BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780635|ref|YP_003065048.1| hypothetical protein
CLIBASIA_02610 [Candidatus Liberibacter asiaticus str. psy62]
         (412 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780635|ref|YP_003065048.1| hypothetical protein CLIBASIA_02610 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 412

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/412 (100%), Positives = 412/412 (100%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT
Sbjct: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
           TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK
Sbjct: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
           ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW
Sbjct: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA
Sbjct: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
           TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV
Sbjct: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI
Sbjct: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP 412
           ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP
Sbjct: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP 412


>gi|254780624|ref|YP_003065037.1| ubiquinone/menaquinone biosynthesis methyltransferase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 265

 Score = 30.0 bits (66), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 44/92 (47%), Gaps = 5/92 (5%)

Query: 156 RKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEY 215
           R  HR + ++  ++ G H      W + + TN+    ++ Y   D+   TG    R  E 
Sbjct: 36  RVSHRYDVMNDLMSLGLH----RFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEA 91

Query: 216 LKVVSKILVSDLEEMMKAWGPDGQATKDLMKD 247
               S+I+V+D+   M + G D +A K+ ++D
Sbjct: 92  SDNRSQIVVADINNEMLSVGRD-RAFKENLQD 122


>537021.9.peg.1064_1 
          Length = 238

 Score = 29.6 bits (65), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 5/61 (8%)

Query: 22  PNVSLEK---VLQNYATIAHAKYEDALM--CARTLDSAIETLVTTPNKKNLENARLQWIR 76
           PN SLE+   +L NY T+   +YE A +     +L    E L T  + + L +  + W R
Sbjct: 132 PNASLEERKEILYNYPTMGSQQYEKAFLDRLQSSLQQDREDLETKLHNQGLVSGSVAWNR 191

Query: 77  A 77
           A
Sbjct: 192 A 192


>gi|255764461|ref|YP_003064629.2| methionyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 511

 Score = 26.9 bits (58), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 120 KENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTG 171
           KE E+  + TA    N++  +        +I  D+L + HR +G+D   TTG
Sbjct: 2   KEREKLYISTAIAYPNAQPHIGHA---YEMIIADVLARFHRLDGLDVLFTTG 50


>gi|254780127|ref|YP_003064540.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 675

 Score = 26.2 bits (56), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 23/53 (43%)

Query: 216 LKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELA 268
             V  K++ +  E + KAW    Q    L KD+  G   ++    S+S   +A
Sbjct: 492 FAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVA 544


>gi|254780549|ref|YP_003064962.1| signal peptide protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 271

 Score = 26.2 bits (56), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 54  AIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98
           +I+T+V  P+KK L +   +  R RIP Q + +    N+++  W+
Sbjct: 148 SIDTVVVRPDKKELLSKVEKSSRKRIPSQDA-IAIVRNRVIANWN 191


>gi|254780275|ref|YP_003064688.1| SsrA-binding protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 159

 Score = 25.4 bits (54), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 18/25 (72%)

Query: 291 NTYASYLNDVIGIISSYTGEYIRMN 315
           ++YA++ ND I + +SY  EY++ N
Sbjct: 53  DSYATFENDEIWLTNSYIPEYLQAN 77


>gi|254780765|ref|YP_003065178.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 268

 Score = 25.0 bits (53), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 4/70 (5%)

Query: 89  FGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANII---ANSKIIVNEKEI 145
            G  IV   D K+N   L  GF   +  +  +   +      NII     S+IIVN  + 
Sbjct: 49  IGRVIVAVDDTKINEIVLQAGFESVMTHTSHQSGSDRIFEALNIIDSDKKSQIIVN-MQA 107

Query: 146 DLSIISPDLL 155
           D+  I P++L
Sbjct: 108 DIPNIEPEIL 117


>gi|254780654|ref|YP_003065067.1| Glyceraldehyde 3-Phosphate Dehydrogenase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 333

 Score = 24.6 bits (52), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 15/22 (68%), Gaps = 1/22 (4%)

Query: 186 TNVREPGNRPYTDFDIG-NCTG 206
           T++R+P + P+ D D+   CTG
Sbjct: 77  TSIRDPQDLPWGDVDVAMECTG 98


>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 398

 Score = 24.6 bits (52), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 33/71 (46%), Gaps = 6/71 (8%)

Query: 310 EYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISE 369
           EY+R  G KI+  ++            Q++  K +++   F  + D  E +ESFD++  +
Sbjct: 333 EYMRNAGMKIYSVAVSAPPE------GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDK 386

Query: 370 NNPEGNKIVRN 380
              +  +I  N
Sbjct: 387 IQEQSVRIAPN 397


>gi|254780409|ref|YP_003064822.1| ribose-phosphate pyrophosphokinase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 310

 Score = 24.6 bits (52), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 10/76 (13%)

Query: 330 HNNRNLAQEINDKFSNTM--------KDFHILKDRAENIESFDQMI--SENNPEGNKIVR 379
           ++NRNLAQEI D    ++         D  +  +  EN+   D  I  S + P  + ++ 
Sbjct: 7   NSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPANDYLME 66

Query: 380 NLINDLITQTESLRKI 395
            LI     +  S R+I
Sbjct: 67  LLIMIDAVRRSSARRI 82


>537021.9.peg.410_1 
          Length = 952

 Score = 23.1 bits (48), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 8/21 (38%), Positives = 15/21 (71%)

Query: 82  QQSEVYRFGNKIVDTWDKKVN 102
           +Q  + RFGN+++D  D+ +N
Sbjct: 514 RQQFISRFGNEVIDVLDEFLN 534


>gi|254780698|ref|YP_003065111.1| D-alanyl-D-alanine carboxypeptidase 1 penicillin-binding protein
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 336

 Score = 23.1 bits (48), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 154 LLRKLHRANGIDTNIT--TGYHVIEFLLWGQD 183
           LL K+H  +GI T  T  +G++++  L +  D
Sbjct: 230 LLNKMHNIDGIKTGYTRNSGFNIVTSLRYKDD 261


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.317    0.135    0.392 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 277,660
Number of Sequences: 1233
Number of extensions: 12432
Number of successful extensions: 49
Number of sequences better than 100.0: 17
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 37
Number of HSP's gapped (non-prelim): 20
length of query: 412
length of database: 328,796
effective HSP length: 76
effective length of query: 336
effective length of database: 235,088
effective search space: 78989568
effective search space used: 78989568
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 39 (19.6 bits)