HHsearch alignment for GI: 254780636 and conserved domain: TIGR01298

>TIGR01298 RNaseT ribonuclease T; InterPro: IPR005987 Ribonuclease T (3.1.13 from EC) is an enzyme found so far only in gamma-subdivision proteobacteria such as Escherichia coli and Xylella fastidiosa. Ribonuclease T is homologous to the DNA polymerase III alpha chain. It can liberate AMP from the common C-C-A terminus of uncharged tRNA. It appears also to be involved in RNA maturation. It also acts as a 3' to 5' single-strand DNA-specific exonuclease; it is distinctive for its ability to remove residues near a double-stranded stem. Ribonuclease T is a high copy suppressor in E. coli of a UV-repair defect caused by deletion of three other single-stranded DNA exonucleases.; GO: 0004540 ribonuclease activity, 0006396 RNA processing.
Probab=94.58  E-value=0.2  Score=27.50  Aligned_cols=135  Identities=21%  Similarity=0.280  Sum_probs=73.2

Q ss_pred             CCEEEECCCCCCCCCCC---EEEEEEEEE-------CCCC--EEEECCCCCCCCCH---------------------HHH
Q ss_conf             82799717778985445---079999841-------8942--89974657785706---------------------776
Q gi|254780636|r   21 DAIAVDTETLGLMPRRD---RLCIVQLSP-------GDGT--VDIIRIAAGQKNAP---------------------NLV   67 (207)
Q Consensus        21 ~~iaiDtEt~~l~~~~~---~l~LiQl~~-------~~~~--~~l~~~~~~~~~~~---------------------~L~   67 (207)
T Consensus         9 lPVVvDVET~GfN~~~dALLEiAait~~MDe~G~L~P~~~~~~~~~P~~Gani~P~~L~~~GI~~d~P~R~A~~E~~Al~   88 (201)
T TIGR01298         9 LPVVVDVETAGFNAKTDALLEIAAITLKMDEQGYLVPDETLHFHVEPFEGANIEPEALEFTGIDLDHPLRGAVEEKLALE   88 (201)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHCCCCCCEEECCCCEEEEEEECCCCCCCCCCCEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             43488610677660134555554200011673001478525788522679988712002206544887522466889999


Q ss_pred             HHHH----------CCCCCEEECCCCHHHHHHHHHH----HC-----CCCCHHHHHHHHHHHHHHCCCHHHHHHHHHH--
Q ss_conf             7773----------2364023010000168886542----00-----0000045789886521100000088777654--
Q gi|254780636|r   68 GMLV----------DEKREKIFHYGRFDIAVLFYTF----GV-----RVRPVFCTKIASRLTRTYTNQHGLKDNLKEL--  126 (207)
Q Consensus        68 ~ll~----------d~~i~KV~Hn~~~D~~~L~~~~----gi-----~~~~i~DT~ias~l~~~~~~~~~L~~L~~~~--  126 (207)
T Consensus        89 ~iF~~vR~~~K~~gC~RailV~HNa~fD~~Fl~~AA~~R~~~KRnPFH~F~~FDTatLAGl~--y----GQTVL~kA~Q~  162 (201)
T TIGR01298        89 EIFKVVRKALKASGCQRAILVAHNASFDLGFLNRAAVKRTALKRNPFHPFSVFDTATLAGLA--Y----GQTVLAKACQA  162 (201)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHH--H----HHHHHHHHHHH
T ss_conf             99999999997557960367600320466689999999861157898765224689998886--4----17999988864


Q ss_pred             HCCCCCCCCEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             2002467520036565443236899998645999999999999999749
Q gi|254780636|r  127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG  175 (207)
Q Consensus       127 lg~~ldK~~q~SdW~~rpLs~~Qi~YAA~Dv~~l~~L~~~l~~~L~~~~  175 (207)
T Consensus       163 Ag~---------~f-----d~~~AHSA~YDtE~TA~LFC~ivN~wk~~g  197 (201)
T TIGR01298       163 AGL---------DF-----DAKQAHSALYDTEKTAELFCEIVNRWKELG  197 (201)
T ss_pred             CCC---------CC-----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             278---------86-----754431012003568999998863045504