RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780635|ref|YP_003065048.1| hypothetical protein
CLIBASIA_02610 [Candidatus Liberibacter asiaticus str. psy62]
         (412 letters)



>2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase
           class II, ligase; 3.23A {Methanococcus maripaludis S2}
           (C:359-648)
          Length = 290

 Score = 29.4 bits (66), Expect = 0.81
 Identities = 20/121 (16%), Positives = 40/121 (33%), Gaps = 44/121 (36%)

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNA-----WPLDEGFIDYVDSSYGK----------EN 122
           ++P    E+Y    +++++  K  +        +++ F       +GK          E 
Sbjct: 22  KVP-VMDEIYDLTKELIESCVKNKDLKSPCELAIEKTFS------FGKTKKNVKINIFEK 74

Query: 123 EENN------------LYTANI--IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNI 168
           EE              +Y  N+  I  S   V E+  D          +  ++ G+ T I
Sbjct: 75  EEGKNLLGPSILNEIYVYDGNVIGIPESFDGVKEEFKD--------FLEKGKSEGVATGI 126

Query: 169 T 169
            
Sbjct: 127 R 127


>2odr_D Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase
           class II, ligase; 3.23A {Methanococcus maripaludis S2}
           (D:363-647)
          Length = 285

 Score = 29.4 bits (66), Expect = 0.94
 Identities = 20/121 (16%), Positives = 40/121 (33%), Gaps = 44/121 (36%)

Query: 78  RIPYQQSEVYRFGNKIVDTWDKKVNA-----WPLDEGFIDYVDSSYGK----------EN 122
           ++P    E+Y    +++++  K  +        +++ F       +GK          E 
Sbjct: 18  KVP-VMDEIYDLTKELIESCVKNKDLKSPCELAIEKTFS------FGKTKKNVKINIFEK 70

Query: 123 EENN------------LYTANI--IANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNI 168
           EE              +Y  N+  I  S   V E+  D          +  ++ G+ T I
Sbjct: 71  EEGKNLLGPSILNEIYVYDGNVIGIPESFDGVKEEFKD--------FLEKGKSEGVATGI 122

Query: 169 T 169
            
Sbjct: 123 R 123


>2qne_A Putative methyltransferase; ZP_00558420.1, structural
           genomics, joint center for structural genomics, JCSG;
           HET: MSE; 2.30A {Desulfitobacterium hafniense Y51}
           (A:1-113,A:182-365,A:472-495)
          Length = 321

 Score = 27.8 bits (62), Expect = 2.9
 Identities = 16/98 (16%), Positives = 29/98 (29%), Gaps = 14/98 (14%)

Query: 144 EIDLSIISPDLLRKLHRANGI--DTNITTGYHVIE---------FLLWGQDLKTNVREPG 192
           EI +       L    R         +      +E         F L  ++ + NV   G
Sbjct: 45  EIGIEFEYEPALEVFRREGQKVEGKRVYLTREFVESKLKSAPAEFTLHARNPENNVVIGG 104

Query: 193 NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEM 230
           +        G+  G   + R E    ++ IL    + +
Sbjct: 105 DNIVFXPGYGSAEG---KERAEDSVEIAAILFGGKDVI 139


>3g4d_A (+)-delta-cadinene synthase isozyme XC1; cyclase, lyase,
           magnesium, metal-binding; 2.40A {Gossypium arboreum}
           PDB: 3g4f_A* (A:107-206)
          Length = 100

 Score = 27.4 bits (61), Expect = 3.0
 Identities = 13/53 (24%), Positives = 27/53 (50%), Gaps = 7/53 (13%)

Query: 295 SYLNDVIGIISSYTGEYIRMNGEKI-----HGASIH--DLISHNNRNLAQEIN 340
           S  +DV G++  Y   Y+R++GE I        + H    ++  +  L++E++
Sbjct: 40  SVTSDVRGLLELYQASYLRVHGEDILDEAISFTTHHLSLAVASLDHPLSEEVS 92


>2gzq_A Phosphatidylethanolamine-binding protein; structural
           genomics, PSI, protein structure initiative; HET: MSE;
           1.30A {Plasmodium vivax} PDB: 2r77_A (A:30-200)
          Length = 171

 Score = 27.4 bits (60), Expect = 3.2
 Identities = 8/47 (17%), Positives = 13/47 (27%)

Query: 170 TGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYL 216
           TG H I F+L     +      G   Y           +  +    +
Sbjct: 106 TGLHRISFILSLVKEENKGNVTGVPLYRGEHYITRVKFNNCQSAYNV 152


>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc,
           oxidoreductase; HET: MSE; 1.85A {Sulfolobus
           solfataricus} (A:1-147,A:297-347)
          Length = 198

 Score = 27.5 bits (60), Expect = 3.7
 Identities = 9/28 (32%), Positives = 15/28 (53%)

Query: 382 INDLITQTESLRKIRIALDLIEPNRVIG 409
           +   IT+T  L +   A+D +E  + IG
Sbjct: 165 VKPXITKTXKLEEANEAIDNLENFKAIG 192


>2j5c_A 1,8-cineole synthase; terpene synthases, 1, monoterpene,
           lyase; 1.95A {Salvia fruticosa} (A:119-224)
          Length = 106

 Score = 27.1 bits (60), Expect = 3.7
 Identities = 12/76 (15%), Positives = 25/76 (32%), Gaps = 16/76 (21%)

Query: 279 HDPEQEIDCFSDNTY----ASYLNDVIGIISSYTGEYIRMNGEKI----------HGASI 324
              ++  DCF +        S ++D  G++  Y   ++   GE+                
Sbjct: 23  SVSQEVFDCFKNAKGTDFKPSLVDDTRGLLQLYEASFLSAQGEETLRLARDFATKFLQKR 82

Query: 325 HDLISHNNRNLAQEIN 340
             ++   + NL   I 
Sbjct: 83  --VLVDKDINLLSSIE 96


>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein,
           coenzyme A, structural genomics, PSI-2, protein
           structure initiative; HET: SUC COA; 3.20A {Bacillus
           subtilis} (A:)
          Length = 163

 Score = 27.0 bits (59), Expect = 4.2
 Identities = 7/30 (23%), Positives = 10/30 (33%)

Query: 344 SNTMKDFHILKDRAENIESFDQMISENNPE 373
           SN M     L    + +E F +       E
Sbjct: 1   SNAMTKVERLLINYKTLEEFKKFKEYGIQE 30


>2dou_A Probable N-succinyldiaminopimelate aminotransferase;
           PLP-dependent enzyme, structural genomics, NPPSFA; HET:
           EPE; 2.30A {Thermus thermophilus HB8} (A:1-36,A:279-376)
          Length = 134

 Score = 26.4 bits (58), Expect = 7.2
 Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 1/54 (1%)

Query: 185 KTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG 238
           K   RE G     D  IG+      R      +  +  +   L+ ++    P  
Sbjct: 17  KRKARERG-VGLIDLSIGSTDKEVVRGYARVYRERALGMAEALKGVLSLLPPRA 69


>2gai_A DNA topoisomerase I; zinc ribbon; HET: DNA; 1.70A
           {Thermotoga maritima MSB8} PDB: 2gaj_A*
           (A:163-187,A:462-504,A:590-633)
          Length = 112

 Score = 26.0 bits (57), Expect = 8.2
 Identities = 18/115 (15%), Positives = 32/115 (27%), Gaps = 20/115 (17%)

Query: 280 DPEQEIDCFSDNTYASYLNDVIGIISS-YTGEYIRMNGEKIHGASIHDLISHNNRNLAQE 338
           D E+EI  F  +TYAS        I       YI+     ++              +   
Sbjct: 16  DREREILRFVPSTYAS-------TIKLLLNRGYIKKIRGYLYPTI-----------VGSV 57

Query: 339 INDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR 393
           + D       D   + D  + I    +     +P+G  +          +     
Sbjct: 58  VMDYLEKKYSDEIAVIDDGK-IFLGRKDSESGSPDGRSVEGKGNLSEKRRKGKKG 111


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.317    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0601    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 3,118,632
Number of extensions: 141729
Number of successful extensions: 383
Number of sequences better than 10.0: 1
Number of HSP's gapped: 383
Number of HSP's successfully gapped: 18
Length of query: 412
Length of database: 4,956,049
Length adjustment: 91
Effective length of query: 321
Effective length of database: 1,879,794
Effective search space: 603413874
Effective search space used: 603413874
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 56 (25.6 bits)