HHsearch alignment for GI: 254780636 and conserved domain: cd06128

>cd06128 DNA_polA_exo The 3'-5' exonuclease domain of family-A DNA polymerases has a fundamental role in reducing polymerase errors and is involved in proofreading activity. Family-A DNA polymerases contain a DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-B DNA polymerases. The exonuclease domain contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, which are clustered around the active site and contain four invariant acidic residues that serve as ligands for the two metal ions required for catalysis. The Klenow fragment (KF) of Escherichia coli pol I, the Thermus aquaticus (Taq) pol I, and Bacillus stearothermophilus (BF) pol I are examples of family-A DNA polymerases. They are involved in nucleotide excision repair and in the processing of Okazaki fragments that are generated during lagging strand synthesis. The N-terminal domains of BF pol I and Taq pol I resemble the fold of the 3'-5' exonuclease domain of KF
Probab=99.98  E-value=5.8e-32  Score=205.03  Aligned_cols=147  Identities=24%  Similarity=0.255  Sum_probs=125.6

Q ss_pred             CCCEEEECCCCCCCCCCCEEEEEEEEECCCCEEEECCCCCCCCC----------HHHHHHHHCCCCCEEECCCCHHHHHH
Q ss_conf             98279971777898544507999984189428997465778570----------67767773236402301000016888
Q gi|254780636|r   20 VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA----------PNLVGMLVDEKREKIFHYGRFDIAVL   89 (207)
Q Consensus        20 ~~~iaiDtEt~~l~~~~~~l~LiQl~~~~~~~~l~~~~~~~~~~----------~~L~~ll~d~~i~KV~Hn~~~D~~~L   89 (207)
T Consensus         1 a~~~a~DtETt~ld~~~a~iVGis~s~~~~~a~YiP~~h~~~~~~~~l~~~~vl~~L~p~led~~i~KighNlK~D~~vL   80 (166)
T cd06128           1 APVFAFDTETDSLDNISANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERALELLKPLLEDEKALKVGQNLKYDRGIL   80 (166)
T ss_pred             CCEEEEECCCCCCCCCCCEEEEEEEECCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECHHHHHHHH
T ss_conf             99899978879989043549999998008969999526776675257789999999999973999764531156679999


Q ss_pred             HHHHHCCCCCH-HHHHHHHHHHHHHCCCHHHHHHHHHHHCCCC-------CCCCEECCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             65420000000-4578988652110000008877765420024-------675200365654432368999986459999
Q gi|254780636|r   90 FYTFGVRVRPV-FCTKIASRLTRTYTNQHGLKDNLKELLGINI-------SKAQQSSDWSADDLSDEQLQYAASDVVHLH  161 (207)
Q Consensus        90 ~~~~gi~~~~i-~DT~ias~l~~~~~~~~~L~~L~~~~lg~~l-------dK~~q~SdW~~rpLs~~Qi~YAA~Dv~~l~  161 (207)
T Consensus        81 ~~~-Gi~l~g~~fDTMlaaylldp~~~~h~Ld~La~~~L~~~~i~~~dl~GkGk~q~~f~~v~i-~~~~~YA~eDAd~t~  158 (166)
T cd06128          81 ANY-GIELRGIAFDTMLESYILNSVAGRHDMDSLAERWLKHKTITFEEIAGKGKNQLTFNQIAL-EEAGRYAAEDADVTL  158 (166)
T ss_pred             HHC-CCCCCCCCCCHHHHHHHCCCCCCCCCHHHHHHHHCCCCCEEHHHHHCCCCCCCCCCCCCH-HHHHHHHHHHHHHHH
T ss_conf             619-966899984576798762899988996999999839987059998378857589322899-999998999999999


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254780636|r  162 ALRLQFT  168 (207)
Q Consensus       162 ~L~~~l~  168 (207)
T Consensus       159 rL~~~l~  165 (166)
T cd06128         159 QLHLKMW  165 (166)
T ss_pred             HHHHHHC
T ss_conf             9998538