HHsearch alignment for GI: 254780636 and conserved domain: COG2176

>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair].
Probab=98.97  E-value=3.5e-09  Score=72.59  Aligned_cols=149  Identities=22%  Similarity=0.275  Sum_probs=100.1

Q ss_pred             HHHHCCCCCCEEEECCCCCCCCCCCEEEEEEEEEC---CCC------EEEECCCCCC--------------CCC------
Q ss_conf             57842489827997177789854450799998418---942------8997465778--------------570------
Q gi|254780636|r   13 AECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPG---DGT------VDIIRIAAGQ--------------KNA------   63 (207)
Q Consensus        13 ~~~~l~~~~~iaiDtEt~~l~~~~~~l~LiQl~~~---~~~------~~l~~~~~~~--------------~~~------   63 (207)
T Consensus       414 ~d~~l~datyVVfDiETTGLs~~~d~i--IE~aAvKikng~iId~f~~Fi~P~~pl~~~~telTgITdeml~~a~~i~~v  491 (1444)
T COG2176         414 DDQKLDDATYVVFDIETTGLSPVYDEI--IEIAAVKIKNGRIIDKFQFFIKPGRPLSATITELTGITDEMLENAPEIEEV  491 (1444)
T ss_pred             CCCCCCCCCEEEEEEECCCCCCCCCHH--HHHEEEEEECCCCHHHHHHHCCCCCCCCHHHHHCCCCCHHHHCCCCCHHHH
T ss_conf             445456550899985537767542015--620004433880437789750899967644542035679987488339999


Q ss_pred             -HHHHHHHHCCCCCEEECCCCHHHHHHHHHH---HCCC--CCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCEE
Q ss_conf             -677677732364023010000168886542---0000--0004578988652110000008877765420024675200
Q gi|254780636|r   64 -PNLVGMLVDEKREKIFHYGRFDIAVLFYTF---GVRV--RPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS  137 (207)
Q Consensus        64 -~~L~~ll~d~~i~KV~Hn~~~D~~~L~~~~---gi~~--~~i~DT~ias~l~~~~~~~~~L~~L~~~~lg~~ldK~~q~  137 (207)
T Consensus       492 L~kf~~~~~d-~Il-VAHNasFD~gFl~~~~~k~~~~~~~~pvIDTL~lar~L~P~~ksh~Lg~l~kk-~~v~l------  562 (1444)
T COG2176         492 LEKFREFIGD-SIL-VAHNASFDMGFLNTNYEKYGLEPLTNPVIDTLELARALNPEFKSHRLGTLCKK-LGVEL------  562 (1444)
T ss_pred             HHHHHHHHCC-CEE-EECCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCHHHHHCCHHHHHHH-HCCCH------
T ss_conf             9999998448-589-96167556457888899838851027501199999875745432466778887-48637------


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             365654432368999986459999999999999997491899999
Q gi|254780636|r  138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS  182 (207)
Q Consensus       138 SdW~~rpLs~~Qi~YAA~Dv~~l~~L~~~l~~~L~~~~~~~~~~~  182 (207)
T Consensus       563 ----------e~hHRA~yDaeat~~vf~~f~~~~ke~Gi~~l~el  597 (1444)
T COG2176         563 ----------ERHHRADYDAEATAKVFFVFLKDLKEKGITNLSEL  597 (1444)
T ss_pred             ----------HHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHH
T ss_conf             ----------87531010089999999999999988455659998