HHsearch alignment for GI: 254780636 and conserved domain: PRK08858

>PRK08858 consensus.
Probab=99.13  E-value=6.2e-10  Score=77.00  Aligned_cols=133  Identities=18%  Similarity=0.229  Sum_probs=83.5

Q ss_pred             CCCCCEEEECCCCCCCCCC----CEEEEEEEEEC---C-----CCE-EEECCCCCCC---------------CC------
Q ss_conf             4898279971777898544----50799998418---9-----428-9974657785---------------70------
Q gi|254780636|r   18 RYVDAIAVDTETLGLMPRR----DRLCIVQLSPG---D-----GTV-DIIRIAAGQK---------------NA------   63 (207)
Q Consensus        18 ~~~~~iaiDtEt~~l~~~~----~~l~LiQl~~~---~-----~~~-~l~~~~~~~~---------------~~------   63 (207)
T Consensus         8 ~~~R~VVlDtETTGl~~~~~~~~~gdRIIEIgaV~i~~~~~t~~~f~~~InP~r~Ip~~a~~ihGIT~e~L~daP~F~eI   87 (246)
T PRK08858          8 EYQRIVVLDTETTGMNREGGPHYEGHRIIEIGAVEIINRKLTGRHFHVYLKPDREIQPEAIDVHGITDEFLVDKPEYKDV   87 (246)
T ss_pred             CCCEEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEEECCEEECCEEEEEECCCCCCCHHHHHHCCCCHHHHHCCCCHHHH
T ss_conf             60479999857899997656777898799999999999998221478888979969988997739289998359758999


Q ss_pred             -HHHHHHHHCCCCCEEECCCCHHHHHHHHHHHC---CC------CCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCC
Q ss_conf             -67767773236402301000016888654200---00------000457898865211000000887776542002467
Q gi|254780636|r   64 -PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGV---RV------RPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK  133 (207)
Q Consensus        64 -~~L~~ll~d~~i~KV~Hn~~~D~~~L~~~~gi---~~------~~i~DT~ias~l~~~~~~~~~L~~L~~~~lg~~ldK  133 (207)
T Consensus        88 ~~efl~FI~d~~L--VaHNa~FD~~FLn~El~r~~~~~~~~~~~~~viDTL~lAR~~~P-g~~~sLdaLc~r-~~Id~--  161 (246)
T PRK08858         88 HQEFLEFIKGAEL--VAHNAPFDVGFMDYEFEKLNPAIGKTDDYCKVTDTLAMAKKIFP-GKRNNLDVLCER-YGIDN--  161 (246)
T ss_pred             HHHHHHHHCCCEE--EEECCHHHHHHHHHHHHHHCCCCCCHHHHCCCEEHHHHHHHHCC-CCCCCHHHHHHH-CCCCC--
T ss_conf             9999999589989--99722888999999999828776751342010029999998689-998888999998-19898--


Q ss_pred             CCEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             52003656544323689999864599999999999
Q gi|254780636|r  134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFT  168 (207)
Q Consensus       134 ~~q~SdW~~rpLs~~Qi~YAA~Dv~~l~~L~~~l~  168 (207)
T Consensus       162 ------------s~R~~HgALlDa~lLa~Vyl~mt  184 (246)
T PRK08858        162 ------------SHRTLHGALLDAEILADVYLLMT  184 (246)
T ss_pred             ------------CCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             ------------88340230888999999999972