HHsearch alignment for GI: 254780636 and conserved domain: PRK06195

>PRK06195 DNA polymerase III subunit epsilon; Validated.
Probab=98.60  E-value=6.7e-07  Score=59.37  Aligned_cols=139  Identities=19%  Similarity=0.279  Sum_probs=81.8

Q ss_pred             CCEEEECCCCCCCCCCCEEEEEEEE-ECC-----CCEEEECCCCCC----------------CCC-------HHHHHHHH
Q ss_conf             8279971777898544507999984-189-----428997465778----------------570-------67767773
Q gi|254780636|r   21 DAIAVDTETLGLMPRRDRLCIVQLS-PGD-----GTVDIIRIAAGQ----------------KNA-------PNLVGMLV   71 (207)
Q Consensus        21 ~~iaiDtEt~~l~~~~~~l~LiQl~-~~~-----~~~~l~~~~~~~----------------~~~-------~~L~~ll~   71 (207)
T Consensus         2 ~fvviD~ETt~--~~~d~iieIg~v~v~~g~iv~~~~~Li~P~~~~~~p~~i~ihGIt~~~v~~aP~f~ev~~~~~~fi~   79 (309)
T PRK06195          2 DFVAIDFETAN--EKRNSPCSIGIVVVKDGEIVEKVHYLIKPKEMRFMPINIGIHGIRPHMVQDELEFDKIWEKIKDYFN   79 (309)
T ss_pred             CEEEEEEECCC--CCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCCCCCEEEECCCCHHHHHCCCCHHHHHHHHHHHHC
T ss_conf             29999978999--9998059999999999999999999989999888874464037799999659999999999999857


Q ss_pred             CCCCCEEECCCCHHHHHHHHH---HHCCC-C-CHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCC
Q ss_conf             236402301000016888654---20000-0-004578988652110000008877765420024675200365654432
Q gi|254780636|r   72 DEKREKIFHYGRFDIAVLFYT---FGVRV-R-PVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLS  146 (207)
Q Consensus        72 d~~i~KV~Hn~~~D~~~L~~~---~gi~~-~-~i~DT~ias~l~~~~~~~~~L~~L~~~~lg~~ldK~~q~SdW~~rpLs  146 (207)
T Consensus        80 ~~--vlVaHNa~FD~~fL~~~~~r~gl~~~~~~~~cTl~LAR~~~p~l~~~kL~~La~~-~gi~~~--------------  142 (309)
T PRK06195         80 DN--LVIAHNASFDISVLRKTLELYNIPMPDFEYICTMKLAKNFYSNIPNARLNTVNNF-LGYEFK--------------  142 (309)
T ss_pred             CC--EEEEECCHHHHHHHHHHHHHCCCCCCCCCEEEHHHHHHHHCCCCCCCCHHHHHHH-HCCCCC--------------
T ss_conf             99--7999562888999999999849999999777479999986557765788899998-598801--------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHH
Q ss_conf             36899998645999999999999999749189999
Q gi|254780636|r  147 DEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT  181 (207)
Q Consensus       147 ~~Qi~YAA~Dv~~l~~L~~~l~~~L~~~~~~~~~~  181 (207)
T Consensus       143 --h-H~Al~DA~A~a~I~~~~~~~~~~~~l~el~~  174 (309)
T PRK06195        143 --H-HDALEDAMACSNILLNISKELNSKSIEEISK  174 (309)
T ss_pred             --C-CCCCCCHHHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             --1-6851019999999999999818877899976