HHsearch alignment for GI: 254780636 and conserved domain: TIGR01406

>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit; InterPro: IPR006309 These represent DnaQ, the DNA polymerase III epsilon subunit, as found in most Proteobacteria. It consists largely of an exonuclease region as described in IPR006055 from INTERPRO. In Gram-positive bacteria, closely related regions are found both in the Gram-positive type DNA polymerase III alpha subunit and as an additional N-terminal domain of a DinG-family helicase. Both are not included in this set of sequences, as they are smaller proteins.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication.
Probab=99.01  E-value=4.6e-09  Score=71.92  Aligned_cols=130  Identities=26%  Similarity=0.345  Sum_probs=84.0

Q ss_pred             CEEEECCCCCCCCCC-----CEEEEEEEE---------ECCCCEEEECCCCCC-----------------CCCHH-----
Q ss_conf             279971777898544-----507999984---------189428997465778-----------------57067-----
Q gi|254780636|r   22 AIAVDTETLGLMPRR-----DRLCIVQLS---------PGDGTVDIIRIAAGQ-----------------KNAPN-----   65 (207)
Q Consensus        22 ~iaiDtEt~~l~~~~-----~~l~LiQl~---------~~~~~~~l~~~~~~~-----------------~~~~~-----   65 (207)
T Consensus         2 ~IiLDTETTGl~~~~G~~~~G-hRivEIGavE~vnr~~tG~~fH~Y~~P~Rd~p~eA~kVHGiT~efL~dKnaP~Fk~Ia   80 (246)
T TIGR01406         2 EIILDTETTGLDPKGGLPYIG-HRIVEIGAVELVNRMLTGKNFHVYVKPERDIPAEAAKVHGITDEFLKDKNAPKFKEIA   80 (246)
T ss_pred             EEEECCCCCCCCCCCCCCCCC-CEEEEEEEEEEECCCCCCCCEEEEECCCCCCHHHCEECCCCCHHHHCCCCCCCHHHHH
T ss_conf             267115556877667768568-6268882185673503887312433688877300210137646884688989525789


Q ss_pred             --HHHHHHCCCCCEEECCCCHHHHHHHHH---HH---CC----CCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCC
Q ss_conf             --767773236402301000016888654---20---00----0000457898865211000000887776542002467
Q gi|254780636|r   66 --LVGMLVDEKREKIFHYGRFDIAVLFYT---FG---VR----VRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK  133 (207)
Q Consensus        66 --L~~ll~d~~i~KV~Hn~~~D~~~L~~~---~g---i~----~~~i~DT~ias~l~~~~~~~~~L~~L~~~~lg~~ldK  133 (207)
T Consensus        81 ~~Fl~Fi~~~~L--vIHNA~FD~gFlN~EL~~Lg~~~~~~~~~~~~~~DTL~mAR~~-FPG~~~sLDALCkR-f~vD---  153 (246)
T TIGR01406        81 DEFLDFIKGSEL--VIHNAAFDVGFLNYELERLGLKEIKKISDFCRVIDTLAMARER-FPGKRNSLDALCKR-FKVD---  153 (246)
T ss_pred             HHHHHHHCCCEE--EEECCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHC-CCCCCCCHHHHHHH-HCCC---
T ss_conf             999998459889--9975702167899999872873210001366786568999723-78986646787743-0425---


Q ss_pred             CCEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5200365654432368999986459999999999999
Q gi|254780636|r  134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEK  170 (207)
Q Consensus       134 ~~q~SdW~~rpLs~~Qi~YAA~Dv~~l~~L~~~l~~~  170 (207)
T Consensus       154 -----------ns~R~LHGAL~DA~LLAeVYl~ltGG  179 (246)
T TIGR01406       154 -----------NSHRQLHGALLDAELLAEVYLALTGG  179 (246)
T ss_pred             -----------CCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             -----------00021347899999999999986288