbjct: 273 LFQASKLG 280


>gi|325137239|gb|EGC59833.1| putative lipoprotein [Neisseria meningitidis M0579]
          Length = 388

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 54/381 (14%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE+ LW                    
Sbjct: 227 -----------------------------TGFHRIEYALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++         K ++ 
Sbjct: 318 ---FRPLIEAKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L ++R  L L
Sbjct: 370 SINAL---AEDLAQLRGILGL 387


>gi|261401520|ref|ZP_05987645.1| protein YcdO [Neisseria lactamica ATCC 23970]
 gi|269208427|gb|EEZ74882.1| protein YcdO [Neisseria lactamica ATCC 23970]
          Length = 388

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 49/365 (13%), Positives = 106/365 (29%), Gaps = 127/365 (34%)

Query: 38  HAKYEDALM-CARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT 96
            A Y+  +    + L +  +T        ++E A+  +   R+ Y++ E           
Sbjct: 149 LADYKAYVQGEVKELVAKTKTFTEAVKAGDIEKAKSLFAATRVHYERIE----------- 197

Query: 97  WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR 156
                   P+ E F +       +E++  +                              
Sbjct: 198 --------PIAELFSELDPVIDAREDDFKDGAKDAGF----------------------- 226

Query: 157 KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYL 216
                        TG+H IE  LW                              + V  +
Sbjct: 227 -------------TGFHRIEHALWV----------------------------EKDVSGV 245

Query: 217 KVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGL 276
           K ++  L++D+E + K           ++   +  +             E+AG +++   
Sbjct: 246 KEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI------------EEVAGSKISG-- 291

Query: 277 ILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLA 336
                  E D +S    + +  +V G                        LI   N+ L 
Sbjct: 292 -------EEDRYSHTDLSDFQANVDGSKKIVDL--------------FRPLIEAKNKALL 330

Query: 337 QEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
           ++ +  F    +     + + +  E++D++    +    K ++  +N L    E L ++R
Sbjct: 331 EKTDTNFKQVNEILAKYRTK-DGFETYDKL----SEADRKALQAPVNAL---AEDLAQLR 382

Query: 397 IALDL 401
             L L
Sbjct: 383 GILGL 387


>gi|218767295|ref|YP_002341807.1| hypothetical protein NMA0281 [Neisseria meningitidis Z2491]
 gi|111075623|gb|ABH04982.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075625|gb|ABH04983.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075629|gb|ABH04985.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075633|gb|ABH04987.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075635|gb|ABH04988.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|121051303|emb|CAM07587.1| putative lipoprotein [Neisseria meningitidis Z2491]
 gi|254672531|emb|CBA06097.1| hypothetical protein NMW_0749 [Neisseria meningitidis alpha275]
 gi|325129195|gb|EGC52040.1| putative lipoprotein [Neisseria meningitidis N1568]
          Length = 388

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 54/381 (14%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE+ LW                    
Sbjct: 227 -----------------------------TGFHRIEYALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++         K ++ 
Sbjct: 318 ---FRPLIETKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L ++R  L L
Sbjct: 370 SINAL---AEDLAQLRGILGL 387


>gi|51596061|ref|YP_070252.1| hypothetical protein YPTB1726 [Yersinia pseudotuberculosis IP
           32953]
 gi|81825833|sp|Q66BP5|YCDO_YERPS RecName: Full=UPF0409 protein ycdO; Flags: Precursor
 gi|51589343|emb|CAH20965.1| putative exported protein [Yersinia pseudotuberculosis IP 32953]
          Length = 374

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 50/366 (13%), Positives = 97/366 (26%), Gaps = 127/366 (34%)

Query: 38  HAKYEDALMC-ARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT 96
            A+Y+  +      L S  +         +L  AR  +   R  Y++ E           
Sbjct: 135 IAEYKVYVTQEVAQLVSQTKAFTDAVKAGDLALARKLYAPTRQHYERIE----------- 183

Query: 97  WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR 156
                   P+ E F D   S   +E++                                 
Sbjct: 184 --------PIAELFSDLDGSIDAREDDFEQKSADPKF----------------------- 212

Query: 157 KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYL 216
                        TG+H +E +L+G +      +                          
Sbjct: 213 -------------TGFHRLEKILFGDNTTKGADKF------------------------- 234

Query: 217 KVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGL 276
              + +L  D  E+ K       A   +             G  +    E+A  +++   
Sbjct: 235 ---ADLLYQDTLELQKRIAGLTFAPNKV------------VGGAAGLIEEVAASKISG-- 277

Query: 277 ILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLA 336
                  E D +S      +  +V G                     +  L+   ++ L 
Sbjct: 278 -------EEDRYSRTDLWDFQANVDGAQKIVNL--------------LRPLLEKADKPLL 316

Query: 337 QEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
           Q+I+  F+         + + E  ES++++           ++  I  L    E L ++R
Sbjct: 317 QKIDANFNTVDSVLAKYRTK-EGYESYEKL----TDADRNAMKGPITAL---AEDLAQLR 368

Query: 397 IALDLI 402
             L L 
Sbjct: 369 GVLGLD 374


>gi|329965221|ref|ZP_08302151.1| Imelysin [Bacteroides fluxus YIT 12057]
 gi|328523241|gb|EGF50341.1| Imelysin [Bacteroides fluxus YIT 12057]
          Length = 383

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 60/173 (34%), Gaps = 30/173 (17%)

Query: 16  HALSIVPNVSLEKVLQNYATIA-HAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQW 74
              +I  N +L+ ++ NY  +     Y+D       L  A+  L   P+    E A   W
Sbjct: 238 DNSTINSNEALDPIVGNYVEVVVLPTYKDLKKKNNMLYDAVVALANNPSNSAFETACNAW 297

Query: 75  IRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIA 134
           I AR P+++SE + FG       D  +++WPLD+  I  + +S    +            
Sbjct: 298 ITAREPWEESEAFLFGPVDELGLDPNMDSWPLDQNAIVQILNSQKWSDL----------- 346

Query: 135 NSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTN 187
                             +       A         G+H +EFLL+       
Sbjct: 347 ------------------EWSEGDDDAKVESAQNVRGFHTLEFLLFKDGKPRT 381



 Score = 72.2 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/187 (12%), Positives = 57/187 (30%), Gaps = 24/187 (12%)

Query: 172 YHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMM 231
           ++     L      T   +  +    +         +      Y++ V+ +L +D   + 
Sbjct: 6   FYATALALGLAFTATACSDDDDNSTVNPADIEYNSENAASWHNYMRNVAALLKTDAANLY 65

Query: 232 KAWGPDGQATKDLM------------KDINAGLNSIITGMTSLSYNELAGERMNLGLILH 279
            +W    +                        +  +I G   +S NE+   ++      +
Sbjct: 66  DSWNTSYKGGASFATSFKAHNGAYNFSSAWNCIEQVIDGCVEIS-NEVGETKIGDPYNKY 124

Query: 280 DPEQE-------IDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNN 332
                          +S ++   Y N++  I ++Y G        K+   SI  L++  N
Sbjct: 125 MANNVIEALYAVESWYSWHSRDDYTNNIYSIRNAYYGSLDG----KVSDKSISKLVAGVN 180

Query: 333 RNLAQEI 339
             L  ++
Sbjct: 181 AELDTKV 187


>gi|121633912|ref|YP_974157.1| hypothetical protein NMC0012 [Neisseria meningitidis FAM18]
 gi|111075585|gb|ABH04963.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075587|gb|ABH04964.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075609|gb|ABH04975.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075613|gb|ABH04977.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075627|gb|ABH04984.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|120865618|emb|CAM09338.1| putative lipoprotein [Neisseria meningitidis FAM18]
 gi|325133195|gb|EGC55865.1| putative lipoprotein [Neisseria meningitidis M6190]
 gi|325139268|gb|EGC61812.1| putative lipoprotein [Neisseria meningitidis ES14902]
          Length = 388

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 54/381 (14%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE+ LW                    
Sbjct: 227 -----------------------------TGFHRIEYALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++         K ++ 
Sbjct: 318 ---FRPLIEAKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L ++R  L L
Sbjct: 370 SINAL---AEDLAQLRGILGL 387


>gi|330859498|emb|CBX69841.1| UPF0409 protein ycdO [Yersinia enterocolitica W22703]
          Length = 376

 Score = 98.1 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 48/366 (13%), Positives = 95/366 (25%), Gaps = 127/366 (34%)

Query: 38  HAKYEDALM-CARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT 96
            A+Y+  +      L +  +       K +L  AR  +   R  Y++ E           
Sbjct: 137 IAEYKVYVTHEVAQLVTQTKAFTDAVKKGDLALARKLYAPTRQHYERIE----------- 185

Query: 97  WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR 156
                   P+ E F D   S   +E++                                 
Sbjct: 186 --------PIAELFSDLDGSIDAREDDFEQKAADPKF----------------------- 214

Query: 157 KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYL 216
                        TG+H +E +L+G +      +                          
Sbjct: 215 -------------TGFHRLEKILFGDNTTKGADKF------------------------- 236

Query: 217 KVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGL 276
              +  L  D  E+ K       A   +             G  +    E+A  +++   
Sbjct: 237 ---ANQLYQDTLELQKRIAGLTFAPNKV------------VGGAAGLIEEVAASKISG-- 279

Query: 277 ILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLA 336
                  E D +S      +  +V G                     +  L+   ++ L 
Sbjct: 280 -------EEDRYSRTDLWDFQANVDGAQKIVNL--------------LRPLLEKADKPLL 318

Query: 337 QEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
            +I+  F          + + +  ES++++           ++  I  L    E L ++R
Sbjct: 319 DKIDANFKTVDSVLAKYRTK-DGYESYEKL----TDADRNAMKGPITAL---AEDLAQLR 370

Query: 397 IALDLI 402
             L L 
Sbjct: 371 GVLGLD 376


>gi|296314864|ref|ZP_06864805.1| protein YcdO [Neisseria polysaccharea ATCC 43768]
 gi|296838310|gb|EFH22248.1| protein YcdO [Neisseria polysaccharea ATCC 43768]
          Length = 388

 Score = 98.1 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 50/365 (13%), Positives = 105/365 (28%), Gaps = 127/365 (34%)

Query: 38  HAKYEDALM-CARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT 96
            A Y+  +    + L +  +T        ++E A+  +   R+ Y++ E           
Sbjct: 149 LANYKAYVQGEVKELVAKTKTFTEAVKAGDIEKAKSLFAATRVHYERIE----------- 197

Query: 97  WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR 156
                   P+ E F +       +E++  +                              
Sbjct: 198 --------PIAELFSELDPVIDAREDDFKDGAKDAGF----------------------- 226

Query: 157 KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYL 216
                        TG+H IE  LW                              + V  +
Sbjct: 227 -------------TGFHRIEHALWI----------------------------EKDVSGV 245

Query: 217 KVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGL 276
           K  +  L++D+E + K           ++   +  +             E+AG +++   
Sbjct: 246 KETAAKLMTDVEALQKEIDALAFPPGKVVGGASELI------------EEVAGSKISG-- 291

Query: 277 ILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLA 336
                  E D +S    + +  +V G                        LI   N+ L 
Sbjct: 292 -------EEDRYSHTDLSDFQANVDGSKKIVDL--------------FRPLIEAKNKALL 330

Query: 337 QEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
           ++ +  F    +     + + +  E++D++    +    K ++  IN L    E L ++R
Sbjct: 331 EKTDTNFKQVNEILAKYRTK-DGFETYDKL----SEADRKALQAPINAL---AEDLAQLR 382

Query: 397 IALDL 401
             L L
Sbjct: 383 GILGL 387


>gi|111075597|gb|ABH04969.1| 47 kDa lipoprotein [Neisseria meningitidis]
          Length = 388

 Score = 98.1 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 55/381 (14%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   RI 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRIH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE+ LW                    
Sbjct: 227 -----------------------------TGFHRIEYALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++         K ++ 
Sbjct: 318 ---FRPLIEAKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L ++R  L L
Sbjct: 370 SINAL---AEDLAQLRGILGL 387


>gi|293606597|ref|ZP_06688953.1| hypothetical protein HMPREF0004_4529 [Achromobacter piechaudii ATCC
           43553]
 gi|292814982|gb|EFF74107.1| hypothetical protein HMPREF0004_4529 [Achromobacter piechaudii ATCC
           43553]
          Length = 371

 Score = 98.1 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 41/382 (10%), Positives = 101/382 (26%), Gaps = 82/382 (21%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
             A       +  A  LD A+      P+          + +  + +   E+ RFG  + 
Sbjct: 49  DYARPAVTGMVDAAGALDGALGAWCAKPDAAGAARVADAYTQLALAWSGVEILRFGPLVQ 108

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
               +++  WP   G                              V  +++   I + D 
Sbjct: 109 ANRYERLAFWPDTRG------------------------------VMPRQVQQLIAAQDA 138

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
                 A    +    G   +E++L+G+          +  Y                  
Sbjct: 139 ALLAPGALAGRSVAVQGLPALEYVLYGEPALLKQVGAPDFAYA---------------CG 183

Query: 215 YLKVVSKILVSDLEEMMKAWGPDGQA---------TKDLMKDINAGLNSIITGMTSLSYN 265
           Y + V+  + +   ++ +AW P G             +L +D        +  + S    
Sbjct: 184 YARAVASNVSTISRDVAQAWSPQGDFGRQFAKPQAGNELYRDPQEIAAEAMKAL-STGLQ 242

Query: 266 ELAGERM----NLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
                ++            P++     S  +    + ++ G+ + Y              
Sbjct: 243 FARDVKIQPVLGDSPDAARPKRAAFWRSGLSTRLLVANLDGLKAFYQAGAYA-------- 294

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
                 +   N  +   +  +  +  +    +    E         +  + +G + +   
Sbjct: 295 ------LPAGNAWIDDSVRGELQSAAQALQAVPAPLEA--------ALQDEDGRRQLLLA 340

Query: 382 INDLITQTESLRK-IRIALDLI 402
              L      + + +  AL + 
Sbjct: 341 SLTLKNAKAIVDQDLAPALGVT 362


>gi|150398711|ref|YP_001329178.1| putative signal peptide protein [Sinorhizobium medicae WSM419]
 gi|150030226|gb|ABR62343.1| conserved hypothetical signal peptide protein [Sinorhizobium
           medicae WSM419]
          Length = 377

 Score = 98.1 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 48/391 (12%), Positives = 110/391 (28%), Gaps = 80/391 (20%)

Query: 1   MYFITIISIVFTLPSHALS--IVPNVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIET 57
           +  +  ++        ALS   V   ++  V+           Y D      +L  A   
Sbjct: 14  LSLVFALAPAAAQEEDALSPRAVNEAAVPSVMARAVDGFIIPGYRDLAEATNSLSDASAA 73

Query: 58  LVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSS 117
           L  +P+   L+ AR  +      +   E+ R G  +     ++   +P  +         
Sbjct: 74  LCKSPSDATLDVARSAFSSVVQAWSAIEIIRLGPALEQNRFERFLFYPDRKS-------- 125

Query: 118 YGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEF 177
                                    K++   +   D       +    +    G   +E 
Sbjct: 126 ----------------------TGRKQVQAILAKQDESATTAESLKGKSVAVQGLGALEL 163

Query: 178 LLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--- 234
           +L+G   +      G                   R  Y   VS+ L +   E +  W   
Sbjct: 164 VLYGNGAEILSSGSGGF-----------------RCRYGLAVSQNLRNIAGEFLAEWEKP 206

Query: 235 ------GPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGER--------MNLGLILHD 280
                       +  L +D       ++ G+   S   +  +R        ++       
Sbjct: 207 DGIQAAWKKPGTSNPLFRDNKEAATELL-GVLVHSVEMVKDQRLRPFYAGTIDGKPDKGR 265

Query: 281 PEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEIN 340
           P+  I   S NT  +   +   +   +              A + +L+  ++R++A  I+
Sbjct: 266 PKLAIYWRSVNTMPAISANFSALQRLFDT------------AGMEELLPADSRSIAGSID 313

Query: 341 DKFSNTMKDFHILKDRAENIESFDQMISENN 371
             F   +     ++   +   + ++  +  +
Sbjct: 314 FLFKALIAAADRMEGPVDAALADERQRATLD 344


>gi|311107739|ref|YP_003980592.1| imelysin [Achromobacter xylosoxidans A8]
 gi|310762428|gb|ADP17877.1| imelysin family protein 1 [Achromobacter xylosoxidans A8]
          Length = 362

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 43/382 (11%), Positives = 103/382 (26%), Gaps = 82/382 (21%)

Query: 35  TIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIV 94
             A       +  A  LD A+      P   +    +  +    + +   E  RFG  + 
Sbjct: 40  DYARPAVARMVDAASALDGALGRWCAQPGAADAARVQEAFENLALAWSGIEFLRFGPLVQ 99

Query: 95  DTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDL 154
               +++  WP   G                              V  K++   I + D 
Sbjct: 100 ANRYERLAFWPDTRG------------------------------VMPKQVQALIAAQDG 129

Query: 155 LRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVE 214
              +  A    +    G   +E++L+G+             Y                 +
Sbjct: 130 ALLVPGALAGRSVAVQGLPALEYVLYGEPALLRQDGGKVDAYA---------------CD 174

Query: 215 YLKVVSKILVSDLEEMMKAWGPDGQA---------TKDLMKDINAGLNSIITGMTSLSYN 265
           Y + V+  +     ++ +AW  +G             DL +D        +  + S    
Sbjct: 175 YARAVAANVRQITRDVAQAWSAEGDFGRQFAQPKAGNDLYRDQQEVAAEAMKSL-STGLQ 233

Query: 266 ELAGERM----NLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHG 321
                ++            P++     S  +      ++ G+ + Y              
Sbjct: 234 FARDVKILPVLGETPEAARPKRAAFWRSQLSTRLLAANLDGLQAFYQAGAYA-------- 285

Query: 322 ASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNL 381
                 +   +  +A+ +  + ++  +    +    E      Q +++ +  G + +   
Sbjct: 286 ------LPKGDAWMAESVRGELASAARTLQAVPVPLE------QALAQED--GRRQLTLA 331

Query: 382 INDLITQTESL-RKIRIALDLI 402
              L      +   +  AL + 
Sbjct: 332 ALTLKNAKAIVDENLAPALGVT 353


>gi|294788009|ref|ZP_06753253.1| protein YcdO [Simonsiella muelleri ATCC 29453]
 gi|294484302|gb|EFG31985.1| protein YcdO [Simonsiella muelleri ATCC 29453]
          Length = 387

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 53/387 (13%), Positives = 104/387 (26%), Gaps = 133/387 (34%)

Query: 16  HALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWI 75
              +      L + L  Y              A  L    +          LE A+  + 
Sbjct: 134 DTAAESDLEKLAQPLTEYKKYVQ-------NEAAELVKLTKQFTDAVKANQLEKAQSLFA 186

Query: 76  RARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIAN 135
           +AR PY++ E                   P+ E F +   S   +E++        +   
Sbjct: 187 KARAPYERIE-------------------PIAELFNELDPSIDAREDDFKAGAKDELF-- 225

Query: 136 SKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRP 195
                                             TG+H IE+ LW +             
Sbjct: 226 ----------------------------------TGFHKIEYALWVEKDTKA-------- 243

Query: 196 YTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSI 255
                               +  ++  L +D+E++ K           +           
Sbjct: 244 --------------------VHAIADKLQADVEKLQKEIDTLNFPPSKV----------- 272

Query: 256 ITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMN 315
             G  ++   E+A  +++          E D +S    + +  ++ G             
Sbjct: 273 -VGGAAVLIEEVAASKISG---------EEDRYSHTDLSDFYANMEGAQKIIQL------ 316

Query: 316 GEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGN 375
                       I   +++L   I+ +F          K  A+  +++D++    +    
Sbjct: 317 --------FRANIEAKDKDLLAVIDKQFKAVGDILAKYKT-ADGFQTYDKL----SEADR 363

Query: 376 KIVRNLINDLITQTESLRKIRIALDLI 402
           K ++  IN L    E L K+R  L L 
Sbjct: 364 KALQAPINSL---AEDLAKLRGLLGLD 387


>gi|254669656|emb|CBA03732.1| hypothetical protein NME_0216 [Neisseria meningitidis alpha153]
          Length = 388

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 54/381 (14%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE+ LW                    
Sbjct: 227 -----------------------------TGFHRIEYALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++         K ++ 
Sbjct: 318 ---FRPLIETKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L ++R  L L
Sbjct: 370 SINAL---AEDLAQLRGILGL 387


>gi|261379194|ref|ZP_05983767.1| protein YcdO [Neisseria cinerea ATCC 14685]
 gi|269144331|gb|EEZ70749.1| protein YcdO [Neisseria cinerea ATCC 14685]
          Length = 388

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 53/381 (13%), Positives = 110/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTDAVKAGDIEKAKSLFAATRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE  LW                    
Sbjct: 227 -----------------------------TGFHRIEHALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K          +++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGNVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++    +    K ++ 
Sbjct: 318 ---FRPLIEAKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----SEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            +N L    E L ++R  L L
Sbjct: 370 PVNAL---AEDLAQLRGILGL 387


>gi|238764876|ref|ZP_04625816.1| hypothetical protein ykris0001_37910 [Yersinia kristensenii ATCC
           33638]
 gi|238696895|gb|EEP89672.1| hypothetical protein ykris0001_37910 [Yersinia kristensenii ATCC
           33638]
          Length = 374

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 50/394 (12%), Positives = 100/394 (25%), Gaps = 133/394 (33%)

Query: 9   IVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLE 68
           +  T  S   +    ++L   +  Y                 L +  +       K +L 
Sbjct: 114 LTVTAGSDTATKPDAMALVGPIAEYKVYVT-------QEVAQLVTQTKAFTDAVKKGDLA 166

Query: 69  NARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY 128
            AR  +   R  Y++ E                   P+ E F D   S   +E++     
Sbjct: 167 LARKLYAPTRQHYERIE-------------------PIAELFSDLDGSIDAREDDFEQKA 207

Query: 129 TANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNV 188
                                                    TG+H +E +L+G +     
Sbjct: 208 ADPKF------------------------------------TGFHRLEKILFGDNTTKGA 231

Query: 189 REPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDI 248
            +                             +  L  D  E+ K       A   +    
Sbjct: 232 DKF----------------------------ADQLYQDTLELQKRITGLTFAPNKV---- 259

Query: 249 NAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYT 308
                    G  +    E+A  +++          E D +S      +  +V G      
Sbjct: 260 --------VGGAAGLIEEVAASKISG---------EEDRYSRTDLWDFQANVDGAQKIVN 302

Query: 309 GEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMIS 368
                          +  L+   ++ L  +I+  F+         + + +  ES++++  
Sbjct: 303 L--------------LRPLLEKADKPLLDKIDANFTTVDSILAKYRTK-DGYESYEKL-- 345

Query: 369 ENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
                    ++  I  L    E L ++R  L L 
Sbjct: 346 --TDADRNAMKGPITAL---AEDLAQLRGVLGLD 374


>gi|329767970|ref|ZP_08259481.1| hypothetical protein HMPREF0428_01178 [Gemella haemolysans M341]
 gi|328838455|gb|EGF88063.1| hypothetical protein HMPREF0428_01178 [Gemella haemolysans M341]
          Length = 310

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 54/355 (15%), Positives = 100/355 (28%), Gaps = 124/355 (34%)

Query: 46  MCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWP 105
               TL    E    T    NLE A+ Q+   R+ Y++SE            +  VN   
Sbjct: 76  NQVDTLLKDTEKFAETIKAGNLEEAKKQYPLIRMAYERSE-----PIAESFGELDVN--- 127

Query: 106 LDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGID 165
                ID+  + Y +EN+  +                                       
Sbjct: 128 -----IDFRLADYLEENKTEDG-------------------------------------- 144

Query: 166 TNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVS 225
                G+H IE ++W ++      E                             +  LV 
Sbjct: 145 ---WRGFHRIEKIMWEKNTTKGTEEY----------------------------ADQLVK 173

Query: 226 DLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEI 285
           D++E+             ++      LN            E+A +++           E 
Sbjct: 174 DVKELKAKVATVEVTPDLMVTGAVDLLN------------EVATQKITG---------EE 212

Query: 286 DCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSN 345
           + FS      +  ++ G    +                   LI   +  LA+++ +KF+ 
Sbjct: 213 EIFSHTDLYDFKANIEGAEEIF--------------KIFKPLIEKKDSKLAKDLVEKFAT 258

Query: 346 TMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALD 400
                   K   +N + +  +  EN  E ++ V           E L ++ + LD
Sbjct: 259 INSLLDKYKTDDKNYKLYTDLTKENTKELSEAV-------TKLGEPLSQMGVILD 306


>gi|295396567|ref|ZP_06806724.1| PbrT family lead (Pb2+) uptake porter [Brevibacterium mcbrellneri
           ATCC 49030]
 gi|294970582|gb|EFG46500.1| PbrT family lead (Pb2+) uptake porter [Brevibacterium mcbrellneri
           ATCC 49030]
          Length = 416

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 48/383 (12%), Positives = 101/383 (26%), Gaps = 94/383 (24%)

Query: 18  LSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRA 77
           +S       +K +++Y                 L+  +        K + E AR  +   
Sbjct: 128 VSGEDKELFDKAVKDYIAFVK-------NEVAELEPKVGEFADAYAKGDDEQARKLYATT 180

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
           R  Y++ E       ++D               IDY +  Y  E +              
Sbjct: 181 RTHYERIEPIAEALGVLDPR-------------IDYREVDYLAEADILKKDDPTF----- 222

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYT 197
                                            G+H +E  L+        +   N    
Sbjct: 223 -----------------------------TEWLGFHRMEKDLF-----PPKKGDKNADGA 248

Query: 198 DFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIIT 257
           D   G        R+      ++  L  D+ ++ +    D       ++D    + ++  
Sbjct: 249 DAFDGWKPSSPGDRKR-----IADTLKEDVHKLRETVDADN-----FIEDQQINIATVAN 298

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
           G  S    E+A  ++           E D +S      +  +V G   ++         +
Sbjct: 299 G-ASGLLEEVAVSKVTG---------EEDWWSHTDLYDFAANVEGSKIAFDLVKPIAERK 348

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKI 377
              G             L ++I  ++    K      +  +   S+D        E    
Sbjct: 349 GSEG-----------EQLVKDIEQEYGELNKLLGKYGNLDKGFVSYD----TVTAEQQAE 393

Query: 378 VRNLINDLITQTESLRKIRIALD 400
           + + I++L      L    + + 
Sbjct: 394 LTHQIDELREPLSKLTGTVLEIK 416


>gi|238798553|ref|ZP_04642030.1| hypothetical protein ymoll0001_16680 [Yersinia mollaretii ATCC
           43969]
 gi|238717573|gb|EEQ09412.1| hypothetical protein ymoll0001_16680 [Yersinia mollaretii ATCC
           43969]
          Length = 366

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 50/366 (13%), Positives = 96/366 (26%), Gaps = 127/366 (34%)

Query: 38  HAKYEDALMC-ARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT 96
            A+Y+  +      L +  +       K +L  AR  +   R  Y++ E           
Sbjct: 127 IAEYKVYVTQEVAQLVTQTKAFTDAVKKGDLALARKLYAPTRQHYERIE----------- 175

Query: 97  WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR 156
                   P+ E F D   S   +E++                                 
Sbjct: 176 --------PIAELFSDLDGSIDAREDDFEQKAADPKF----------------------- 204

Query: 157 KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYL 216
                        TG+H +E +L+G +      +                          
Sbjct: 205 -------------TGFHRLEKILFGDNTTKGADKF------------------------- 226

Query: 217 KVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGL 276
              +  L  D  E+ K       A   +             G  +    E+A  +++   
Sbjct: 227 ---ADQLYLDTLELQKRITGLTFAPNKV------------VGGAAGLIEEVAASKISG-- 269

Query: 277 ILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLA 336
                  E D +S      +  +V G                     +  L+   ++ L 
Sbjct: 270 -------EEDRYSRTDLWDFQANVDGAQKIVNL--------------LRPLLEKADKPLL 308

Query: 337 QEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
           Q+I+  F          + + E  ES++++           ++  I  L    E L ++R
Sbjct: 309 QKIDANFKTVDGVLAKYRTK-EGYESYEKL----TDADRNAMKGPITAL---AEDLAQLR 360

Query: 397 IALDLI 402
             L L 
Sbjct: 361 GVLGLD 366


>gi|170024590|ref|YP_001721095.1| hypothetical protein YPK_2365 [Yersinia pseudotuberculosis YPIII]
 gi|169751124|gb|ACA68642.1| conserved hypothetical protein [Yersinia pseudotuberculosis YPIII]
          Length = 376

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 51/396 (12%), Positives = 101/396 (25%), Gaps = 133/396 (33%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           +++       A      ++L   +  Y                 L S  +         +
Sbjct: 114 LTVTVAAGEQAPVKPDAMALVGPIAEYKVYVT-------QEVAQLVSQTKAFTDAVKAGD 166

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  +   R  Y++ E                   P+ E F D   S   +E++   
Sbjct: 167 LALARKLYAPTRQHYERIE-------------------PIAELFSDLDGSIDAREDDFEQ 207

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
                                                      TG+H +E +L+G +   
Sbjct: 208 KSADPKF------------------------------------TGFHRLEKILFGDNTTK 231

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
              +                             + +L  D  E+ K       A   +  
Sbjct: 232 GADKF----------------------------ADLLYQDTLELQKRIAGLTFAPNKV-- 261

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
                      G  +    E+A  +++          E D +S      +  +V G    
Sbjct: 262 ----------VGGAAGLIEEVAASKISG---------EEDRYSRTDLWDFQANVDGAQKI 302

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
                            +  L+   ++ L Q+I+  F+         + + E  ES++++
Sbjct: 303 VNL--------------LRPLLEKADKPLLQKIDANFNTVDSVLAKYRTK-EGYESYEKL 347

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
                      ++  I  L    E L ++R  L L 
Sbjct: 348 ----TDADRSAMKGPITAL---AEDLAQLRGVLGLD 376


>gi|319441153|ref|ZP_07990309.1| hypothetical protein CvarD4_05222 [Corynebacterium variabile DSM
           44702]
          Length = 364

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 57/378 (15%), Positives = 100/378 (26%), Gaps = 129/378 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
             + +L   ++ +                 L    +T V      +LE A+  +   RI 
Sbjct: 111 EGSDTLTAAVEGHLRYVR-------SQTTALQEQTDTFVQAIQDGDLETAKPLFAPTRIY 163

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F D                            
Sbjct: 164 YERIE-------------------PIAESFPD---------------------------- 176

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                       D    L  A+  D    TG+H IE  LW                    
Sbjct: 177 ----------DLDPRIDLRDADLEDGQEWTGFHRIEKDLWEGG----------------- 209

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     R  E  K  +  L  D+ E++     D                 +I   T
Sbjct: 210 ----------RITEQTKKDADQLSEDIAELVDGVNTDDFTVA----------PDLIANGT 249

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
               +E++  ++           E D FS      +  ++              +G K  
Sbjct: 250 HGLLDEISTSKITG---------EEDIFSHTDLWDFQANL--------------DGSKAA 286

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
            AS+ D I   + +L  +IN KF    +     +D  +    +D        +  K +  
Sbjct: 287 VASLEDAIDEKDADLLADINAKFDAVQELLDTFRD-GDGFVYYD----TVGEDDRKKLST 341

Query: 381 LINDLITQTESLRKIRIA 398
           +++ L  Q   +  +  A
Sbjct: 342 VLDQLNEQVSKVTGVITA 359


>gi|111075591|gb|ABH04966.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075595|gb|ABH04968.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075599|gb|ABH04970.1| 47 kDa lipoprotein [Neisseria meningitidis]
          Length = 388

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 55/381 (14%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   RI 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRIH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE+ LW                    
Sbjct: 227 -----------------------------TGFHRIEYALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++         K ++ 
Sbjct: 318 ---FRPLIEAKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L ++R  L L
Sbjct: 370 SINAL---AEDLAQLRGILGL 387


>gi|318605300|emb|CBY26798.1| ferrous iron transport periplasmic protein EfeO,contains
           peptidase-M75 domain and (frequently) cupredoxin-like
           domain [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 376

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 48/366 (13%), Positives = 95/366 (25%), Gaps = 127/366 (34%)

Query: 38  HAKYEDALMC-ARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDT 96
            A+Y+  +      L +  +       K +L  AR  +   R  Y++ E           
Sbjct: 137 IAEYKVYVTQEVAQLVTQTKAFTDAVKKGDLALARKLYAPTRQHYERIE----------- 185

Query: 97  WDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLR 156
                   P+ E F D   S   +E++                                 
Sbjct: 186 --------PIAELFSDLDGSIDAREDDFEQKAADPKF----------------------- 214

Query: 157 KLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYL 216
                        TG+H +E +L+G +      +                          
Sbjct: 215 -------------TGFHRLEKILFGDNTTKGADKF------------------------- 236

Query: 217 KVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGL 276
              +  L  D  E+ K       A   +             G  +    E+A  +++   
Sbjct: 237 ---ANQLYQDTLELQKRIAGLTFAPNKV------------VGGAAGLIEEVAASKISG-- 279

Query: 277 ILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLA 336
                  E D +S      +  +V G                     +  L+   ++ L 
Sbjct: 280 -------EEDRYSRTDLWDFQANVDGAQKIVNL--------------LRPLLEKADKPLL 318

Query: 337 QEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIR 396
            +I+  F          + + +  ES++++           ++  I  L    E L ++R
Sbjct: 319 DKIDANFKTVDSVLAKYRTK-DGYESYEKL----TDADRNAMKGPITAL---AEDLAQLR 370

Query: 397 IALDLI 402
             L L 
Sbjct: 371 GVLGLD 376


>gi|111075589|gb|ABH04965.1| 47 kDa lipoprotein [Neisseria meningitidis]
 gi|111075621|gb|ABH04981.1| 47 kDa lipoprotein [Neisseria meningitidis]
          Length = 388

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 54/381 (14%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   RI 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFAATRIH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE  LW                    
Sbjct: 227 -----------------------------TGFHRIEHALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMADVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++    +    K ++ 
Sbjct: 318 ---FRPLIEAKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----SEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            +N L    E L ++R  L L
Sbjct: 370 PVNAL---AEDLAQLRGILGL 387


>gi|118579243|ref|YP_900493.1| periplasmic lipoprotein-like protein [Pelobacter propionicus DSM
           2379]
 gi|118501953|gb|ABK98435.1| periplasmic lipoprotein-like protein [Pelobacter propionicus DSM
           2379]
          Length = 355

 Score = 97.7 bits (241), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 50/387 (12%), Positives = 110/387 (28%), Gaps = 89/387 (22%)

Query: 29  VLQNYAT-IAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVY 87
           VL + AT +      +    AR L  +   +    +   L  A+  W +A   +++S  +
Sbjct: 37  VLASLATGVIRPSLTELADTARKLADSSRRMCQRRDMAGLTAAQDDWRKASAAWRRSVPF 96

Query: 88  RFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDL 147
           +FG       ++++   P  E  ++        ++      T                  
Sbjct: 97  QFGPAA--NLERRLGG-PTQETVLEAAVRDDRMQHLRTGKET------------------ 135

Query: 148 SIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGG 207
                                  GY  +E+LL+           G               
Sbjct: 136 ----------------------RGYAAVEYLLFAPAGAAAATAGG--------------- 158

Query: 208 HCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKD-------INAGLNSIITGMT 260
               R E+L+ V+  + +      +     G   + +              L+ I+    
Sbjct: 159 ----RCEHLRDVTAEIAAVTSR-AEQEWDKGYGREFVAAGDGKPFLVPGDALSLILARTL 213

Query: 261 SLSYNELAGERMNLG----LILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNG 316
           +     L    + +          PE      S  T  ++   + G+  S  G     + 
Sbjct: 214 NSIETVLRDG-IGVPGGIFTGRPRPELFYGRRSATTREAFQATLEGLNRSLLG---GGSA 269

Query: 317 EKIHGASIHD-LISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGN 375
             ++  +  D L+S  N  LA  I  +          L             +  +  + +
Sbjct: 270 SIVNLVATRDGLVSRKNPALAAGIRRQLEIIGNTIAKLDAAD---------LGSHGGKPS 320

Query: 376 KIVRNLINDLITQTESLRKIRIALDLI 402
           + ++ L + +    + L +  + L+L 
Sbjct: 321 RRLKRLYDGMEKLQKQLVEATLVLELD 347


>gi|111075637|gb|ABH04989.1| 47 kDa lipoprotein [Neisseria meningitidis]
          Length = 388

 Score = 97.3 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 53/381 (13%), Positives = 108/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDIEKAKSLFADTRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFSELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE+ LW                    
Sbjct: 227 -----------------------------TGFHRIEYALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++           ++ 
Sbjct: 318 ---FRPLIEAKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----GEADRTALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            IN L    E L ++R  L L
Sbjct: 370 SINAL---AEDLAQLRGILGL 387


>gi|111075639|gb|ABH04990.1| 47 kDa lipoprotein [Neisseria lactamica]
          Length = 388

 Score = 97.3 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 53/381 (13%), Positives = 109/381 (28%), Gaps = 130/381 (34%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
                LEK+ Q  A      Y       + L +  +T        ++E A+  +   R+ 
Sbjct: 137 ANEADLEKLSQPLADY--KAYVQ--GEVKELVAKTKTFTEAVKAGDMEKAKSLFAATRVH 192

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           Y++ E                   P+ E F +       +E++  +              
Sbjct: 193 YERIE-------------------PIAELFNELDPVIDAREDDFKDGAKDAGF------- 226

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                                        TG+H IE  LW                    
Sbjct: 227 -----------------------------TGFHRIEHALWV------------------- 238

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                     + V  +K ++  L++D+E + K           ++   +  +        
Sbjct: 239 ---------EKDVSGVKEIAAKLMADVEALQKEIDALAFPPGKVVGGASELI-------- 281

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
                E+AG +++          E D +S    + +  +V G                  
Sbjct: 282 ----EEVAGSKISG---------EEDRYSHTDLSDFQANVDGSKKIVDL----------- 317

Query: 321 GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRN 380
                 LI   N+ L ++ +  F    +     + + +  E++D++    +    K ++ 
Sbjct: 318 ---FRPLIEAKNKALLEKTDTNFKQVNEILAKYRTK-DGFETYDKL----SEADRKALQA 369

Query: 381 LINDLITQTESLRKIRIALDL 401
            +N L    E L ++R  L L
Sbjct: 370 PVNAL---AEDLAQLRGILGL 387


>gi|218704436|ref|YP_002411955.1| hypothetical protein ECUMN_1202 [Escherichia coli UMN026]
 gi|293404315|ref|ZP_06648309.1| hypothetical protein ECGG_02706 [Escherichia coli FVEC1412]
 gi|298380094|ref|ZP_06989699.1| hypothetical protein ECFG_02900 [Escherichia coli FVEC1302]
 gi|300899533|ref|ZP_07117773.1| imelysin [Escherichia coli MS 198-1]
 gi|331662428|ref|ZP_08363351.1| protein YcdO [Escherichia coli TA143]
 gi|218431533|emb|CAR12411.1| ferrous iron transport binding protein [Escherichia coli UMN026]
 gi|284920853|emb|CBG33916.1| putative exported protein [Escherichia coli 042]
 gi|291428901|gb|EFF01926.1| hypothetical protein ECGG_02706 [Escherichia coli FVEC1412]
 gi|298279792|gb|EFI21300.1| hypothetical protein ECFG_02900 [Escherichia coli FVEC1302]
 gi|300356894|gb|EFJ72764.1| imelysin [Escherichia coli MS 198-1]
 gi|331060850|gb|EGI32814.1| protein YcdO [Escherichia coli TA143]
          Length = 375

 Score = 97.3 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 44/383 (11%), Positives = 93/383 (24%), Gaps = 126/383 (32%)

Query: 20  IVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
              + +    L +      A     +     L +  +         ++E A+  +   R 
Sbjct: 119 ATADAAQSDALLSLGDAITAYKAYVMAETTQLVTDTKAFTDAIKAGDIEKAKALYAPTRQ 178

Query: 80  PYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKII 139
            Y++ E                   P+ E F D   S   +E++                
Sbjct: 179 HYERIE-------------------PIAELFSDLDGSIDAREDDYEQKAADPKF------ 213

Query: 140 VNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDF 199
                                         TG+H +E  L+G +                
Sbjct: 214 ------------------------------TGFHRLEKALFGDNTTKG------------ 231

Query: 200 DIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGM 259
                           +   +  L SD+ ++ K           +             G 
Sbjct: 232 ----------------MDQYADQLYSDVVDLQKRISELAFPPSKV------------VGG 263

Query: 260 TSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
            +    E+A  +++          E D +S      +  +V G                 
Sbjct: 264 AAGLIEEVAASKISG---------EEDRYSHTDLWDFQANVEGSQKIVDL---------- 304

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVR 379
               +   +   N  L  +++  F          + +    E++D++           ++
Sbjct: 305 ----LRPQLQKANPELLAKVDANFKKVDTILAKYRTKG-GFETYDKL----TDADRNALK 355

Query: 380 NLINDLITQTESLRKIRIALDLI 402
             I  L    E L ++R  L L 
Sbjct: 356 GPITAL---AEDLAQLRGVLGLD 375


>gi|296876537|ref|ZP_06900588.1| lipoprotein [Streptococcus parasanguinis ATCC 15912]
 gi|296432530|gb|EFH18326.1| lipoprotein [Streptococcus parasanguinis ATCC 15912]
          Length = 310

 Score = 97.3 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 61/383 (15%), Positives = 105/383 (27%), Gaps = 129/383 (33%)

Query: 21  VPNVSLEKVLQNYATIAHAKYEDALM-CARTLDSAIETLVTTPNKKNLENARLQWIRARI 79
              V L K  Q     A A+Y+D +      L    E    T    NLE A+ Q+   R+
Sbjct: 52  SSTVQLSKADQKTLDNATAEYKDFVEMQIDQLLKDTEGFRDTLKAGNLEEAKKQYPLIRM 111

Query: 80  PYQQSEVYR--FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSK 137
            Y++SE     FG   V                IDY    Y  EN+              
Sbjct: 112 AYERSEPIAETFGESDV---------------KIDYRLVDYVDENKSEEG---------- 146

Query: 138 IIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYT 197
                                           +G+H IE +LW ++      +       
Sbjct: 147 -------------------------------WSGFHRIERILWEKNTTDGTEKY------ 169

Query: 198 DFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIIT 257
                                 +  LV+D++E+             ++      LN    
Sbjct: 170 ----------------------ADQLVNDIKELKAKIATVDVTPDVMLTGAVDLLN---- 203

Query: 258 GMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGE 317
                   E+A +++           E + FS      +  ++ G    ++         
Sbjct: 204 --------EVATQKITG---------EEEVFSHTDLYDFRANIEGAEKIFSL-------- 238

Query: 318 KIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKI 377
                    LI   +  L + +  +F N             N +S+  +  E+  E  + 
Sbjct: 239 ------FKPLIEKKDAKLVKTLEAEFKNVNALLDKHMTGDSNYKSYTDLSKEDTKELAEA 292

Query: 378 VRNLINDLITQTESLRKIRIALD 400
           V           E L ++ + LD
Sbjct: 293 V-------TKLGEPLSQMGVILD 308


>gi|222084584|ref|YP_002543113.1| hypothetical protein Arad_0519 [Agrobacterium radiobacter K84]
 gi|221722032|gb|ACM25188.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 373

 Score = 97.3 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 50/402 (12%), Positives = 110/402 (27%), Gaps = 84/402 (20%)

Query: 14  PSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQ 73
                + VP V  + +      +    Y      A  L +A++ L   P+  +L  A+  
Sbjct: 34  AGLNEAAVPGVMQKAI----DDVIRPGYRAVHDSASKLTTAMKALCADPSAASLSAAQSA 89

Query: 74  WIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANII 133
           +      + + E+ + G  I     + +  +P  +G                        
Sbjct: 90  FGDTVKSWSRIEIVQTGPIIEKNRFEHILFYPDRKG------------------------ 125

Query: 134 ANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGN 193
                 V  K++   I   D       A    +        +E++L+G            
Sbjct: 126 ------VGLKQVQALIAKADEHDTTVEAVAGKSVALMSMTALEYVLYGNGS--------- 170

Query: 194 RPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLN 253
                      +      R  Y   ++  + +  +E+   W       K           
Sbjct: 171 --------SVLSSEKQGFRCRYGAAIAGNIENVSKEIADEWDDPNGVQKSWKNPGKDSEE 222

Query: 254 SI--------ITGMTSLSYNELAGERMNLGL----ILHDPEQEIDCFSDNTYASYLNDVI 301
            +        + G+       +  +R+            P+  I   S NT+ S   ++ 
Sbjct: 223 FMDNKEAVTALLGILVHGAGNVRDQRLETFYKGDPAAARPKMAIYWRSGNTWTSLTANLE 282

Query: 302 GIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIE 361
           G+ + +              A + DL+  + R++A +I+      +     +    +   
Sbjct: 283 GLKALW------------EKAGMADLLPADKRDMAGKIDALLDKLIATAPTINPDIDAAI 330

Query: 362 SFDQMISENNPEGNKIVRNLINDLITQTESL-RKIRIALDLI 402
           + D             +  L+ D    T         A+ L 
Sbjct: 331 ASD--------ADRAKIDRLLADTRDLTTGFSDNYGGAIGLS 364


>gi|238788355|ref|ZP_04632149.1| hypothetical protein yfred0001_8050 [Yersinia frederiksenii ATCC
           33641]
 gi|238723601|gb|EEQ15247.1| hypothetical protein yfred0001_8050 [Yersinia frederiksenii ATCC
           33641]
          Length = 376

 Score = 97.3 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 51/396 (12%), Positives = 101/396 (25%), Gaps = 133/396 (33%)

Query: 7   ISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKN 66
           +++     S A      ++L   +  Y                 L +  +       K +
Sbjct: 114 LTVTAAAGSDAAMKPDAMALVGPIAEYKVYVT-------QEVAQLVTQTKAFTDAVKKGD 166

Query: 67  LENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENN 126
           L  AR  +   R  Y++ E                   P+ E F D   S   +E++   
Sbjct: 167 LALARKLYAPTRQHYERIE-------------------PIAELFSDLDGSIDAREDDFEQ 207

Query: 127 LYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKT 186
                                                      TG+H +E +L+G +   
Sbjct: 208 KAADPKF------------------------------------TGFHRLEKILFGDNTTK 231

Query: 187 NVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMK 246
              +                             +  L  D  E+ K       A   +  
Sbjct: 232 GADKF----------------------------ADTLYQDTLELQKRISGLTFAPSKV-- 261

Query: 247 DINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISS 306
                      G  +    E+A  +++          E D +S      +  +V G    
Sbjct: 262 ----------VGGAAGLIEEVAASKISG---------EEDRYSRTDLWDFQANVDGAQKI 302

Query: 307 YTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQM 366
                            +  L+   N+ L ++I+  F          + + +  ES++++
Sbjct: 303 VNL--------------LRPLLEKANKPLLEKIDTNFKTVDSILAKYRTK-DGYESYEKL 347

Query: 367 ISENNPEGNKIVRNLINDLITQTESLRKIRIALDLI 402
                      ++  I  L    E L ++R  L L 
Sbjct: 348 ----TDADRTAMKGPITAL---AEDLAQLRGLLGLD 376


>gi|309812111|ref|ZP_07705869.1| Imelysin [Dermacoccus sp. Ellin185]
 gi|308433798|gb|EFP57672.1| Imelysin [Dermacoccus sp. Ellin185]
          Length = 381

 Score = 97.3 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 44/377 (11%), Positives = 91/377 (24%), Gaps = 116/377 (30%)

Query: 22  PNVSLEKVLQNYATIAHAKYEDAL-MCARTLDSAIETLVTTPNKKNLENARLQWIRARIP 80
            +++     +     A  +Y+  +   A  L +   T V          AR  + +AR+ 
Sbjct: 119 ADLTPTGADKALVDEADKQYQAYVKDQATQLSAQTTTFVNLYKSGKDAEARALYAKARLH 178

Query: 81  YQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIV 140
           +++ E                   P+ E F D                            
Sbjct: 179 WERVE-------------------PVAESFGDLDPKM----------------------- 196

Query: 141 NEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFD 200
                            L  A+       TG+H IE  LW             R      
Sbjct: 197 ----------------DLREADLEKGQEWTGWHRIEKDLWPPKSGYTAMSKTER------ 234

Query: 201 IGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMT 260
                             ++  L+SD +               +     + +        
Sbjct: 235 ----------------NKIADQLLSDTKTFETRTKTTTFTADKIANGAKSLM-------- 270

Query: 261 SLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH 320
               +E+A  ++           E + +S      +  +V G   ++             
Sbjct: 271 ----DEVATGKVTG---------EEEIWSHTDLYDFQGNVDGARIAWEN----------- 306

Query