HHsearch alignment for GI: 254780636 and conserved domain: cd05785

>cd05785 DNA_polB_like2_exo A subfamily of the 3'-5' exonuclease domain of family-B DNA polymerases. This subfamily is composed of uncharacterized bacterial family-B DNA polymerases. Family-B DNA polymerases contain an N-terminal DEDDy DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-A DNA polymerases. This exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are involved in metal binding and catalysis. The exonuclease domain of family-B DNA polymerases has a fundamental role in proofreading activity. It contains a beta hairpin structure that plays an important role in active site switching in the event of a nucleotide misincorporation. Family-B DNA polymerases are predominantly involved in DNA replication and DNA repair.
Probab=97.42  E-value=0.0031  Score=38.09  Aligned_cols=142  Identities=25%  Similarity=0.277  Sum_probs=76.4

Q ss_pred             CCCCCCEEEECCCCCCCCC--------CCEEEEEEEEECCCCEEEECCCCCCCCCHHHHH---HH--HCCCCCEEECCC-
Q ss_conf             2489827997177789854--------450799998418942899746577857067767---77--323640230100-
Q gi|254780636|r   17 ARYVDAIAVDTETLGLMPR--------RDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG---ML--VDEKREKIFHYG-   82 (207)
Q Consensus        17 l~~~~~iaiDtEt~~l~~~--------~~~l~LiQl~~~~~~~~l~~~~~~~~~~~~L~~---ll--~d~~i~KV~Hn~-   82 (207)
T Consensus         6 ~~~lr~lsfDIE~~~~~g~~~p~p~~~~d~Ii~I~~~~~~~~~~v~~~~~-~~E~~lL~~F~~~i~~~dPDII-tGyNi~   83 (207)
T cd05785           6 FDDLRRLQLDIETYSLPGFFFSNPDRGDDRIIIVALRDNRGWEEVLHAED-AAEKELLEELVAIIRERDPDVI-EGHNIF   83 (207)
T ss_pred             HHHEEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEECCCCEEEEEECC-CCHHHHHHHHHHHHHHCCCCEE-EECCCC
T ss_conf             20405999999747889977999888999789999885899779876269-9999999999999987399999-867987


Q ss_pred             CHHHHHHHHHHH---CC------------------------------CCC--HHHHHHHHHHHH--H-HCCCHHHHHHHH
Q ss_conf             001688865420---00------------------------------000--045789886521--1-000000887776
Q gi|254780636|r   83 RFDIAVLFYTFG---VR------------------------------VRP--VFCTKIASRLTR--T-YTNQHGLKDNLK  124 (207)
Q Consensus        83 ~~D~~~L~~~~g---i~------------------------------~~~--i~DT~ias~l~~--~-~~~~~~L~~L~~  124 (207)
T Consensus        84 ~FD~pYL~~Ra~~~~i~~~lgR~~~~~~~~~~~~~~~~~~~~~~~~~i~Gr~~lD~~~~~k~~~~~~~~L~SY~L~~Va~  163 (207)
T cd05785          84 RFDLPYLRRRCRRHGVPLAIGRDGSIPRQRPSRFRFAERLIDYPRYDIPGRHVIDTYFLVQLFDVSSRDLPSYGLKAVAK  163 (207)
T ss_pred             CCCHHHHHHHHHHHCCCCCCCCCCCCCEEECCEEEECCCCCCEEEEEECCEEEEEHHHHHHHHCCCCCCCCCCCHHHHHH
T ss_conf             75889999999995997222578987446403021223555304998736488654999986421114677652899999


Q ss_pred             HHHCCC-CCCCC----EECC-CCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             542002-46752----0036-565443236899998645999999
Q gi|254780636|r  125 ELLGIN-ISKAQ----QSSD-WSADDLSDEQLQYAASDVVHLHAL  163 (207)
Q Consensus       125 ~~lg~~-ldK~~----q~Sd-W~~rpLs~~Qi~YAA~Dv~~l~~L  163 (207)
T Consensus       164 ~~-~l~~~~k~~~~~~~i~~~~~~d~--~~l~~Yni~Dv~~t~~L  205 (207)
T cd05785         164 HF-GLASPDRTYIDGRQIAEVWRSDP--ARLLAYALDDVRETEGL  205 (207)
T ss_pred             HH-HHCCCCCCCCCHHHHHHHHHCCH--HHHHHHHHHHHHHHHHH
T ss_conf             87-31366656388999999995298--99999829999999986