HHsearch alignment for GI: 254780636 and conserved domain: KOG2248

>KOG2248 consensus.
Probab=96.74  E-value=0.0021  Score=39.00  Aligned_cols=83  Identities=18%  Similarity=0.131  Sum_probs=51.5

Q ss_pred             HHHHHHCCCCCEEECCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHH-HCCCHHHHHHHHHHHCCCCCCCCEECCCCCCC
Q ss_conf             76777323640230100001688865420000000457898865211-00000088777654200246752003656544
Q gi|254780636|r   66 LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRT-YTNQHGLKDNLKELLGINISKAQQSSDWSADD  144 (207)
Q Consensus        66 L~~ll~d~~i~KV~Hn~~~D~~~L~~~~gi~~~~i~DT~ias~l~~~-~~~~~~L~~L~~~~lg~~ldK~~q~SdW~~rp  144 (207)
T Consensus       287 l~~~~~~~TIL-VGHSLenDL~aLKl~----H~~ViDTa~lf~~~~g~~~~k~sLk~L~~~~L~~~Iq-~----~~~~--  354 (380)
T KOG2248         287 LLELISKNTIL-VGHSLENDLKALKLD----HPSVIDTAVLFKHPTGPYPFKSSLKNLAKSYLGKLIQ-E----GVGG--  354 (380)
T ss_pred             HHHHCCCCCEE-EEECHHHHHHHHHHH----CCCEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHH-C----CCCC--
T ss_conf             99646867179-951003078897642----7742200588864889854259999999999889986-1----6778--


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             3236899998645999999999
Q gi|254780636|r  145 LSDEQLQYAASDVVHLHALRLQ  166 (207)
Q Consensus       145 Ls~~Qi~YAA~Dv~~l~~L~~~  166 (207)
T Consensus       355 ------HdS~eDA~acm~Lv~~  370 (380)
T KOG2248         355 ------HDSVEDALACMKLVKL  370 (380)
T ss_pred             ------CCCHHHHHHHHHHHHH
T ss_conf             ------7608889999999999